summaryrefslogtreecommitdiff
diff options
context:
space:
mode:
-rw-r--r--.gitignore6
-rw-r--r--access/ent2api.c2
-rw-r--r--api/sqnutil3.c2
-rw-r--r--connect/ncbi_gnutls.c2
-rw-r--r--connect/ncbi_http_connector.c8
-rw-r--r--connect/ncbi_util.c4
-rw-r--r--connect/urlquery.c3
-rw-r--r--corelib/ncbimain.c8
-rw-r--r--corelib/ncbitime.c21
-rw-r--r--debian/.gitignore15
-rw-r--r--debian/.ncbirc74
-rw-r--r--debian/.nlmstmanrc646
-rw-r--r--debian/Cn3D-3.0.desktop.in3
-rw-r--r--debian/NOTES2
-rw-r--r--debian/Psequin.desktop.in3
-rw-r--r--debian/README.test8
-rw-r--r--debian/TODO2
-rw-r--r--debian/bkgd.gifbin0 -> 1140 bytes
-rw-r--r--debian/changelog1264
-rw-r--r--debian/compat1
-rw-r--r--debian/control163
-rw-r--r--debian/copyright64
-rw-r--r--debian/ddv.desktop.in3
-rw-r--r--debian/entrez2.desktop.in3
-rw-r--r--debian/header-deps5
-rw-r--r--debian/help2man127
-rw-r--r--debian/installman56
-rw-r--r--debian/left.gifbin0 -> 895 bytes
-rw-r--r--debian/libncbi6-dev.NEWS.debian7
-rw-r--r--debian/libncbi6-dev.README.debian5
-rw-r--r--debian/libncbi6-dev.docs4
-rw-r--r--debian/libncbi6-dev.install203
-rw-r--r--debian/libncbi6.doc-base13
-rw-r--r--debian/libncbi6.docs7
-rw-r--r--debian/libncbi6.examples1
-rw-r--r--debian/libncbi6.install13
-rw-r--r--debian/libncbi6.symbols11649
-rw-r--r--debian/libvibrant6-dev.install87
-rw-r--r--debian/libvibrant6-dev.postinst13
-rw-r--r--debian/libvibrant6b.install5
-rw-r--r--debian/libvibrant6b.lintian-overrides1
-rw-r--r--debian/libvibrant6b.symbols2469
-rw-r--r--debian/makemenu66
-rw-r--r--debian/man/Cn3D-3.0.126
-rw-r--r--debian/man/vibrate.121
-rw-r--r--debian/ncbi-cn3d.install1
-rw-r--r--debian/ncbi-cn3d.mime2
-rw-r--r--debian/ncbi-cn3d.postinst8
-rw-r--r--debian/ncbi-cn3d.prerm5
-rw-r--r--debian/ncbi-tools-bin.docs8
-rw-r--r--debian/ncbi-tools-bin.examples2
-rw-r--r--debian/ncbi-tools-bin.install36
-rw-r--r--debian/ncbi-tools-bin.lintian-overrides2
-rw-r--r--debian/ncbi-tools-x11.doc-base.firewall11
-rw-r--r--debian/ncbi-tools-x11.doc-base.sequin15
-rw-r--r--debian/ncbi-tools-x11.docs5
-rw-r--r--debian/ncbi-tools-x11.install5
-rw-r--r--debian/ncbi-tools-x11.links2
-rw-r--r--debian/ncbi-tools-x11.lintian-overrides1
-rw-r--r--debian/ncbi2.css184
-rw-r--r--debian/patches/debian-changes955
-rw-r--r--debian/patches/series1
-rwxr-xr-xdebian/rules225
-rw-r--r--debian/sbtedit.desktop.in3
-rw-r--r--debian/source/format1
-rw-r--r--debian/source/include-binaries7
-rw-r--r--debian/source/options1
-rw-r--r--debian/source/patch-header1
-rw-r--r--debian/spacer10.gifbin0 -> 50 bytes
-rw-r--r--debian/tests/control3
-rw-r--r--debian/tests/run-unit-test220
-rw-r--r--debian/tests/test-data/Sc_16.fsa14
-rw-r--r--debian/tests/test-data/Sc_16.sbt139
-rw-r--r--debian/tests/test-data/Sc_16.tbl6
-rw-r--r--debian/tests/test-data/dsRNA_viruses.ags.gzbin0 -> 625732 bytes
-rw-r--r--debian/tests/test-data/dsRNA_viruses.gene_info.gzbin0 -> 28072 bytes
-rw-r--r--debian/tests/test-data/idfetch_g1234.npset457
-rw-r--r--debian/tests/test-data/nc0225.aso.gzbin0 -> 411571 bytes
-rw-r--r--debian/tests/test-data/spidey_genome.fasta.gzbin0 -> 324752 bytes
-rw-r--r--debian/tests/test-data/spidey_mRNA.fasta83
-rw-r--r--debian/tests/test-data/trnascan-se_sample.output49
-rw-r--r--debian/udv.desktop.in3
-rw-r--r--debian/upstream/metadata26
-rw-r--r--debian/vibrate20
-rw-r--r--debian/watch3
-rw-r--r--demo/asndisc.c3
-rw-r--r--demo/entrez2.c6
-rw-r--r--demo/findspl.c4
-rw-r--r--demo/gbseqget.c4
-rw-r--r--demo/insdseqget.c4
-rw-r--r--demo/nps2gps.c4
-rw-r--r--demo/taxblast_main.c4
-rw-r--r--demo/tbl2asn.c5
-rw-r--r--desktop/bspview.c6
-rw-r--r--doc/dispatcher.html10
-rw-r--r--doc/firewall.html16
-rwxr-xr-xdoc/fwd_check.sh2
-rw-r--r--doc/man/cleanasn.18
-rw-r--r--doc/man/taxblast.131
-rw-r--r--make/makeall.unx22
-rw-r--r--make/makedemo.unx5
-rw-r--r--make/makenet.unx38
-rw-r--r--make/makeshlb.unx112
-rw-r--r--tools/readdb.c5
-rw-r--r--vibrant/netscape.c5
-rw-r--r--vibrant/shim3d.c15
-rw-r--r--vibrant/vibmain.c15
-rw-r--r--vibrant/vibwndws.c2
108 files changed, 19854 insertions, 61 deletions
diff --git a/.gitignore b/.gitignore
new file mode 100644
index 00000000..460a3226
--- /dev/null
+++ b/.gitignore
@@ -0,0 +1,6 @@
+bin
+build
+include
+lib
+shlib
+*-stamp
diff --git a/access/ent2api.c b/access/ent2api.c
index b8828347..823c2d09 100644
--- a/access/ent2api.c
+++ b/access/ent2api.c
@@ -1273,7 +1273,7 @@ NLM_EXTERN CONN EntrezOpenConnection (
*arg = '\0';
return QUERY_OpenServiceQueryEx
- (StringHasNoText (e2_service) ? "Entrez2" : e2_service, NULL, 30, arg);
+ (StringHasNoText (e2_service) ? "Entrez2s" : e2_service, NULL, 30, arg);
}
#ifdef OS_MAC
diff --git a/api/sqnutil3.c b/api/sqnutil3.c
index 553dd506..0f4cba63 100644
--- a/api/sqnutil3.c
+++ b/api/sqnutil3.c
@@ -33198,7 +33198,7 @@ ClickableItemPtr LIBCALL ClickableGlobalItemCategorize (ValNodePtr list, int ite
cip->clickable_item_type = item_type;
cip->description
= (CharPtr) MemNew ( sizeof (Char) * (StringLen (fmt) + 15));
- sprintf (cip->description, fmt);
+ strcpy (cip->description, fmt);
return cip;
}
return NULL;
diff --git a/connect/ncbi_gnutls.c b/connect/ncbi_gnutls.c
index 875163cd..d29136a8 100644
--- a/connect/ncbi_gnutls.c
+++ b/connect/ncbi_gnutls.c
@@ -585,6 +585,7 @@ static EIO_Status s_GnuTlsInit(FSSLPull pull, FSSLPush push)
assert(!s_GnuTlsCredAnon);
+#if 0
version = gnutls_check_version(0);
if (strcasecmp(GNUTLS_VERSION, version) != 0) {
CORE_LOGF(eLOG_Critical,
@@ -592,6 +593,7 @@ static EIO_Status s_GnuTlsInit(FSSLPull pull, FSSLPush push)
GNUTLS_VERSION, version));
assert(0);
}
+#endif
val = ConnNetInfo_GetValue(0, "GNUTLS_LOGLEVEL", buf, sizeof(buf), 0);
CORE_LOCK_READ;
diff --git a/connect/ncbi_http_connector.c b/connect/ncbi_http_connector.c
index 74afd7e6..d6adf318 100644
--- a/connect/ncbi_http_connector.c
+++ b/connect/ncbi_http_connector.c
@@ -240,8 +240,14 @@ static int/*bool*/ x_UnsafeRedirectOK(SHttpConnector* uuu)
if (uuu->unsafe_redir == eDefault) {
if (!(uuu->flags & fHTTP_UnsafeRedirects)) {
char val[32];
+ const char* dflt = NULL;
+ if (uuu->net_info->scheme == eURL_Https
+ && (strspn(uuu->net_info->host, "0123456789.")
+ == strlen(uuu->net_info->host))) {
+ dflt = "TRUE";
+ }
ConnNetInfo_GetValue(0, "HTTP_UNSAFE_REDIRECTS",
- val, sizeof(val), 0);
+ val, sizeof(val), dflt);
uuu->unsafe_redir = ConnNetInfo_Boolean(val) ? eOn : eOff;
} else
uuu->unsafe_redir = eOn;
diff --git a/connect/ncbi_util.c b/connect/ncbi_util.c
index d29ca350..f986ccdb 100644
--- a/connect/ncbi_util.c
+++ b/connect/ncbi_util.c
@@ -49,7 +49,9 @@
# ifndef NCBI_OS_SOLARIS
# include <limits.h>
# endif /*!NCBI_OS_SOLARIS*/
-# ifdef NCBI_OS_LINUX
+# ifdef __MACH__
+# include <mach/vm_param.h>
+# elif defined(NCBI_OS_LINUX)
# include <sys/user.h>
# endif /*NCBI_OS_LINUX*/
# include <pwd.h>
diff --git a/connect/urlquery.c b/connect/urlquery.c
index 626a15e1..da1dc619 100644
--- a/connect/urlquery.c
+++ b/connect/urlquery.c
@@ -128,7 +128,10 @@ NLM_EXTERN CONN QUERY_OpenUrlQuery (
}
if ( host_port ) {
net_info->port = host_port;
+ } else {
+ net_info->scheme = eURL_Https;
}
+
StringNCpy_0 (net_info->path, host_path, sizeof (net_info->path));
if (StringDoesHaveText (arguments)) {
StringNCpy_0 (net_info->args, arguments, sizeof (net_info->args));
diff --git a/corelib/ncbimain.c b/corelib/ncbimain.c
index 3abcdf28..ca788e3e 100644
--- a/corelib/ncbimain.c
+++ b/corelib/ncbimain.c
@@ -67,6 +67,7 @@
#pragma segment NlmSegA
#endif
+extern Nlm_Int2 Nlm_Main(void) __attribute__((weak));
/*****************************************************************************
*
@@ -95,7 +96,12 @@ main(int argc, char *argv[])
/* Initialize connection library's logger, registry and lock */
CONNECT_Init(0);
- retval = Nlm_Main();
+ if (Nlm_Main) {
+ retval = Nlm_Main();
+ } else {
+ ErrPost(0, 0, "Neither main nor Nlm_Main defined by program.");
+ retval = -1;
+ }
NlmThreadJoinAll();
diff --git a/corelib/ncbitime.c b/corelib/ncbitime.c
index 9c6ac630..f8964054 100644
--- a/corelib/ncbitime.c
+++ b/corelib/ncbitime.c
@@ -77,6 +77,7 @@
#include <ncbi.h>
#include <ncbithr.h>
#include <ncbiwin.h>
+#include <stdlib.h>
#ifdef OS_UNIX
#include <sys/times.h>
@@ -108,8 +109,18 @@ NLM_EXTERN time_t LIBCALL Nlm_GetSecs (void)
*****************************************************************************/
NLM_EXTERN Nlm_Boolean LIBCALL Nlm_GetDayTime (Nlm_DayTimePtr dtp)
{
+ /* This function honors the SOURCE_DATE_EPOCH specificatin
+ (https://reproducible-builds.org/specs/source-date-epoch/) */
+ const char *sde = getenv("SOURCE_DATE_EPOCH");
#if (defined(SOLARIS_THREADS_AVAIL) || defined(POSIX_THREADS_AVAIL) || defined(WIN32)) && !defined(OS_UNIX_DARWIN)
- time_t t = time( NULL );
+ time_t t;
+ if (sde) {
+ t = strtoul(sde, NULL, 0);
+ if (t == 0)
+ return FALSE;
+ } else {
+ t = time( NULL );
+ }
#ifdef WIN32
static TNlmMutex localtime_lock;
if (NlmMutexLockEx( &localtime_lock ) != 0)
@@ -125,7 +136,13 @@ NLM_EXTERN Nlm_Boolean LIBCALL Nlm_GetDayTime (Nlm_DayTimePtr dtp)
time_t ltime;
struct tm *dt;
Nlm_MemFill ((Nlm_VoidPtr) dtp, 0, sizeof(Nlm_DayTime));
- time(&ltime);
+ if (sde) {
+ ltime = strtoul(sde, NULL, 0);
+ if (ltime == 0)
+ return FALSE;
+ } else {
+ time(&ltime);
+ }
if ((dt = localtime (&ltime)) != NULL)
{
Nlm_MemCopy ((Nlm_VoidPtr) dtp, (Nlm_VoidPtr) dt, sizeof (struct tm));
diff --git a/debian/.gitignore b/debian/.gitignore
new file mode 100644
index 00000000..afd21109
--- /dev/null
+++ b/debian/.gitignore
@@ -0,0 +1,15 @@
+*.xpm
+*.debhelper
+*.debhelper.log
+*.substvars
+files
+libncbi6
+libvibrant6b
+lib*-dbg
+lib*-dev
+ncbi-cn3d
+ncbi-data
+ncbi-rrna-data
+ncbi-tools-bin
+ncbi-tools-x11
+tmp
diff --git a/debian/.ncbirc b/debian/.ncbirc
new file mode 100644
index 00000000..4c7510d8
--- /dev/null
+++ b/debian/.ncbirc
@@ -0,0 +1,74 @@
+[LINKS]
+CHANNELS=LINKS_FROM_MEDLINE, LINKS_FROM_SEQUENCE
+
+[SEQUENCE_CD_DESC]
+MEDIA=ENTREZ_SEQ_CD
+
+[REFERENCE_FROM_NET]
+MEDIA=ENTREZ_NET
+
+[SEQUENCE_FROM_NET]
+MEDIA=ENTREZ_NET
+
+[LINKS_FROM_NET]
+MEDIA=ENTREZ_NET
+ENTR_SEQ__ENTR_SEQ=1
+ENTR_SEQ__ENTR_REF=1
+ENTR_REF__ENTR_SEQ=1
+ENTR_REF__ENTR_REF=1
+
+[NCBI]
+DATA=/usr/share/ncbi/data/
+MEDIA=ENTREZ_NET
+AsnLoad=
+
+[ENTR_LINK]
+CHANNELS=LINKS_FROM_NET
+
+[ENTR_REF]
+CHANNELS=REFERENCE_FROM_NET
+
+[ENTR_SEQ]
+CHANNELS=SEQUENCE_FROM_NET
+
+[ENTREZ]
+SERVICES=ENTR_LINK, ENTR_REF, ENTR_SEQ
+
+[ENTREZ_NET]
+TYPE=NET
+SERVICE_NAME=Entrez
+RESOURCE_NAME=Entrez
+RESOURCE_TYPE=Entrez
+SERV_VERS_MIN=1
+SERV_VERS_MAX=0
+RES_VERS_MIN=150
+RES_VERS_MAX=0
+FORMAL_NAME=Entrez Network Service
+
+[NET_SERV]
+DISPATCHER=130.14.25.211
+DISP_ALT_1=dispatch1.nlm.nih.gov
+DISP_ALT_2=130.14.25.47
+DISP_ALT_3=dispatch2.nlm.nih.gov
+DISP_ALT_4=dispatch3.nlm.nih.gov
+DISP_ALT_5=130.14.25.1
+DISPSERIALNO=6
+DISP_USERNAME=letondal
+DISP_RECONN_ACTION=CONT
+
+[FONTS]
+JOURNAL=Helvetica,12,i
+VOLUME=Helvetica,12,b
+PAGES=Helvetica,12
+TITLE=Times,18,b
+AUTHORS=Times,18
+AFFILIATION=Times,14
+ABSTRACT=Times,14
+MESH=Times,12
+HEADING=Helvetica,14,b
+REFERENCE=Helvetica,12
+SEQUENCE=Courier,12
+STANDARD=Times,12
+DISPLAY=Courier,10
+FETCHED=Times,14
+
diff --git a/debian/.nlmstmanrc b/debian/.nlmstmanrc
new file mode 100644
index 00000000..22c17493
--- /dev/null
+++ b/debian/.nlmstmanrc
@@ -0,0 +1,646 @@
+[style1]
+PPPPAAAA=AACAAAAE
+PPPPAAAC=AAGAAAADAAAAAAAB
+AAACAAAB=AAACAAPPAAPP
+AAACAAAC=AAABAB
+AAACAAAD=AAACAAAAPPAA
+AAACAAAE=AAICAAPPAAAAAAAC
+AAACAAAG=AACAAAAE
+AAADAAAG=AACAAAAF
+AAAEAAAG=AACAAAAI
+AAAHAAAG=AACAAAAJ
+AAAIAAAG=AACAAAAK
+AAAJAAAG=AACAAAAL
+AAAKAAAG=AACAAAAM
+AAAMAAAG=AACAAAAA
+AAANAAAG=AACAAAAN
+AAAOAAAG=AACAAAAO
+AAAPAAAG=AACAAAAP
+AABAAAAG=AACAAABA
+AABBAAAG=AACAAABB
+AABCAAAG=AACAAABC
+AABDAAAG=AACAAABD
+AABEAAAG=AACAAABE
+AABFAAAG=AACAAABF
+AABGAAAG=AACAAABG
+AABHAAAG=AACAAAAG
+AABKAAAG=AACAAAAH
+AABLAAAG=AACAAAAC
+AABMAAAG=AACAAABI
+AABNAAAG=AACAAABJ
+AABOAAAG=AACAAABK
+AABPAAAG=AACAAABL
+AACAAAAG=AACAAABM
+AACBAAAG=AACAAABN
+AACCAAAG=AACAAABO
+AACDAAAG=AACAAABP
+AACEAAAG=AACAAACA
+AACFAAAG=AACAAACB
+AACGAAAG=AACAAACC
+AACHAAAG=AACAAACD
+AACIAAAG=AACAAACE
+AACJAAAG=AACAAACF
+AACKAAAG=AACAAACG
+AACLAAAG=AACAAACH
+AACMAAAG=AACAAAAB
+AADBAAAG=AACAAAAF
+AADCAAAF=AACAAAAE
+AADCAAAG=AACAAAAE
+AADDAAAG=AACAAAAD
+AADEAAAG=AACAAACM
+AADFAAAG=AACAAACN
+AADGAAAG=AACAAACO
+AADHAAAG=AACAAAAC
+AADIAAAG=AACAAAAA
+AADJAAAG=AACAAACP
+AADKAAAG=AACAAADA
+AADLAAAG=AACAAADB
+AADMAAAG=AACAAADC
+AADNAAAG=AACAAADD
+AADOAAAG=AACAAADE
+AADPAAAG=AACAAADF
+AAEAAAAG=AACAAADG
+AAEBAAAG=AACAAADH
+AAECAAAG=AACAAADI
+AAEDAAAG=AACAAADJ
+AAEEAAAG=AACAAADK
+AAEFAAAG=AACAAADL
+AAEGAAAG=AACAAADM
+AAEHAAAG=AACAAADN
+AAEIAAAG=AACAAAAB
+AAEKAAAG=AACAAADO
+AAELAAAG=AACAAADP
+AAEMAAAG=AACAAAEA
+AAENAAAG=AACAAAEB
+AAEOAAAG=AACAAAEC
+AAEPAAAG=AACAAAED
+AAFAAAAG=AACAAAEE
+AAFBAAAG=AACAAAEF
+AAFCAAAG=AACAAAEG
+AAFDAAAG=AACAAAEI
+AAFEAAAG=AACAAAEH
+PPPPAAAE=EACAAAACexon-intron
+AAAEAAAB=ABACAAPPAAAAAAAAAAAE
+AAAEAAAE=AAICAAPPAAAAAAAC
+PPPNAAAB=AAACAAAAPPPP
+AAADAAAE=AAICAAAAIAAAAAAL
+AAAFAAAB=ABACAAAAIAIAAAAAAAAE
+AAAFAAAE=AAICAAPPAAAAAAAN
+AABIAAAF=AACAAAAE
+AABIAAAG=AACAAAAB
+AABJAAAG=AACAAABH
+AABLAAAF=AACAAAAE
+AADDAAAF=AACAAAAE
+AAAFAAAD=AAACAAPPAAPP
+AAALAAAG=AACAAAAD
+AAABAAAB=ABACAAAAPPPPAAAAAAAE
+AAAFAAAF=AACAAAAB
+AAAGAAAG=AACAAAAE
+AACMAAAB=ABACAAAAIAIAAAAAAAAE
+AACMAAAF=AACAAAAB
+AABAAAAB=AAECAAPPAAPPAAAAAABD
+AACKAAAB=AAECAAAAAAPPAAAAAABE
+AACLAAAB=AAECAAAAAAPPAAAAAABE
+AACPAAAB=AAECAAAAIAIAAAAAAABC
+AADBAAAB=AAECAAPPAAAAAAAAAABC
+AAEIAAAB=AAEAAAAAAABC
+AAEHAAAB=AAECAAPPAAPPAAAAAABE
+AAEHAAAE=AAACAAAAAAPP
+PPPMAAAC=AAABAB
+PPPMAAAE=AAMAAAAAAAAEAABD
+AAADAAAD=AAACAAAAIAAA
+AACMAAAD=AAECAAPPAAAAAAAAAAAC
+PPPOAAAB=AABAAC
+AAAAAAAE=AAGAAABEAAAAAAAC
+AAAGAAAE=AAIAAAAP
+PPPMAAAB=ABAAAAAAAAAG
+AAADAAAC=AAACAAAAAAPP
+PPPLAAAE=AAICAAAAIAAAAAAC
+AAABAAAE=AAIAAAAO
+PPPJAAAB=AAACAAPPAAAA
+PPPJAAAE=AAICAAPPAAAAAAAK
+PPPKAAAB=AAACAAAAAAPP
+PPPKAAAE=AAICAAAAIAAAAAAJ
+AAAAAAAB=ABAAAAAAAAAD
+AAADAAAB=ABAAAAAAAAAE
+AAAGAAAB=ABAAAAAAAAAE
+AAAHAAAB=ABAAAAAAAAAE
+AAAIAAAB=ABAAAAAAAAAE
+AAAJAAAB=ABAAAAAAAAAE
+AAAKAAAB=ABAAAAAAAAAE
+AAANAAAB=ABAAAAAAAAAE
+AAAOAAAB=ABAAAAAAAAAE
+AAAPAAAB=ABAAAAAAAAAE
+AABBAAAB=ABAAAAAAAAAE
+AABCAAAB=ABAAAAAAAAAE
+AABDAAAB=ABAAAAAAAAAE
+AABEAAAB=ABAAAAAAAAAE
+AABFAAAB=ABAAAAAAAAAE
+AABGAAAB=ABAAAAAAAAAE
+AABHAAAB=ABAAAAAAAAAE
+AABIAAAB=ABACAAPPAAPPAAAAAAAE
+AABIAAAE=AAIAAABB
+AABJAAAB=ABAAAAAAAAAE
+AABKAAAB=ABAAAAAAAAAE
+AABLAAAB=ABACAAAAPPPPAAAAAAAE
+AABLAAAE=AAIAAABB
+AABMAAAB=ABAAAAAAAAAE
+AABNAAAB=ABAAAAAAAAAE
+AABOAAAB=ABAAAAAAAAAE
+AABPAAAB=ABAAAAAAAAAE
+AACAAAAB=ABAAAAAAAAAE
+AACBAAAB=ABAAAAAAAAAE
+AACCAAAB=ABAAAAAAAAAE
+AACDAAAB=ABAAAAAAAAAE
+AACEAAAB=ABAAAAAAAAAE
+AACFAAAB=ABAAAAAAAAAE
+AACMAAAE=AAIAAAAM
+AADCAAAB=ABAAAAAAAAAE
+AADCAAAE=AAIAAABB
+AADDAAAB=ABAAAAAAAAAE
+AADDAAAE=AAIAAABB
+PPPNAAAE=AAACAAPPPPAA
+AAEKAAAB=ABAAAAAAAAAE
+AAEKAAAE=AAIAAABB
+
+[SYSTEM]
+STYLE1=style1
+styles=3
+fonts=24
+STYLE2=style2
+
+[SYSTEMFONT:2]
+name=Times Roman
+size=12
+style=0
+charset=1
+pitch=2
+family=1
+
+[SYSTEMFONT:1]
+name=Helvetica
+size=12
+style=0
+charset=1
+pitch=2
+family=2
+
+[SYSTEMFONT:3]
+name=Courier
+size=12
+style=0
+charset=1
+pitch=1
+family=3
+
+[SYSTEMFONT:4]
+name=Courier
+size=12
+style=0
+charset=1
+pitch=1
+family=3
+
+[SYSTEMFONT:7]
+name=helvetica
+size=14
+style=3
+charset=0
+pitch=0
+family=0
+
+[SYSTEMFONT:6]
+name=Helvetica
+size=12
+style=0
+charset=1
+pitch=2
+family=2
+
+[SYSTEMFONT:5]
+name=Courier
+size=12
+style=0
+charset=1
+pitch=1
+family=3
+
+[SYSTEMFONT:8]
+name=courier
+size=12
+style=3
+charset=0
+pitch=0
+family=0
+
+[SYSTEMFONT:10]
+name=Helvetica
+size=14
+style=0
+charset=1
+pitch=2
+family=2
+
+[SYSTEMFONT:9]
+name=courier
+size=14
+style=3
+charset=0
+pitch=0
+family=0
+
+[SYSTEMFONT:11]
+name=times
+size=10
+style=1
+charset=0
+pitch=0
+family=0
+
+[SYSTEMFONT:17]
+name=Courier
+size=12
+style=0
+charset=1
+pitch=1
+family=3
+
+[SYSTEMFONT:16]
+name=serif
+size=11
+style=0
+charset=0
+pitch=0
+family=0
+
+[SYSTEMFONT:15]
+name=helvetica
+size=10
+style=3
+charset=0
+pitch=0
+family=0
+
+[SYSTEMFONT:14]
+name=helvetica
+size=10
+style=2
+charset=0
+pitch=0
+family=0
+
+[SYSTEMFONT:13]
+name=courier
+size=10
+style=1
+charset=0
+pitch=0
+family=0
+
+[SYSTEMFONT:12]
+name=helvetica
+size=10
+style=1
+charset=0
+pitch=0
+family=0
+
+[SYSTEMFONT:18]
+name=lucida bright
+size=6
+style=0
+charset=0
+pitch=0
+family=0
+
+[SYSTEMFONT:19]
+name=times
+size=10
+style=0
+charset=0
+pitch=0
+family=0
+
+[style2]
+PPPMAAAE=AAMAAAAAAAAEAABI
+PPPPAAAA=AACAAAAF
+PPPPAAAC=AACAAAAF
+AAABAAAB=ABACAAIAIAIAAAAAAAAG
+AAABAAAD=AAEAAAAAAAAC
+AAABAAAE=AAIAAABG
+AAABAAAG=AACAAAAB
+AAACAAAE=AAIAAABG
+AAADAAAD=AAECAAPPAAPPAAAAAAAC
+AAADAAAE=AAIAAABG
+AAADAAAG=AACAAAAH
+AAAFAAAB=ABACAAAAPPAAAAAAAAAG
+AAAFAAAD=AAECAAAAPPAAAAAAAAAC
+AAAFAAAE=AAIAAABG
+AAAFAAAF=AACAAAAB
+AAAFAAAG=AACAAAAF
+AAAGAAAD=AAECAAAAAAPPAAAAAAAC
+AAAGAAAE=AAIAAABG
+AAAGAAAG=AACAAAAG
+AAAHAAAB=ABACAAPPAAAAAAAAAAAG
+AAAHAAAD=AAECAAPPAAAAAAAAAAAC
+AAAHAAAE=AAIAAABG
+AAAHAAAF=AACAAAAD
+AAAHAAAG=AACAAAAF
+AAAIAAAB=ABACAAPPAAAAAAAAAAAG
+AAAIAAAD=AAECAAPPAAAAAAAAAAAC
+AAAIAAAE=AAIAAABG
+AAAIAAAF=AACAAAAD
+AAAJAAAB=ABACAAPPAAAAAAAAAAAG
+AAAJAAAD=AAECAAPPAAAAAAAAAAAC
+AAAJAAAE=AAIAAABG
+AAAJAAAF=AACAAAAD
+AAAJAAAG=AACAAAAD
+AAAKAAAB=ABACAAPPAAAAAAAAAAAG
+AAAKAAAD=AAECAAPPAAAAAAAAAAAC
+AAAKAAAE=AAIAAABG
+AAAKAAAF=AACAAAAD
+AAAKAAAG=AACAAAAC
+AAALAAAE=AAIAAABG
+AAAMAAAE=AAIAAABG
+AAAMAAAG=AACAAAAA
+AAANAAAG=AACAAAAB
+AAAOAAAG=AACAAAAC
+AAAPAAAE=AAIAAABG
+AAAPAAAG=AACAAAAD
+AABAAAAE=AAIAAABG
+AABAAAAG=AACAAAAE
+AABBAAAE=AAIAAABG
+AABBAAAG=AACAAAAF
+AABCAAAG=AACAAAAG
+AABDAAAE=AAIAAABG
+AABDAAAG=AACAAAAH
+AABEAAAB=AAEAAAAAAABE
+AABEAAAG=AACAAAAI
+AABFAAAE=AAIAAABG
+AABFAAAG=AACAAAAJ
+AABGAAAE=AAIAAABG
+AABGAAAG=AACAAAAK
+AABHAAAB=AAEAAAAAAABE
+AABHAAAE=AAIAAABG
+AABHAAAG=AACAAAAL
+AABIAAAE=AAIAAABG
+AABIAAAG=AACAAAAM
+AABJAAAB=AAEAAAAAAABE
+AABJAAAE=AAIAAABG
+AABJAAAG=AACAAAAN
+AABKAAAE=AAIAAABG
+AABKAAAG=AACAAAAO
+AABLAAAE=AAIAAABG
+AABLAAAG=AACAAAAP
+AABMAAAE=AAIAAABG
+AABMAAAG=AACAAABA
+AABNAAAE=AAIAAABG
+AABNAAAG=AACAAABB
+AABOAAAE=AAIAAABG
+AABOAAAG=AACAAABC
+AABPAAAE=AAIAAABG
+AABPAAAG=AACAAABD
+AACAAAAB=AAEAAAAAAABE
+AACAAAAE=AAIAAABG
+AACAAAAG=AACAAABE
+AACBAAAE=AAIAAABG
+AACBAAAG=AACAAABF
+AACCAAAE=AAIAAABG
+AACCAAAG=AACAAABG
+AACDAAAB=ABACAAPPAAAAAAAAAAAG
+AACDAAAD=AAECAAPPAAAAAAAAAAAC
+AACDAAAE=AAIAAABG
+AACDAAAF=AACAAAAD
+AACDAAAG=AACAAAAB
+AACEAAAB=AAEAAAAAAABE
+AACEAAAE=AAIAAABG
+AACEAAAG=AACAAABH
+AACFAAAB=AAEAAAAAAABE
+AACFAAAE=AAIAAABG
+AACFAAAG=AACAAABI
+AACGAAAB=AAEAAAAAAABE
+AACGAAAE=AAIAAABG
+AACGAAAG=AACAAABJ
+AACHAAAB=AAEAAAAAAABE
+AACHAAAE=AAIAAABG
+AACHAAAG=AACAAABK
+AACIAAAE=AAIAAABG
+AACIAAAG=AACAAABL
+AACJAAAE=AAIAAABG
+AACJAAAG=AACAAABM
+AACKAAAB=AAEAAAAAAABF
+AACKAAAE=AAIAAABG
+AACKAAAG=AACAAABN
+AACLAAAB=AAEAAAAAAABE
+AACLAAAE=AAIAAABG
+AACLAAAG=AACAAABO
+AACMAAAF=AACAAAAB
+AACMAAAG=AACAAAAE
+AACNAAAE=AAIAAABG
+AACNAAAG=AACAAAAD
+AACOAAAE=AAIAAABG
+AACOAAAG=AACAAABP
+AACPAAAB=AAEAAAAAAABC
+AACPAAAE=AAIAAABG
+AACPAAAG=AACAAACA
+AADAAAAB=AAEAAAAAAABE
+AADAAAAE=AAIAAABG
+AADAAAAG=AACAAACB
+AADBAAAB=AAEAAAAAAABD
+AADBAAAE=AAIAAABG
+AADBAAAG=AACAAACC
+AADCAAAE=AAIAAABG
+AADCAAAG=AACAAACD
+AADDAAAE=AAIAAABG
+AADDAAAG=AACAAACE
+AADEAAAB=AAECAAPPAAAAAAAAAABE
+AADEAAAE=AAIAAABG
+AADEAAAG=AACAAACF
+AADFAAAE=AAIAAABG
+AADFAAAG=AACAAACG
+AADGAAAE=AAIAAABG
+AADGAAAG=AACAAACH
+AADHAAAE=AAIAAABG
+AADHAAAG=AACAAACI
+AADIAAAE=AAIAAABG
+AADIAAAG=AACAAAAA
+AADJAAAE=AAIAAABG
+AADJAAAG=AACAAACJ
+AADKAAAB=ABACAAAAIAIAAAAAAAAG
+AADKAAAD=AAACAAAAIAIA
+AADKAAAE=AAIAAABG
+AADKAAAG=AACAAACK
+AADLAAAB=AAECAAAAAAPPAAAAAABF
+AADLAAAE=AAIAAABG
+AADLAAAG=AACAAACL
+AADMAAAB=AAECAAAAAAPPAAAAAABE
+AADMAAAE=AAIAAABG
+AADMAAAG=AACAAACM
+AADNAAAE=AAIAAABG
+AADNAAAG=AACAAACN
+AADOAAAE=AAIAAABG
+AADOAAAG=AACAAACO
+AADPAAAE=AAIAAABG
+AADPAAAG=AACAAACP
+AAEAAAAE=AAIAAABG
+AAEAAAAG=AACAAADA
+AAEBAAAB=ABEAAAAAAABDAAAAAAAG
+AAEBAAAE=AAIAAABG
+AAEBAAAG=AACAAADB
+AAECAAAE=AAIAAABG
+AAECAAAG=AACAAADC
+AAEDAAAE=AAIAAABG
+AAEDAAAG=AACAAADD
+AAEEAAAE=AAIAAABG
+AAEEAAAG=AACAAADE
+AAEFAAAE=AAIAAABG
+AAEFAAAG=AACAAADF
+AAEGAAAE=AAIAAABG
+AAEGAAAG=AACAAADG
+AAEHAAAB=AAEAAAAAAABE
+AAEHAAAE=AAIAAABG
+AAEHAAAG=AACAAADH
+AAEIAAAB=AAEAAAAAAABE
+AAEIAAAE=AAIAAABG
+AAEIAAAG=AACAAADI
+AAEKAAAE=AAIAAABG
+AAEKAAAG=AACAAAAB
+AAELAAAE=AAIAAABG
+AAELAAAG=AACAAADJ
+AAEMAAAE=AAIAAABG
+AAEMAAAG=AACAAAAD
+AAENAAAE=AAIAAABG
+AAENAAAG=AACAAAAE
+AAEOAAAB=AAEAAAAAAABE
+AAEOAAAE=AAIAAABG
+AAEOAAAG=AACAAADK
+AAEPAAAE=AAIAAABG
+AAEPAAAG=AACAAADL
+AAFAAAAB=AAEAAAAAAABE
+AAFAAAAE=AAIAAABG
+AAFAAAAG=AACAAADM
+AAFBAAAE=AAIAAABG
+AAFBAAAG=AACAAADN
+AAFCAAAE=AAIAAABG
+AAFCAAAG=AACAAAAC
+AAFDAAAB=AAEAAAAAAABE
+AAFDAAAE=AAIAAABG
+AAFDAAAG=AACAAAAB
+AAFEAAAE=AAIAAABG
+AAFEAAAG=AACAAAAC
+PPPPAAAD=EACAAAAERNAs
+PPPMAAAB=ABAAAAAAAAAI
+AAAAAAAB=ABAAAAAAAAAD
+AAAAAAAE=AAGAAABOAAAAAAAC
+AAACAAAB=ABAAAAAAAAAG
+AAADAAAB=ABAAAAAAAAAG
+AAAEAAAB=ABACAAAAIAAAAAAAAAAG
+AAAGAAAB=ABAAAAAAAAAG
+AAALAAAB=ABAAAAAAAAAG
+AAAMAAAB=ABAAAAAAAAAG
+AAAPAAAB=ABAAAAAAAAAG
+AABAAAAB=AAEAAAAAAABE
+AABBAAAB=ABAAAAAAAAAG
+AABCAAAB=AAEAAAAAAABE
+AABDAAAB=ABAAAAAAAAAG
+AABFAAAB=ABAAAAAAAAAG
+AABGAAAB=ABAAAAAAAAAG
+AABIAAAB=ABACAAIAIAIAAAAAAAAG
+AABKAAAB=ABAAAAAAAAAG
+AABLAAAB=ABACAAMAMAMAAAAAAAAG
+AABMAAAB=ABAAAAAAAAAG
+AABNAAAB=ABACAAIAAAAAAAAAAAAG
+AABNAAAD=AAACAAIAAAAA
+AABOAAAB=ABAAAAAAAAAG
+AABPAAAB=ABAAAAAAAAAG
+AACBAAAB=ABACAAAAIAIAAAAAAAAG
+AACBAAAD=AAACAAAAIAIA
+AACCAAAB=ABAAAAAAAAAG
+AACIAAAB=ABAAAAAAAAAG
+AACJAAAB=ABAAAAAAAAAG
+AACMAAAB=ABAAAAAAAAAG
+AACNAAAB=ABAAAAAAAAAG
+AACNAAAF=AACAAAAB
+AACOAAAB=ABACAAAAIAIAAAAAAAAG
+AACOAAAD=AAACAAAAIAIA
+AADCAAAB=ABAAAAAAAAAG
+AADDAAAB=ABAAAAAAAAAG
+AADFAAAB=ABAAAAAAAAAG
+AADGAAAB=ABAAAAAAAAAG
+AADHAAAB=ABAAAAAAAAAG
+AADIAAAB=ABAAAAAAAAAG
+AADJAAAB=ABAAAAAAAAAG
+AADNAAAB=ABAAAAAAAAAG
+AADOAAAB=ABEAAAAAAABEAAAAAAAG
+AADPAAAB=ABAAAAAAAAAG
+AAEAAAAB=ABAAAAAAAAAG
+AAECAAAB=ABAAAAAAAAAG
+AAEDAAAB=ABAAAAAAAAAG
+AAEEAAAB=ABAAAAAAAAAG
+AAEFAAAB=ABAAAAAAAAAG
+AAEGAAAB=ABAAAAAAAAAG
+AAEKAAAB=ABACAAAAIAIAAAAAAAAG
+AAELAAAB=ABAAAAAAAAAG
+AAEMAAAB=ABECAAPPAAAAAAAAAAAAAAAAAAAE
+AAEMAAAD=AAECAAPPAAAAAAAAAAAC
+AAENAAAB=AAECAAAAAAPPAAAAAABE
+AAEPAAAB=ABAAAAAAAAAG
+AAFBAAAB=ABAAAAAAAAAG
+AAFCAAAB=ABACAAIAAAAAAAAAAAAG
+PPPJAAAE=AAIAAABH
+PPPKAAAE=AAICAAAAAAPPAABH
+PPPLAAAE=AAICAAPPAAAAAABH
+AAAEAAAE=AAIAAABH
+AAAEAAAF=AACAAAAB
+AAAEAAAG=AACAAAAC
+AAEKAAAF=AACAAAAE
+AAEMAAAF=AACAAAAF
+AAENAAAF=AACAAAAF
+AAFCAAAF=AACAAAAE
+AAFDAAAF=AACAAAAF
+AAFEAAAB=AAECAAIAAAIAAAAAAABC
+AAFEAAAF=AACAAAAF
+PPPPAAAE=EACAAAADProts
+PPPPAAAF=EACAAAACProt1
+
+[SYSTEMFONT:22]
+name=lucida bright
+size=10
+style=0
+charset=0
+pitch=0
+family=0
+
+[SYSTEMFONT:21]
+name=helvetica
+size=10
+style=0
+charset=0
+pitch=0
+family=0
+
+[SYSTEMFONT:20]
+name=helvetica
+size=12
+style=1
+charset=0
+pitch=0
+family=0
+
+[SYSTEMFONT:23]
+name=lucidabright
+size=10
+style=0
+charset=0
+pitch=0
+family=0
+
+[SYSTEMFONT:24]
+name=helvetica
+size=12
+style=1
+charset=0
+pitch=0
+family=0
+
+
diff --git a/debian/Cn3D-3.0.desktop.in b/debian/Cn3D-3.0.desktop.in
new file mode 100644
index 00000000..6ce35d6e
--- /dev/null
+++ b/debian/Cn3D-3.0.desktop.in
@@ -0,0 +1,3 @@
+Name=Cn3D NCBI Database Viewer
+GenericName=Database Viewer
+Comment=View NCBI databases in 3D
diff --git a/debian/NOTES b/debian/NOTES
new file mode 100644
index 00000000..13ff53ea
--- /dev/null
+++ b/debian/NOTES
@@ -0,0 +1,2 @@
+X apps should pull in -lvibrant BEFORE -lvibgif to avoid problematic
+shadowing.
diff --git a/debian/Psequin.desktop.in b/debian/Psequin.desktop.in
new file mode 100644
index 00000000..1e3a45b7
--- /dev/null
+++ b/debian/Psequin.desktop.in
@@ -0,0 +1,3 @@
+Name=Sequin DNA Sequence Submission Tool
+GenericName=Sequence Submission Tool
+Comment=Submit DNA sequences to the GenBank, EMBL, and DDBJ databases
diff --git a/debian/README.test b/debian/README.test
new file mode 100644
index 00000000..f600d738
--- /dev/null
+++ b/debian/README.test
@@ -0,0 +1,8 @@
+Notes on how this package can be tested.
+_______________________________________
+
+This package can be tested by execution
+
+ bash run-unit-test
+
+in order to confirm its integrity.
diff --git a/debian/TODO b/debian/TODO
new file mode 100644
index 00000000..dc3c8bcf
--- /dev/null
+++ b/debian/TODO
@@ -0,0 +1,2 @@
+* Document sequin's options properly.
+* Split blast.1 back up, preferably semi-automatically?
diff --git a/debian/bkgd.gif b/debian/bkgd.gif
new file mode 100644
index 00000000..0313d7e1
--- /dev/null
+++ b/debian/bkgd.gif
Binary files differ
diff --git a/debian/changelog b/debian/changelog
new file mode 100644
index 00000000..add95719
--- /dev/null
+++ b/debian/changelog
@@ -0,0 +1,1264 @@
+ncbi-tools6 (6.1.20170106+dfsg1-1) UNRELEASED; urgency=medium
+
+ * Belatedly repackage without data/UniVec.*, some portions of which
+ turned out to be non-free (with copyright held by Invitrogen
+ Corporation, which requires a license for commercial use thereof.)
+ (NOT RELEASED YET.)
+
+ -- Aaron M. Ucko <ucko@debian.org> Sun, 28 Jul 2019 21:30:56 -0400
+
+ncbi-tools6 (6.1.20170106-7) unstable; urgency=medium
+
+ [ Steffen Möller ]
+ * debian/upstream/metadata: Add metadata for Cn3D.
+
+ [ Aaron M. Ucko ]
+ * Split Cn3D(-3.0) out into a new ncbi-cn3d binary package; update
+ debian/upstream/metadata accordingly.
+ * debian/upstream/metadata: Quote title because it contains a colon.
+
+ -- Aaron M. Ucko <ucko@debian.org> Sun, 24 Feb 2019 16:35:37 -0500
+
+ncbi-tools6 (6.1.20170106-6) unstable; urgency=medium
+
+ * debian/rules: Find indirectly needed libraries via -rpath-link rather
+ than LD_LIBRARY_PATH; the -rpath-link approach is generally saner, and
+ in particular has a decent shot at fully fixing cross-building.
+
+ -- Aaron M. Ucko <ucko@debian.org> Thu, 27 Dec 2018 22:39:09 -0500
+
+ncbi-tools6 (6.1.20170106-5) unstable; urgency=medium
+
+ [ Andreas Tille ]
+ * Improve cross building: Don't force the build architecture compiler
+ (Thanks for the patch to Helmut Grohne)
+ Closes: #908353
+ * cme fix dpkg-control
+
+ [ Aaron M. Ucko ]
+ * debian/control: libvibrant6b Recommends: sensible-utils (no longer
+ guaranteed present, per #871260).
+ * Standards-Version: 4.3.0 (already compliant).
+
+ -- Aaron M. Ucko <ucko@debian.org> Mon, 24 Dec 2018 23:40:58 -0500
+
+ncbi-tools6 (6.1.20170106-4) unstable; urgency=medium
+
+ * debian/compat: Advance to Debhelper 11.
+ * debian/control:
+ - Mark *-data reshuffling with Breaks, not just Replaces. (Closes: #902364.)
+ - Build-Depends: Advance to debhelper (>= 11~).
+ * debian/copyright: Fix years (packaging through 2018, upstream through 2017).
+
+ -- Aaron M. Ucko <ucko@debian.org> Mon, 25 Jun 2018 21:36:10 -0400
+
+ncbi-tools6 (6.1.20170106-3) unstable; urgency=medium
+
+ [ Liubov Chuprikova ]
+ * Added autopkgtest for ncbi-tools-bin.
+ Closes: #879619
+
+ [ Aaron M. Ucko ]
+ * debian/{*.gif,ncbi2.css}: Add local copies of NCBI resources used by HTML
+ docs.
+ * debian/control:
+ - Repoint Vcs-* at salsa.debian.org.
+ - Standards-Version: 4.1.4 (already compliant).
+ - Rules-Requires-Root: no (confirmed safe).
+ * debian/{libncbi6,ncbi-tools-x11}.docs: Install resources from debian/ as
+ needed.
+ * debian/source/format: Set to 3.0 (quilt) to accommodate binary test data.
+ * debian/source/include-binaries: List debian/tests/test-data/nc0305.aso.gz
+ and (individually) debian/*.gif.
+ * debian/source/options: single-debian-patch (tracking changes purely
+ with git for now).
+ * debian/source/patch-header: "Combined patches from git."
+ * demo/{findspl,taxblast_main}.c: Call SOCK_SetupSSL (accidentally missed
+ earlier).
+ * doc/{dispatcher,firewall}.html: Patch to use (newly supplied) local
+ resources, addressing a generic privacy breach caught by Lintian.
+ * make/make{demo,net}.unx: Link findspl and taxblast against $(LIBTLS)
+ and $(GNUTLS_LIBS).
+
+ -- Aaron M. Ucko <ucko@debian.org> Sun, 24 Jun 2018 12:06:15 -0400
+
+ncbi-tools6 (6.1.20170106-2) unstable; urgency=medium
+
+ * debian/control: Correctly version ncbi-tools-bin's Breaks/Replaces
+ on blast2 over taxblast move. (Closes: #854329.)
+
+ -- Aaron M. Ucko <ucko@debian.org> Sun, 05 Feb 2017 21:40:38 -0500
+
+ncbi-tools6 (6.1.20170106-1) unstable; urgency=medium
+
+ * New upstream release (after all).
+ * debian/*.symbols: Update accordingly.
+ * doc/man/cleanasn.1: Update accordingly.
+ * debian/copyright: Update years.
+
+ -- Aaron M. Ucko <ucko@debian.org> Mon, 09 Jan 2017 22:35:15 -0500
+
+ncbi-tools6 (6.1.20160908-2) unstable; urgency=medium
+
+ * Stop building the transitional blast2 package (taken over by ncbi-blast+)
+ and retire its remaining vestiges (the bibliograpy and autopkgtest setup).
+ * connect/ncbi_util.c: Fix a FTBFS on hurd-i386 by conditionally using a
+ more appropriate header for PAGE_SIZE (<mach/vm_param.h>).
+ * Reinstate taxblast (now part of ncbi-tools-bin, and correctly documented
+ as a postprocessing tool), accidentally dropped with the rest of blast2.
+
+ -- Aaron M. Ucko <ucko@debian.org> Tue, 06 Dec 2016 18:37:19 -0500
+
+ncbi-tools6 (6.1.20160908-1) unstable; urgency=medium
+
+ [ Andreas Tille ]
+ * (Final) new upstream release, incorporating most Debian changes, adding
+ HTTPS support, and desupporting legacy BLAST. (Closes: #846477, #821075.)
+ * cme fix dpkg-control
+ * drop -dbg packages since these will be created automatically
+ * Fixed watch file (thanks to Eriberto <eriberto@eriberto.pro.br>)
+ * DEP5
+
+ [ Aaron M. Ucko ]
+ * Reinstate direct upstream changes lost in merge.
+ * Ensure that apps that could potentially hit the network can use HTTPS.
+ (Don't bother with anything that only supports the old Entrez1 service.)
+ * Allow Entrez2 over HTTPS by switching to the Entrez2s service, making
+ HTTPS connections by default, and allowing HTTPS POST redirections from
+ raw IP addresses (which NCBI's certificates don't cover).
+ * Let GCC take care of setting __DATE__ and __TIME__ per SOURCE_DATE_EPOCH.
+ * api/sqnutil3.c: Substitute strcpy for sprintf with no extra
+ arguments, which our hardening flags disallow.
+ * connect/ncbi_gnutls.c: Suppress strict version check.
+ * debian/*.symbols: Update for new release.
+ * debian/{blast2.*,control,rules}, make/makedemo.unx: Turn blast2 into an
+ architecture-independent transitional package for ncbi-blast+-legacy.
+ (Retire blastcl3, which is obsolete.)
+ * debian/{compat,control}: Advance to Debhelper compat level 10.
+ * debian/control: Drop unversioned B-D-I on dpkg-dev left behind by cme.
+ * debian/{control,rules}:
+ - Build against GNU TLS.
+ - Retune ncbi-data/ncbi-rrna-data split.
+ * debian/libncbi6(-dev).install, make/makeshlib.unx: Account for new
+ libconnssl library.
+ * debian/rules:
+ - Drop override_dh_strip-arch target now that -dbg packages are gone.
+ - Fix typo in name of override_dh_makeshlibs-arch target from #806084.
+ * debian/{rules,.gitignore}: Stop generating legacy menu files for
+ non-interactive tools (already retired in favor of XDG desktop files
+ for true graphical applications).
+ * debian/rules, make/make{demo,net}.unx: Substitute -Wl,--as-needed
+ for manual linkage cleanups.
+ * demo/tbl2asn.c: Complain about date only if failing for other reasons.
+ (Closes: #821075.)
+ * doc/man/blastcl3.1: Fix a stray reference to retired programs.
+
+ -- Aaron M. Ucko <ucko@debian.org> Sun, 04 Dec 2016 21:33:55 -0500
+
+ncbi-tools6 (6.1.20120620-12) unstable; urgency=medium
+
+ * Team upload.
+ * Autopkgtest added.
+
+ -- Canberk Koç <canberkkoc@gmail.com> Sat, 20 Aug 2016 10:20:38 +0300
+
+ncbi-tools6 (6.1.20120620-11) unstable; urgency=medium
+
+ * Team upload.
+ * Add support for SOURCE_DATE_EPOCH, making packages building BLAST
+ indexes reproducible (Closes: #834139)
+
+ -- Sascha Steinbiss <satta@debian.org> Fri, 12 Aug 2016 20:29:37 +0000
+
+ncbi-tools6 (6.1.20120620-10) unstable; urgency=medium
+
+ * debian/rules: chmod +x private scripts in the targets that use them.
+ (Doing so in override_dh_auto_build-arch broke indep-only builds.)
+
+ -- Aaron M. Ucko <ucko@debian.org> Thu, 10 Dec 2015 01:19:59 -0500
+
+ncbi-tools6 (6.1.20120620-9) unstable; urgency=medium
+
+ * debian/control: Split most of Build-Depends into Build-Depends-Arch.
+ * debian/makemenu: Elide menu entries, and potentially entire menu
+ files, when .desktop(.in) files cover the same apps. (See #741573.)
+ * debian/rules:
+ - Fix and streamline builds covering only the architecture-independent
+ (*-data) packages. (Closes: #806084.)
+ - Arrange to define BUILD_{DATE,TIME} based on the last changelog entry.
+ - clean: chmod -x private scripts, for compatibility with dgit.
+ * debian/sbtedit.desktop.in: Add a menu entry for sbtedit, accidentally
+ missed earlier.
+ * {demo,sequin}/*.c: Favor BUILD_{DATE,TIME} over __DATE__ and __TIME__
+ for the sake of reproducibility.
+ * doc/man/sbtedit.1: Fix some minor typos.
+
+ -- Aaron M. Ucko <ucko@debian.org> Wed, 09 Dec 2015 23:52:45 -0500
+
+ncbi-tools6 (6.1.20120620-8) unstable; urgency=low
+
+ [ Aaron M. Ucko ]
+ * corelib/ncbimisc.c (MergeStringArray): Ensure all return paths
+ explicitly return a value, as Clang reasonably requires.
+ * debian/control: Formally update Standards-Version (3.9.6) and Vcs-Browser.
+
+ [ James McCoy ]
+ * Move debian/upstream to debian/upstream/metadata
+
+ -- Aaron M. Ucko <ucko@debian.org> Wed, 08 Oct 2014 22:26:33 -0400
+
+ncbi-tools6 (6.1.20120620-7) unstable; urgency=low
+
+ * debian/rules: Use find -perm /..., not deprecated +.... (Closes: #724777.)
+ * debian/.gitignore: Belatedly update for switch to libvibrant6b.
+
+ -- Aaron M. Ucko <ucko@debian.org> Tue, 01 Oct 2013 10:58:03 -0400
+
+ncbi-tools6 (6.1.20120620-6) unstable; urgency=low
+
+ * debian/installman: Eliminate for $var qw(...) syntax that broke with
+ Perl 5.18. (Closes: #722913.)
+
+ -- Aaron M. Ucko <ucko@debian.org> Sat, 14 Sep 2013 23:16:12 -0400
+
+ncbi-tools6 (6.1.20120620-5) unstable; urgency=low
+
+ * demo/makeset.c: If unable to open an input ASN.1 file, report an error
+ and exit rather than trying to work with a NULL pointer and crashing.
+ (Thanks to Alexandre Rebert and the Mayhem Team at Carnegie Mellon
+ University's Cylab for revealing this possibility.)
+ * debian/control: Modernize libvibrant6b-dbg's short description.
+
+ -- Aaron M. Ucko <ucko@debian.org> Thu, 27 Jun 2013 22:23:19 -0400
+
+ncbi-tools6 (6.1.20120620-4) unstable; urgency=low
+
+ * Rename libvibrant6(-dbg) to libvibrant6b(-dbg), as the release team
+ doesn't condone ever reusing binary package names.
+ * blast2: Conflict with unofficial ncbi-blast packages. (LP: #658240.)
+ * Rebuild in a clean environment. (Closes: #714070.)
+
+ -- Aaron M. Ucko <ucko@debian.org> Tue, 25 Jun 2013 22:00:52 -0400
+
+ncbi-tools6 (6.1.20120620-3) unstable; urgency=low
+
+ * Migrate from Lesstif to Motif, which is (finally!) free these days.
+ - Substitute libmotif-dev for liblesstif-dev in Build-Depends and
+ libvibrant6-dev's Depends.
+ - Rename libvibrant6a(-dbg) back to libvibrant6(-dbg).
+ * Standards-Version: 3.9.4. (Already compliant.)
+
+ -- Aaron M. Ucko <ucko@debian.org> Tue, 28 May 2013 22:26:01 -0400
+
+ncbi-tools6 (6.1.20120620-2) unstable; urgency=low
+
+ [ Andreas Tille ]
+ * debian/upstream: Strings containing ': ' need to be quoted.
+
+ -- Aaron M. Ucko <ucko@debian.org> Sun, 24 Jun 2012 22:54:29 -0400
+
+ncbi-tools6 (6.1.20120620-1) unstable; urgency=low
+
+ * New upstream release, just in time for Wheezy.
+ * debian/*.symbols: update accordingly.
+ * api/txalign.c: turn one more sprintf into a (nominally safer) snprintf.
+ * make/makenet.unx: link asnmacro against libblastapi now that it actually
+ needs to.
+ * debian/*-dev.install: make sure to install all headers collectively.
+ * doc/man/*.1: update for new release.
+ * debian/ncbi-tools-bin.examples: new, covering scripts from demo/.
+
+ -- Aaron M. Ucko <ucko@debian.org> Sun, 24 Jun 2012 22:15:27 -0400
+
+ncbi-tools6 (6.1.20110713-6) unstable; urgency=low
+
+ * debian/rules: Tweak -fPIC -> -fPIE substitution to accommodate platforms
+ (kFreeBSD, and some Linux architectures) lacking PIE support.
+
+ -- Aaron M. Ucko <ucko@debian.org> Fri, 01 Jun 2012 21:02:58 -0400
+
+ncbi-tools6 (6.1.20110713-5) unstable; urgency=low
+
+ [ Andreas Tille ]
+ * debian/upstream: Added citation information
+
+ [ Aaron M. Ucko ]
+ * debian/control:
+ - Build-Depends-Indep: dpkg-dev (>= 1.16.2~) for dpkg-deb -Sextreme.
+ - Repoint Vcs-* at anonscm.debian.org (vs. git.debian.org).
+ * debian/rules:
+ - Enable full hardening flags, contriving to substitute -fPIC for
+ -fPIE as necessary.
+ - Build ncbi-rrna-data with -Sextreme rather than hacking XZ_OPT.
+ * make/makeshlb.unx: Honor externally supplied (hardening) LDFLAGS.
+
+ -- Aaron M. Ucko <ucko@debian.org> Fri, 01 Jun 2012 18:36:37 -0400
+
+ncbi-tools6 (6.1.20110713-4) unstable; urgency=low
+
+ * debian/control:
+ - Give ncbi-rrna-data a pre-dependency on dpkg (>= 1.15.6) for xz support.
+ - Wrap and sort (build) dependencies.
+ - Drop specific build dependency on libpng12-dev, even as a preferred
+ libpng-dev provider. (Closes: #662442.)
+ - Require debhelper (>= 9), which has been final for some time.
+ - Standards-Version: 3.9.3. (No changes needed.)
+ * debian/{libncbi6,ncbi-tools-bin}.install: sort as well.
+
+ -- Aaron M. Ucko <ucko@debian.org> Thu, 08 Mar 2012 19:14:20 -0500
+
+ncbi-tools6 (6.1.20110713-3) unstable; urgency=low
+
+ * debian/{libncbi6-dev,ncbi-tools-bin}.install: move /usr/bin/asntool
+ and /usr/bin/errhdr from libncbi6-dev to ncbi-tools-bin so that the
+ former can properly be Multi-Arch: same. (Closes: #646970.)
+ * debian/libncbi6-dev.NEWS.debian: note the above move.
+ * debian/control: adjust descriptions and relationships accordingly.
+ * debian/{libncbi6-dev,ncbi-tools-bin}.lintian-overrides: update accordingly.
+ * debian/rules:
+ - Don't try to give libncbi6-dev manpages or menu entries.
+ - Compress the giant ncbi-rrna-data package with xz -7e (the sweet spot).
+
+ -- Aaron M. Ucko <ucko@debian.org> Sun, 30 Oct 2011 20:52:57 -0400
+
+ncbi-tools6 (6.1.20110713-2) unstable; urgency=low
+
+ * api/alignmgr2.c, api/pgppop.c, api/txalign.c, desktop/seqpanel.c,
+ tools/spidey.c: avoid calling printf and the like with non-constant
+ strings, as caught by -Werror=format-security. (Closes: #643444.)
+
+ -- Aaron M. Ucko <ucko@debian.org> Sat, 01 Oct 2011 22:08:13 -0400
+
+ncbi-tools6 (6.1.20110713-1) unstable; urgency=low
+
+ * New upstream release.
+ * debian/*.symbols: update accordingly.
+ * make/makeshlb.unx: link libcn3dOGL.so against -lm for sqrt.
+ * doc/man/*.1: update for new release.
+ * debian/rules:
+ - (VIB): add asnmacro, as upstream takes care to publish binaries thereof.
+ - Retire obsolete multiarch-unaware checks for libpthread.
+ - Fully modernize Debhelper usage; in particular, transition to overrides.
+ * debian/compat: advance to 9 per rules modernization.
+ * debian/ncbi-tools-bin.install: add asnmacro.
+ * make/makenet.unx: link asnmacro only against libraries it directly needs.
+ * doc/man/asnmacro.1: give asnmacro a man page.
+ * doc/man/Psequin.1: list it in SEE ALSO.
+ * network/id1arch/idfetch.c: revert redundant change (from #295110).
+ * Convert to multiarch.
+ - debian/rules: Install libraries (and ncbithr.o) to multiarch directories.
+ - debian/lib*.install: match multiarch library paths.
+ - debian/control:
+ + Build-Depends: debhelper (>= 8.1.3~), implying a recent dpkg-dev.
+ + Set Multi-Arch: as appropriate across the board, and specify
+ Pre-Depends: ${misc:Pre-Depends} for runtime libraries.
+ * debian/*.lintian-overrides: drop leading slashes for Lintian 2.5.x.
+ * debian/control: Standards-Version: 3.9.2 (already compliant).
+
+ -- Aaron M. Ucko <ucko@debian.org> Mon, 05 Sep 2011 18:55:02 -0400
+
+ncbi-tools6 (6.1.20100808-3) unstable; urgency=low
+
+ * vibrant/shim3d.c: support libpng 1.5+, per Nobuhiro Iwamatsu's most
+ helpful patch. (Closes: #636006.)
+
+ -- Aaron M. Ucko <ucko@debian.org> Sat, 30 Jul 2011 11:51:21 -0400
+
+ncbi-tools6 (6.1.20100808-2) unstable; urgency=low
+
+ * Reupload to unstable following the release of Debian 6.0 (squeeze).
+
+ -- Aaron M. Ucko <ucko@debian.org> Sun, 13 Feb 2011 15:07:22 -0500
+
+ncbi-tools6 (6.1.20100808-1) experimental; urgency=low
+
+ * New upstream release; the upgrade to BLAST 2.2.24 (from 2.2.21) should
+ address a formatdb regression. (LP: #586219.)
+ * Uploading to experimental because squeeze is frozen.
+ * debian/rules (install-indep-stamp): adapt to new ncbilogo.ico contents.
+ * debian/lib{ncbi6,vibrant6a}.symbols: update for latest release.
+ * doc/man/*.1: update for latest release.
+ [plus the cleanups backported to unstable in 6.1.20090809-2]
+
+ -- Aaron M. Ucko <ucko@debian.org> Fri, 03 Sep 2010 17:43:17 -0400
+
+ncbi-tools6 (6.1.20090809-2) unstable; urgency=low
+
+ * debian/rules
+ - Clean up compilation settings; in particular, use dpkg-buildflags rather
+ than relying on dpkg-buildpackage to have set CFLAGS appropriately.
+ - (clean): restore expected empty directories if necessary,
+ for compatibility with VCSes (notably git) that don't track them.
+ - (VIB): add asndisc, as upstream takes care to publish binaries thereof.
+ * debian/ncbi-tools6.install: likewise add asndisc.
+ * (debian/).gitignore: Ignore content generated during build.
+ * make/makenet.unx: don't link asndisc against extraneous libraries.
+ * doc/man/asndisc.1: throw together a man page for asndisc.
+ * doc/man/cleanasn.1: fix SEE ALSO formatting.
+ * debian/control:
+ - bump dpkg-dev build-dep to >= 1.15.7 for dpkg-buildflags.
+ - Standards-Version: 3.9.1 (already compliant).
+ - note switch to git-mediated Debian-Med team maintenance.
+
+ -- Aaron M. Ucko <ucko@debian.org> Wed, 13 Oct 2010 20:23:37 -0400
+
+ncbi-tools6 (6.1.20090809-1) unstable; urgency=low
+
+ * New upstream release.
+ * debian/libncbi6.symbols: update accordingly.
+ * debian/control: clean up obsolete or redundant relationship declarations.
+
+ -- Aaron M. Ucko <ucko@debian.org> Tue, 11 Aug 2009 22:03:47 -0400
+
+ncbi-tools6 (6.1.20090719-1) unstable; urgency=low
+
+ * New upstream release.
+ * debian/lib{ncbi6,vibrant6a}.symbols: update accordingly.
+ * doc/man/*.1: update accordingly as well.
+ * debian/control: declare compliance with Policy 3.8.2 (no changes needed).
+
+ -- Aaron M. Ucko <ucko@debian.org> Sat, 01 Aug 2009 21:19:49 -0400
+
+ncbi-tools6 (6.1.20090301-1) unstable; urgency=low
+
+ * New upstream release; uploading to unstable now that lenny is out.
+ * debian/lib{ncbi6,vibrant6a}.symbols: update accordingly.
+ * doc/man/*.1: update accordingly as well.
+ * debian/control: place lib*-dbg in the new debug section, per the
+ current override file.
+ * debian/control: declare compliance with Policy 3.8.1 (no changes needed).
+ * api/aliread.c: merge in fix (from 6.1.20080302-4) to undefined use of
+ sprintf caught by Kees Cook's scan.
+ * debian/watch: belatedly update regex to recognize releases like the
+ previous one ([6.1.]20081116a).
+
+ -- Aaron M. Ucko <ucko@debian.org> Thu, 19 Mar 2009 10:17:26 -0400
+
+ncbi-tools6 (6.1.20081116a-2) experimental; urgency=low
+
+ * debian/control: per Lintian's advice, depend on ${misc:Depends} across
+ the board, in case Debhelper ever populates it.
+ * debian/{control,rules}: split newly added large BLAST databases into a
+ new ncbi-rrna-data package to keep ncbi-data to a reasonable size.
+
+ -- Aaron M. Ucko <ucko@debian.org> Wed, 17 Dec 2008 19:45:48 -0500
+
+ncbi-tools6 (6.1.20081116a-1) experimental; urgency=low
+
+ * New upstream release.
+ * debian/lib{ncbi6,vibrant6a}.symbols: update accordingly.
+ * debian/rules: resync VIB with makedis.csh, adding the new app taxblast.
+ * debian/{blast2,ncbi-tools-bin}.install: add the new apps taxblast and
+ subfuse, respectively.
+ * debian/libncbi6-dev.install: add the new headers ace{read,rdapi}.h.
+ * debian/ncbi-tools-x11.{postinst,prerm}: run update-alternatives
+ without an explicit path, per Lintian.
+ * debian/rules (clean): drop stray references to CDBS's debian/stamp-*.
+ * make/make{demo,net}.unx: link asn2gb, debruijn, subfuse, and taxblast
+ correctly.
+ * doc/fwd_check.sh: use mktemp rather than predictable names (formally
+ CVE-2008-5149).
+ * doc/man/*.1: update for latest release; document new apps.
+
+ -- Aaron M. Ucko <ucko@debian.org> Sat, 13 Dec 2008 18:25:17 -0500
+
+ncbi-tools6 (6.1.20080302-4) unstable; urgency=medium
+
+ * doc/fwd_check.sh: use mktemp rather than predictable names (formally
+ CVE-2008-5149).
+ * api/aliread.c: fix undefined use of sprintf caught by Kees Cook's scan.
+
+ -- Aaron M. Ucko <ucko@debian.org> Sun, 28 Dec 2008 20:31:00 -0500
+
+ncbi-tools6 (6.1.20080302-3) unstable; urgency=high
+
+ * tools/readdb.c: enable madvise()-based code on all glibc (hence all
+ Debian) systems, not just Linux. (Closes: #490437.)
+
+ -- Aaron M. Ucko <ucko@debian.org> Mon, 14 Jul 2008 19:43:15 -0400
+
+ncbi-tools6 (6.1.20080302-2) unstable; urgency=low
+
+ * Migrate from CDBS to Debhelper 7 (along with dpkg-dev >= 1.14.17),
+ replacing some files with equivalent symlinks.
+ * debian/makemenu: stop generating obsolete linda overrides.
+ * Declare compliance with Policy 3.8.0. (No changes needed.)
+
+ -- Aaron M. Ucko <ucko@debian.org> Wed, 11 Jun 2008 19:08:50 -0400
+
+ncbi-tools6 (6.1.20080302-1) unstable; urgency=low
+
+ * New upstream release
+ * debian/lib{ncbi6,vibrant6a}.symbols: update and clean up.
+ * debian/lib{ncbi,vibrant}6-dev.install: ship new headers.
+ * debian/ncbi-tools-bin.docs, doc/man/tbl2asn.1: belatedly ship
+ tbl2asn.txt, and restore tbl2asn.1's reference thereto.
+ * doc/man/*.1: correct usage of ' and -.
+ * doc/man/{blast,cleanasn,nps2gps,tbl2asn}.1: resync with help output.
+ * debian/control: tighten dependencies between binary packages.
+ * debian/{control,rules}: require cdbs 0.4.51; drop workaround for #462130.
+ * debian/{control,rules,*.override}: rename Lintian overrides to
+ $pkg.lintian-overrides and employ dh_lintian from debhelper (>= 6.0.7)
+ in lieu of custom logic.
+ * debian/*.doc-base*: modernize (and correct) section assignments per
+ doc-base 0.8.10: science -> Science/Biology, net -> System/Administration.
+ * debian/makemenu: drop obsolete Encoding key from generated .desktop files.
+
+ -- Aaron M. Ucko <ucko@debian.org> Wed, 19 Mar 2008 19:42:00 -0400
+
+ncbi-tools6 (6.1.20070822-5) unstable; urgency=low
+
+ * debian/{control,rules}, make/make{all,demo,net}.unx: adjust makefiles
+ for compatibility with GNU Make 3.81, and switch back from pmake.
+ * debian/{compat,control,rules}: advance to Debhelper 6, with a
+ temporary workaround for CDBS bug #462130.
+ * debian/lib{ncbi6,vibrant6a}.symbols: new, to allow looser reverse
+ dependencies.
+ * debian/watch: move unsupported downloadurlmangle option to a comment
+ so that uscan actually works.
+ * debian/control: clean up crufty relations, assuming a build
+ environment of at least etch (stable) and an installation environment
+ of at least sarge (oldstable).
+
+ -- Aaron M. Ucko <ucko@debian.org> Wed, 30 Jan 2008 21:56:22 -0500
+
+ncbi-tools6 (6.1.20070822-4) unstable; urgency=low
+
+ * debian/control: enable ${shlibs:Depends} for libncbi6-dev, which
+ contains a couple of utilities in addition to its other contents.
+ * make/make{demo,net,shlb}.unx: ensure that every shipped executable and
+ shared library links against everything it uses directly and nothing
+ else, per dpkg-shlibdeps's new warnings.
+ * debian/watch: reformat, as the old version didn't actually have the
+ desired semantics (which uscan doesn't actually support AFAICT :-/).
+ * doc/man/tbl2asn.1: drop obsolete reference to tbl2asn.txt.
+ * debian/control: give blast2 its own Homepage field.
+ * debian/libncbi6.dirs: dropped, not actually pointful.
+ * debian/{installman,ncbi-tools-x11.links}: make symlinks automatically.
+ * debian/control: declare compliance with Policy 3.7.3.
+
+ -- Aaron M. Ucko <ucko@debian.org> Fri, 18 Jan 2008 19:43:04 -0500
+
+ncbi-tools6 (6.1.20070822-3) unstable; urgency=low
+
+ * debian/control: fix typo (ncbi-tools-data for ncbi-data) that left
+ ncbi-tools-x11 uninstallable. :-/
+
+ -- Aaron M. Ucko <ucko@debian.org> Tue, 30 Oct 2007 19:14:18 -0400
+
+ncbi-tools6 (6.1.20070822-2) unstable; urgency=low
+
+ * debian/control: set Homepage.
+ * debian/{control,makemenu,rules,*.desktop.in}: supply XDG desktop
+ entries and icons for inherently graphical apps. (Closes: #448031.)
+ * debian/{man.unused,old-blast-man,shlibs.local}: remove (obsolete
+ cruft; shlibs.local contained only comments anyway.)
+
+ -- Aaron M. Ucko <ucko@debian.org> Fri, 26 Oct 2007 19:27:01 -0400
+
+ncbi-tools6 (6.1.20070822-1) unstable; urgency=low
+
+ * New upstream release.
+ * vibrant/vib{main,wndws.c}: restore sane behavior in key corner cases
+ (no Nlm_Main, no DISPLAY).
+ * debian/{control,rules}: ncbilogo.ico now contains multiple variants;
+ use icotool from icoutils to extract the right one to convert.
+ * debian/libncbi6-dev.install: handle two new "unclaimed" headers.
+ * debian/ncbi-tools-bin.install: drop getfeat (dead), entrcmd (obsolete).
+ * debian/ncbi-tools-x11.install: drop netentcf (dead), Nentrez (obsolete).
+ * debian/ncbi-tools-x11.links: repoint entrez at entrez2 (vs. Nentrez).
+ * debian/rules: stop building Nentrez; update list of built but unwanted
+ executables.
+ * debian/makemenu: fix section assignments per menu policy 2.1.35.
+ * Update man pages.
+
+ -- Aaron M. Ucko <ucko@debian.org> Mon, 08 Oct 2007 16:42:46 -0400
+
+ncbi-tools6 (6.1.20061015-2) unstable; urgency=low
+
+ * debian/installman: don't append .gz to *.htm(l) files' paths, as
+ dh_compress (rightly) excludes them by default. (Closes: #412651.)
+ * debian/makemenu: correct vibrate's package requirement to libvibrant6a
+ (closes: #429955, #429956); generate appropriate linda overrides (for
+ command-not-exist), another "problem" with the setup.
+ * debian/libvibrant6a.override (new): suppress lintian warnings about
+ the package name not precisely matching any SONAME.
+
+ -- Aaron M. Ucko <ucko@debian.org> Fri, 29 Jun 2007 13:29:17 -0400
+
+ncbi-tools6 (6.1.20061015-1) unstable; urgency=low
+
+ * New upstream release.
+ * Don't bother linking against indirectly used system libraries.
+ * Update man pages.
+
+ -- Aaron M. Ucko <ucko@debian.org> Sun, 22 Oct 2006 19:32:02 -0400
+
+ncbi-tools6 (6.1.20060507-3) unstable; urgency=low
+
+ * Drop transitional packages, which are now entirely redundant thanks to
+ the binNMU of clustalx for i386 earlier this June. (Closes: #322059.)
+ * Migrate to lesstif2, renaming libvibrant6(-dbg) to libvibrant6a(-dbg)
+ to avoid any possibility of version skew. [Lesstif lacks versioned
+ symbols, though admittedly so does Vibrant.] (Closes: #374233.)
+ * Make debian/stamp-setup a dependency of common-configure-indep as well
+ as common-configure-arch so that building via an immediate call to
+ "fakeroot debian/rules binary" works properly, per #373971.
+ * Explicitly build depend on modular versions of *all* relevant X
+ libraries, per the other issue in #373971 (and to ensure that the arm
+ autobuilder's failure mode *really* can't recur).
+
+ -- Aaron M. Ucko <ucko@debian.org> Sat, 24 Jun 2006 09:28:43 -0400
+
+ncbi-tools6 (6.1.20060507-2) unstable; urgency=low
+
+ * Version the build-dependency on libxmu-dev to (>= 1:1) to ensure that
+ we *can* actually drop -I/usr/X11R6/include and -L/usr/X11R6/lib,
+ avoiding the failure mode observed on the arm autobuilder.
+ * Further increase cdbs's minimum required version to the brand new
+ 0.4.40, which automatically sets DEB_DBG_PACKAGE_* appropriately.
+
+ -- Aaron M. Ucko <ucko@debian.org> Mon, 29 May 2006 20:42:28 -0400
+
+ncbi-tools6 (6.1.20060507-1) unstable; urgency=low
+
+ * New upstream release (issued on May 26, but from older sources).
+ * Drop obsolete -I/usr/X11R6/include and -L/usr/X11R6/lib flags.
+ * Rework inter-package relationships with the help of dpkg-dev 1.13.19.
+ * Migrate remaining shared library support files (including vibrate) to
+ ncbi-data, as they're conveniently all architecture-independent.
+ * Add cleanasn (new) to the list of applications to build, and give it a
+ man page.
+ * Update existing man pages.
+ * Increase the cdbs requirement to 0.4.39-0.1, and drop workarounds for
+ (some?) older versions.
+ * Switch to debhelper compatibility level 5, with its reworked -dbg
+ package handling.
+ * Standards-Version: 3.7.2.
+
+ -- Aaron M. Ucko <ucko@debian.org> Mon, 29 May 2006 16:50:27 -0400
+
+ncbi-tools6 (6.1.20060301-1) unstable; urgency=low
+
+ * New (relatively, anyway ;-P) upstream release.
+ * (Build-)depend directly on libgl(u)1-mesa-dev by default (but keep
+ the alternate [build-]dependencies on virtual packages, of course).
+ * Add insdseqget to the list of applications to build.
+ * Stop installing wwwblast.h, which is private to code we don't even
+ build.
+ * Update man pages (and add one for insdseqget, forked from gbseqget's).
+
+ -- Aaron M. Ucko <ucko@debian.org> Sun, 16 Apr 2006 12:52:44 -0400
+
+ncbi-tools6 (6.1.20051206-1) unstable; urgency=low
+
+ * New upstream release.
+ * Temporarily switch to pmake (added to Build-Depends) for upstream's
+ makefiles, as GNU make 3.81.b4 gets mysteriously confused when trying
+ to build from them (but, oddly, only when invoked from debian/rules).
+ * Add "new" blastall_old executable to the blast2 package.
+ * Reshuffle documents slightly, and make sure to register all top-level
+ HTML documents with doc-base.
+ * Loosen libncbi6's dependency on ncbi-data to accommodate binary-only
+ NMUs.
+
+ -- Aaron M. Ucko <ucko@debian.org> Thu, 12 Jan 2006 18:50:27 -0500
+
+ncbi-tools6 (6.1.20050828-1) unstable; urgency=low
+
+ * New upstream release
+ - Adds two new programs: sbtedit (in ncbi-tools-x11) and trna2sap
+ (in ncbi-tools-bin).
+ * Drop obsolete alternative (build-)dependencies on ancient versions of
+ xlibs-dev, and silly build-dependency on libglu1-xorg | libglu1c2, and
+ resync libvibrant-dev's dependencies properly.
+ * Add man pages for the new programs, and clean up and update others as
+ needed.
+
+ -- Aaron M. Ucko <ucko@debian.org> Fri, 4 Nov 2005 16:41:18 -0500
+
+ncbi-tools6 (6.1.20050605-2) unstable; urgency=low
+
+ * Adjust default libglu-dev to libglu1-xorg-dev to avoid confusing the
+ autobuilders.
+
+ -- Aaron M. Ucko <ucko@debian.org> Fri, 15 Jul 2005 23:37:06 -0400
+
+ncbi-tools6 (6.1.20050605-1) unstable; urgency=low
+
+ * New upstream release.
+ * Enable asn2asn via VIB rather than unnecessarily modifying
+ makedemo.unx, and add (and document) nps2gps and trna2tbl along
+ the way.
+ * Make sure to build with libglu1c2 for the C++ transition.
+ * Don't set DEB_DH_SHLIBDEPS_ARGS; it's not necessary with current
+ versions of dpkg and cdbs, and -L isn't actually additive anyway.
+ * Bump standards-version to 3.6.2 (no changes needed).
+
+ -- Aaron M. Ucko <ucko@debian.org> Fri, 15 Jul 2005 19:03:40 -0400
+
+ncbi-tools6 (6.1.20050429-1) unstable; urgency=low
+
+ * New upstream release.
+ * Add and document asn2all, asn2fsa, asnval, and gene2xml, even though
+ makedis.csh still omits them.
+ * Make Nentrez and Psequin available under the saner names entrez and
+ sequin.
+ * Tweak debian/rules to better handle "draft" builds from subversion.
+
+ -- Aaron M. Ucko <ucko@debian.org> Tue, 17 May 2005 17:43:14 -0400
+
+ncbi-tools6 (6.1.20041020-3) unstable; urgency=low
+
+ * Fix FTBFS under GCC 4.0 caused by inconsistent use of "static" on
+ functions. (Closes: #295110.)
+ * Add a watch file, now that we can. (Upstream's layout needs version=3.)
+
+ -- Aaron M. Ucko <ucko@debian.org> Sun, 27 Mar 2005 12:00:15 -0500
+
+ncbi-tools6 (6.1.20041020-2) unstable; urgency=low
+
+ * Add spidey to ncbi-tools-bin by Steffen Moeller's request, and
+ incorporate some documentation he supplied for it. (Closes: #291895.)
+
+ -- Aaron M. Ucko <ucko@debian.org> Tue, 25 Jan 2005 18:16:49 -0500
+
+ncbi-tools6 (6.1.20041020-1) unstable; urgency=low
+
+ * New upstream release; debian/* resynched as necessary.
+ - Fixes Vibrant invisible text bug!
+ * Take advantage of menu 2.1.8's support for multiple required packages.
+
+ -- Aaron M. Ucko <ucko@debian.org> Mon, 1 Nov 2004 20:07:56 -0500
+
+ncbi-tools6 (6.1.20040616-1) unstable; urgency=low
+
+ * New upstream release.
+ * debian/blast2.docs: adjusted for new arrangement (a separate
+ source-tree directory full of HTML files).
+ * debian/{control,lib*-dbg.install,rules}: switch to new-style -dbg
+ packages containing just the stripped-out symbols.
+ * debian/{installman,ncbi-tools-bin.install,rules}: upstream has dropped
+ f(asta)merge.
+
+ -- Aaron M. Ucko <ucko@debian.org> Sat, 26 Jun 2004 00:18:09 -0400
+
+ncbi-tools6 (6.1.20040505-1) unstable; urgency=low
+
+ * New upstream release.
+ * debian/rules:
+ - set BLAST_VERSION from demo/.BLAST_VERSION rather than parsing
+ tools/blastdef.h.
+
+ -- Aaron M. Ucko <ucko@debian.org> Sat, 15 May 2004 17:49:45 -0400
+
+ncbi-tools6 (6.1.20040204-3) unstable; urgency=low
+
+ * Update X-related (build-)dependencies per the changes in 4.3.
+ * Reunite the Vibrant packages, with libvibrant.so.6 and
+ libncbicn3d.so.6 always pointing at the OpenGL-enabled versions, now
+ that xlibmesa-gl merely suggests the heavyweight packages containing
+ acceleration modules.
+ * As such, tighten shlibdeps for libvibrant6 to avoid possible trouble.
+
+ -- Aaron M. Ucko <ucko@debian.org> Wed, 10 Mar 2004 18:48:26 -0500
+
+ncbi-tools6 (6.1.20040204-2) unstable; urgency=low
+
+ * debian/{libncbi6-dev,rules}: account for new include subdirectories.
+
+ -- Aaron M. Ucko <ucko@debian.org> Sun, 8 Feb 2004 22:42:12 -0500
+
+ncbi-tools6 (6.1.20040204-1) unstable; urgency=low
+
+ * New upstream release.
+ * debian/copyright: expand public domain notice to full length.
+ * debian/*.install: install newly added files.
+ * debian/rules:
+ - supply appropriate -L args to dh_shlibdeps (accidentally lost when
+ converting to CDBS).
+ - various minor cleanups.
+ * demo/debruijn.c: fix fencepost error.
+ * desktop/bspview.c, vibrant/netscape.c: launch sensible-browser rather
+ than netscape.
+ * doc/man/blast.1: document new blast2 executable.
+ * doc/man/debruijn.1: new, based on help output.
+ * make/makeshlb.unx: add dependency info for libblast(api).
+
+ -- Aaron M. Ucko <ucko@debian.org> Fri, 6 Feb 2004 22:03:25 -0500
+
+ncbi-tools6 (6.1.20031028-1) unstable; urgency=low
+
+ * New upstream release.
+ * debian/blast2.docs: follow README.* -> *.txt renaming.
+ * debian/libncbi6-dev.install: add new headers scoremat.h and wwwblast.h.
+ * debian/installman: new; factored out of debian/rules, and enhanced
+ to look in doc/man before debian/man and tweak pages as needed.
+ * debian/instdoc: removed (not used since conversion to CDBS).
+ * debian/man/*: remove pages now committed upstream.
+ * debian/{ncbi-tools-bin.files,rules}: remove cdscan (obsolete).
+ * debian/rules: run new debian/installman script.
+ * debian/vibrant/vibwndws.c: add a weak declaration of Nlm_Main
+ (and code to complain if it's not satisfied) here too.
+
+ -- Aaron M. Ucko <ucko@debian.org> Mon, 10 Nov 2003 22:51:03 -0500
+
+ncbi-tools6 (6.1.20030421-6) unstable; urgency=low
+
+ * debian/control: Fix libncbi6-dbg to depend directly on libncbi6
+ rather than on the transitional ncbi-tools6 package.
+ * debian/{control,lib*-dbg.install,rules}: While I'm at it, move
+ unstripped libraries from /usr/lib/ncbi-tools-dbg to /usr/lib/debug.
+
+ -- Aaron M. Ucko <ucko@debian.org> Fri, 17 Oct 2003 23:24:32 -0400
+
+ncbi-tools6 (6.1.20030421-5) unstable; urgency=low
+
+ * debian/control:
+ - Downgrade oldlibs packages (ncbi-tools6 and vibrant6) to priority
+ extra, per override.
+ - Bump CDBS build-dependency to >= 0.4.12.
+ - Drop redundant entries from build-depends-indep.
+ * debian/libncbi6.doc-base: Actually supply the documentation
+ directory's current name. (Closes: #215398.)
+ * debian/rules: Take advantage of CDBS 0.4.12's support for -dbg packages.
+ * corelib/ncbimain.c: Use an __attribute__((weak)) declaration for
+ Nlm_Main rather than a dummy implementation + #pragma weak.
+ * vibrant/shim3d.c: Likewise for Cn3D_GetCurrentOGLData.
+
+ -- Aaron M. Ucko <ucko@debian.org> Sun, 12 Oct 2003 11:18:21 -0400
+
+ncbi-tools6 (6.1.20030421-4) unstable; urgency=low
+
+ * debian/rules: compile with -mieee on Alpha to fix platform-specific
+ FPEs. (Closes: #127224).
+ * doc/README.bls: updated to latest upstream version (which includes the
+ missing release notes for 2.2.6).
+
+ -- Aaron M. Ucko <ucko@debian.org> Tue, 2 Sep 2003 11:13:09 -0400
+
+ncbi-tools6 (6.1.20030421-3) unstable; urgency=low
+
+ * debian/control:
+ - Bump Standards-Version to 3.6.1 (no changes needed).
+ - blast2, ncbi-tools-bin: Suggest libvibrant6 rather than vibrant6.
+ - libvibrant6-gl{,-dev}, ncbi-tools-x11: lower priority to extra due
+ to conflicts with libvibrant6-nogl, which is optional.
+
+ -- Aaron M. Ucko <ucko@debian.org> Fri, 22 Aug 2003 20:21:56 -0400
+
+ncbi-tools6 (6.1.20030421-2) unstable; urgency=low
+
+ * The "overdue cleanup" release.
+ * general (debian/*, make/makeshlb.unx):
+ - Rename library packages to start with "lib"; ncbi-tools6 and vibrant6
+ are now dummy forwarding packages.
+ - Move libvibgif.so.6 to libncbi6, since it's independent of X.
+ - Split GL and non-GL variants of libvibrant and libncbicn3d into
+ separate packages.
+ - Standardize on the network version of the Entrez 1 access library
+ (libncbiNacc), if only for the sake of other libraries that need any
+ of the three variants; the CDROM-only version's not so useful
+ nowadays, and the combo version seems to misfire without the CDs.
+ Note that all three remain available in static form.
+ - Handle the circular relationship between libncbiNacc and libnetentr by
+ linking the PIC version of libnetentr.a into libncbiNacc.so and making
+ libnetentr.so.6 merely another link to libncbiNacc.so.6. (Kludge.)
+ - Set up proper shared library dependencies, now that it is possible to
+ do so uniquely.
+ - Now compliant with Policy 3.6.0.
+ * connect/ncbi_http_connector.c: Don't half-close sockets after sending
+ headers, as we can't always successfully read from them afterwards
+ (due to broken firewalls?).
+ * debian/rules:
+ - Switch to CDBS, despite upstream's funky build system.
+ - Stop imposing the obsolete menu icon color restriction.
+
+ -- Aaron M. Ucko <ucko@debian.org> Mon, 28 Jul 2003 20:11:26 -0400
+
+ncbi-tools6 (6.1.20030421-1) unstable; urgency=low
+
+ * New upstream release.
+ * api/aliread.c: avoid char vs. EOF comparisons.
+ * debian/{blast2,ncbi-tools6-dev}.docs: package new upstream docs.
+ * debian/control:
+ - Change section to devel.
+ - Bump standards version to 3.5.9 (already compliant).
+ - Change preferred libpng-dev to libpng12-dev (12-0-dev went away).
+ * debian/man/Psequin.1: sequin seems to take options after all;
+ (very roughly) document them.
+ * debian/man/{asn2gb,blast,fastacmd,gbseqget,gil2bin,tbl2asn}.1:
+ - Update to reflect current help output.
+ * debian/rules: add bl2seq to VIB so we still actually build it.
+ * demo/gil2bin.c: #include <blast.h> for GetGisFromFile prototype.
+
+ -- Aaron M. Ucko <ucko@debian.org> Sun, 27 Apr 2003 12:41:48 -0400
+
+ncbi-tools6 (6.1.20021213-5) unstable; urgency=low
+
+ * debian/control: Build-Conflict on xlibmesa-glu-dev (<< 4.2.1-6), and
+ drop corresponding workarounds. (See #178310 and #178374.)
+
+ -- Aaron M. Ucko <ucko@debian.org> Tue, 25 Feb 2003 23:44:39 -0500
+
+ncbi-tools6 (6.1.20021213-4) unstable; urgency=low
+
+ * Oops, add a dependency on xlibmesa-gl-dev|libgl-dev because
+ xlibmesa-glu-dev doesn't seem to depend on it....
+ * Likewise for xlibmesa3-glu | libglu1, due to #178310.
+ * Still no (intentional) changes in actual content relative to
+ 6.1.20021213-2.
+
+ -- Aaron M. Ucko <ucko@debian.org> Fri, 24 Jan 2003 22:07:51 -0500
+
+ncbi-tools6 (6.1.20021213-3) unstable; urgency=low
+
+ * Update OpenGL deps to xlibmesa-glu-dev|libglu-dev.
+ * Hack debian/rules to give blast2 a more meaningful version number.
+ * Finally rename *.files to *.install and change dh_movefiles -a to
+ dh_install -a --autodest --list-missing --sourcedir=debian/tmp. (Drop
+ ncbi-data.files in favor of installing directly into debian/ncbi-data.)
+ * Add lintian overrides for menu-icon-missing warnings.
+
+ -- Aaron M. Ucko <ucko@debian.org> Fri, 24 Jan 2003 14:43:59 -0500
+
+ncbi-tools6 (6.1.20021213-2) unstable; urgency=low
+
+ * Address char-signedness issues. (Closes: #177392)
+
+ -- Aaron M. Ucko <ucko@debian.org> Tue, 21 Jan 2003 21:04:50 -0500
+
+ncbi-tools6 (6.1.20021213-1) unstable; urgency=low
+
+ * New upstream release. (Man pages updated.)
+ * Change preferred libpng-dev to libpng12-0-dev rather than libpng3-dev
+ (which is a dummy package these days).
+ * Abandon plans for switching to lesstif2, as Vibrant seems to work
+ better with lesstif1.
+
+ -- Aaron M. Ucko <ucko@debian.org> Tue, 17 Dec 2002 22:34:26 -0500
+
+ncbi-tools6 (6.1.20021119-1) unstable; urgency=low
+
+ * New upstream release. (Man pages updated accordingly.)
+ * Update for policy 3.5.8: move menu entries to Apps/Science per #162812.
+ * Indicate options in man pages with \- rather than - per #159872.
+ * Move icons from /usr/X11R6/include/X11/pixmaps to /usr/share/pixmaps.
+
+ -- Aaron M. Ucko <ucko@debian.org> Thu, 21 Nov 2002 09:05:38 -0500
+
+ncbi-tools6 (6.1.20020828-2) unstable; urgency=low
+
+ * Try to use madvise only if MADV_NORMAL is actually defined.
+
+ -- Aaron M. Ucko <ucko@debian.org> Thu, 5 Sep 2002 10:49:01 -0400
+
+ncbi-tools6 (6.1.20020828-1) unstable; urgency=low
+
+ * New upstream release.
+ * Update man pages based on current help output.
+ * Go to standards version 3.5.7 (support "noopt" rather than "debug" in
+ DEB_BUILD_OPTIONS).
+ * Strictly speaking, the ABI changes should necessitate a new soname,
+ but no external Debian packages seem to use the affected interfaces,
+ so I'll be lazy. You may need to rebuild any local binaries you have.
+ (Conflict with old versions of our binary packages, though.)
+
+ -- Aaron M. Ucko <ucko@debian.org> Wed, 4 Sep 2002 20:30:31 -0400
+
+ncbi-tools6 (6.1.20020426-5) unstable; urgency=low
+
+ * Add a second hyphen before (no-)whole-archive to fix the ARM build.
+
+ -- Aaron M. Ucko <ucko@debian.org> Mon, 26 Aug 2002 18:41:08 -0400
+
+ncbi-tools6 (6.1.20020426-4) unstable; urgency=low
+
+ * Partially migrate to debhelper v4.
+ * Pave the way for C++ toolkit packages (in progress):
+ - Provide a weak default definition of Nlm_Main so that our shared
+ libncbi doesn't bite applications which supply their own main().
+ - Rename Cn3D to Cn3D-3.0 and register it as an alternative for Cn3D.
+ * Move to libpng3 (only affects applications).
+ * Rename fmerge to fastamerge to resolve conflict with fhist.
+ (Closes: #155791)
+
+ -- Aaron M. Ucko <ucko@debian.org> Fri, 23 Aug 2002 22:34:17 -0400
+
+ncbi-tools6 (6.1.20020426-3) unstable; urgency=low
+
+ * Remove getseq (which isn't terribly useful) to resolve conflict with
+ hmmer. (Closes: #147793)
+
+ -- Aaron M. Ucko <ucko@debian.org> Thu, 23 May 2002 21:20:47 -0400
+
+ncbi-tools6 (6.1.20020426-2) unstable; urgency=low
+
+ * Enable large-file support; please let me know if this turns out to
+ break anything. (Closes: #144531)
+ * Don't build ncbithr.o or link against -lpthread unless that library
+ actually exists; should help on non-Linux ports.
+
+ -- Aaron M. Ucko <ucko@debian.org> Thu, 9 May 2002 19:26:35 -0400
+
+ncbi-tools6 (6.1.20020426-1) unstable; urgency=low
+
+ * New upstream release; apparently fixes formatdb segfault on PowerPC
+ (closes: #144783).
+ * Some existing interfaces have changed, but not enough to justify
+ bumping the soname; if binaries built against older revisions of the
+ toolkit no longer work, try rebuilding them. (I don't believe this
+ affects any other Debian packages.)
+ * Updated man pages based on current help output.
+ * Patched both versions (regular and Vibrant) of common argument-
+ processing code to honor "--help" (closes: #144785).
+
+ -- Aaron M. Ucko <ucko@debian.org> Sun, 28 Apr 2002 18:30:43 -0400
+
+ncbi-tools6 (6.1.20011220a-2) unstable; urgency=low
+
+ * Whoops, ncbi-data should replace pre-split versions of ncbi-tools6.
+
+ -- Aaron M. Ucko <ucko@debian.org> Thu, 4 Apr 2002 22:13:09 -0500
+
+ncbi-tools6 (6.1.20011220a-1) unstable; urgency=low
+
+ * New upstream release, mostly appears to address some megablast issues.
+ * Deal with some 64-bit-cleanliness issues.
+ * Partially fix Cn3D lossage in #127224. (It still crashes, but later.)
+ * Fix copymat lossage with trailing spaces and improve its error
+ messages (closes: #138933).
+ * Split architecture-independent files into new ncbi-data package.
+ * Fix path to libXm.so.1 in vibrate.
+
+ -- Aaron M. Ucko <ucko@debian.org> Sun, 31 Mar 2002 10:33:49 -0500
+
+ncbi-tools6 (6.1.20011220-2) unstable; urgency=low
+
+ * Update manpages based on current help output.
+ * Fix typo in description (ASN1 -> ASN.1).
+ * Use $(CC) rather than gcc in makeshlb.unx.
+ * Build asn2asn.
+
+ -- Aaron M. Ucko <ucko@debian.org> Fri, 28 Dec 2001 13:48:20 -0500
+
+ncbi-tools6 (6.1.20011220-1) unstable; urgency=low
+
+ * New upstream release (Closes: #126625).
+ * Bug #31724 is probably fixed by now, and too vague to do much of
+ anything with anyway. (Closes: #31724; please supply useful details
+ if reopening.)
+ * Tweak rules so that the shlibs dependency is always
+ (>= [latest.upstream.version]-1).
+
+ -- Aaron M. Ucko <ucko@debian.org> Thu, 27 Dec 2001 21:08:17 -0500
+
+ncbi-tools6 (6.1.20010709-9) unstable; urgency=low
+
+ * Menu seems to be broken on some architectures, so drop build
+ dependency and add a copy of cmap.xpm to debian/.
+ * Slightly rework treatment of icons in debian/rules.
+ * Change "c-shell" to "tcsh|c-shell" in build-deps to address buildd
+ warnings.
+ * Add lintian overrides for new menu file.
+
+ -- Aaron M. Ucko <ucko@debian.org> Thu, 20 Dec 2001 11:47:53 -0500
+
+ncbi-tools6 (6.1.20010709-8) unstable; urgency=low
+
+ * Change priority of debugging libraries to extra, per the override file.
+ * Add menu file for ncbi-tools6-dev (asntool) and menu icons.
+ * Add build-depends on ImageMagick and menu for icon creation.
+ * Clean up internal script for creating menu files.
+
+ -- Aaron M. Ucko <ucko@debian.org> Tue, 18 Dec 2001 21:12:41 -0500
+
+ncbi-tools6 (6.1.20010709-7) unstable; urgency=low
+
+ * Change section of debugging libraries from libs to devel.
+
+ -- Aaron M. Ucko <ucko@debian.org> Sun, 18 Nov 2001 20:36:31 -0500
+
+ncbi-tools6 (6.1.20010709-6) unstable; urgency=low
+
+ * Introduce debugging libraries. (Closes: #38354).
+
+ -- Aaron M. Ucko <ucko@debian.org> Mon, 12 Nov 2001 12:08:44 -0500
+
+ncbi-tools6 (6.1.20010709-5) unstable; urgency=low
+
+ * Sigh, the change in -4 intended to fix arm broke it instead; revert to
+ __arm__. Where'd I put that paper bag? ;-)
+ * Allow #cpu(...) and #machine(...) for all platforms.
+ * Downgrade "unknown platform" to a warning; the code mostly doesn't
+ care which PROC_XXX macro, if any, gets defined (and when it does, may
+ read too much from it; see below).
+ * Fix uses of PROC_XXX not to assume that MIPS -> IRIX or HPPA -> HP/UX.
+ * Use appropriate sysconf to get processor count.
+
+ -- Aaron M. Ucko <ucko@debian.org> Tue, 16 Oct 2001 13:26:49 -0400
+
+ncbi-tools6 (6.1.20010709-4) unstable; urgency=low
+
+ * Also fix test for m68k. Why can't the macros be more consistent?
+ * Check everything else against the GCC sources and find that __arm__
+ should be arm.
+ * That should be all of these; apologies for the inconvenience.
+
+ -- Aaron M. Ucko <ucko@debian.org> Sat, 13 Oct 2001 14:50:03 -0400
+
+ncbi-tools6 (6.1.20010709-3) unstable; urgency=low
+
+ * Fix test for powerpc in ncbilcl.lnx. (Check for two likely
+ definitions to be extra safe. ;-))
+
+ -- Aaron M. Ucko <ucko@debian.org> Fri, 12 Oct 2001 10:50:39 -0400
+
+ncbi-tools6 (6.1.20010709-2) unstable; urgency=low
+
+ * Fix problems caught by autobuilders:
+ * Rewrite clean rule to avoid mkdir. (Closes: #115103)
+ * Add build-dependency on c-shell (ugh) for ln-if-absent.
+ *
+ * Whoops, my previous sweep missed two (old, minor) bugs on
+ ncbi-tools6-dev:
+ * 31724: I suspect I can close this by now, but don't have a whole lot
+ of information to go on; could somebody on an Alpha investigate?
+ * 38354: Debugging libraries would be a good idea, but I'm holding off
+ until autobuilds succeed because adding more binary packages
+ introduces ftpmaster wait.
+ *
+ * Keep shlib requirement at >= 6.1.20010709-1, because this version
+ doesn't change anything relevant.
+ * Add HTTP URL for HTML SDK docs.
+ * Optimize out blast.REAL build.
+
+ -- Aaron M. Ucko <ucko@debian.org> Wed, 10 Oct 2001 18:42:44 -0400
+
+ncbi-tools6 (6.1.20010709-1) unstable; urgency=low
+
+ * New upstream version; adds more apps, and includes newer BLAST (2.2.1
+ rather than 2.0.9). (Closes: #33451, #37966, #37967, #47369, #101168)
+ * Repackaged largely from scratch, acknowledging the convoluted nature
+ of the upstream build system.
+ * Put ncbi-tools6 and vibrant6 in section "libs", where they belong,
+ rather than "devel" (already correct in override file).
+ * Used the same form of my name in the control file and the changelog so
+ that katie doesn't think I'm making NMUs.
+ * Acknowledged my own last "NMU" (Closes: #100247, #103550, #104365)
+ * Enabled thread support for appropriate applications. (Closes: #35216)
+ * Added automatic fallback to /etc/ncbi if NCBI not set in the
+ environment; did away with no-longer-necessary wrappers.
+ * New binary packages for apps: ncbi-tools-bin and ncbi-tools-x11.
+ * Moved data to /usr/share/ncbi/data, since it's architecture-independent.
+ * Closes all existing bugs. Let's see how long that lasts...
+ and no fair filing silly reports just to thwart me. ;-)
+ * Dropped text version of old SDK docs in favor of pointer to online HTML
+ version.
+ * Don't link against Vibrant unnecessarily; instead, provide a wrapper
+ script (vibrate) with the same net effect.
+ * Added menu entries (using vibrate for apps it benefits).
+ * Added Lintian overrides to deal with cross-package menu entries.
+ * Registered with doc-base.
+ * Clean by Lintian 1.20.15, modulo the aforementioned overrides.
+
+ -- Aaron M. Ucko <ucko@debian.org> Sat, 6 Oct 2001 10:51:36 -0400
+
+ncbi-tools6 (6.0.2-3) unstable; urgency=low
+
+ * Adopted. (Closes: #100247)
+ * Acknowledge previous NMUs. (Closes: #103550, #104365)
+ * Stop installing /usr/share/doc/ncbi-tools6/NCBI/fa2htgs/updateHtgsDoc;
+ it was causing a Lintian error (executable file under /usr/share/doc)
+ and not useful as-is anyway (referring to paths only valid on NCBI
+ systems).
+ * Honor DEB_BUILD_OPTIONS, and build without -g by default.
+ * Above change should suffice to bump standards version to 3.5.6. Yay!
+ * Now clean by Lintian 1.20.14.1.
+
+ -- Aaron M. Ucko <ucko@debian.org> Thu, 6 Sep 2001 11:05:49 -0400
+
+ncbi-tools6 (6.0.2-2.2) unstable; urgency=low
+
+ * NMU
+ * The previous maintainer has resigned. Setting maintainer to Debian QA
+ Group <packages@qa.debian.org>.
+ * debian/ncbi-tools6-dev.README.debian: add final newline to shut diff up
+ * debian/control: tidied up package descriptions
+ * debian/rules: use dh_shlibdeps -l instead of LD_LIBRARY_PATH
+ * debian/{shlibs,vibrant6.shlibs}: while we're at it, why don't we have
+ some shlibs files to go with these shared library packages, like they
+ taught us in freshman year at Debian University
+ * Thanks to the above two fixes... (Closes: #104365)
+
+ -- Dr. Branden Robinson <branden@debian.org> Sat, 11 Aug 2001 20:57:17 -0500
+
+ncbi-tools6 (6.0.2-2.1) unstable; urgency=low
+
+ * Non-maintainer upload.
+ * va_arg promotes shorts to ints. This is flagged as an error by
+ gcc >= 2.96. Closes: #103550
+
+ -- LaMont Jones <lamont@debian.org> Mon, 9 Jul 2001 21:39:34 -0600
+
+ncbi-tools6 (6.0.2-2) unstable; urgency=low
+
+ * Adopted by new maintainer; closes: #92794, #92796, #92798, #48176
+ * Corrected typo in manpage for formatdb; closes: #38483
+ * Removed self-conflict of vibrant-dev; closes: #49712
+ * Changed the double installation of the copyright file by ncbi-tools6 and
+ ncbi-tools6-dev into the same doc directory (and added a README.Debian in
+ /usr/share/doc/ncbi-tools6-dev); closes: #51122, #77541, #56643
+ * Added the installation of README.blast.
+ * Updated to newer standards version and added Build-Depends.
+ * Added debhelper token to vibrant6.preinst to fix lintian warning.
+ * Moved blast2 from section misc to science, because it is a tool that
+ is exclusively useful for molecular biologists.
+
+ -- Dr. Guenter Bechly <gbechly@debian.org> Fri, 13 Apr 2001 15:12:10 +0200
+
+ncbi-tools6 (6.0.2-1.1) unstable; urgency=low
+
+ * NMU.
+ * Recompiled against lesstif1. Closes: #48176
+
+ -- Adam Heath <doogie@debian.org> Mon, 25 Oct 1999 07:05:49 -0500
+
+ncbi-tools6 (6.0.2-1) unstable; urgency=low
+
+ * New upstream release (includes Blast 2.0.8).
+ Addresses #33451 but does not solve it completely.
+ * Manual page. Closes #30227
+ * Add the vibrant package
+ * Proper symlinks in -dev packages. Closes #31619
+
+ -- Stephane Bortzmeyer <bortzmeyer@debian.org> Mon, 15 Feb 1999 12:55:01 +0100
+
+ncbi-tools6 (6.0.1-1) unstable; urgency=low
+
+ * New upstream release
+ * Add the blast package
+
+ -- Stephane Bortzmeyer <bortzmeyer@debian.org> Thu, 12 Nov 1998 15:55:02 +0100
+
+ncbi-tools6 (6.0-3) frozen; urgency=low
+
+ * Changes in the dependencies in control. Closes #28610
+ * Change in rules: the source package was broken and uncompilable. Closes #28978
+
+ -- Stephane Bortzmeyer <bortzmeyer@debian.org> Wed, 28 Oct 1998 09:16:49 +0100
+
+ncbi-tools6 (6.0-2) unstable; urgency=low
+
+ * Various lintian warnings suppressed
+ * Not all files are copied in /usr/lib/ncbi/data, to save space
+
+ -- Stephane Bortzmeyer <bortzmeyer@debian.org> Mon, 26 Oct 1998 15:59:25 +0100
+
+ncbi-tools6 (6.0-1) unstable; urgency=low
+
+ * Initial Release. First public release.
+
+ -- Stephane Bortzmeyer <bortzmeyer@debian.org> Tue, 22 Sep 1998 17:23:12 +0200
+
+
diff --git a/debian/compat b/debian/compat
new file mode 100644
index 00000000..b4de3947
--- /dev/null
+++ b/debian/compat
@@ -0,0 +1 @@
+11
diff --git a/debian/control b/debian/control
new file mode 100644
index 00000000..b1622514
--- /dev/null
+++ b/debian/control
@@ -0,0 +1,163 @@
+Source: ncbi-tools6
+Maintainer: Debian Med Packaging Team <debian-med-packaging@lists.alioth.debian.org>
+Uploaders: Aaron M. Ucko <ucko@debian.org>
+Section: libdevel
+Priority: optional
+Build-Depends: debhelper (>= 11~)
+Build-Depends-Arch: csh | c-shell,
+ libglu1-mesa-dev | libglu-dev,
+ libgnutls28-dev | gnutls-dev,
+ libmotif-dev,
+ libpcre3-dev,
+ libpng-dev,
+ libxmu-dev
+Build-Depends-Indep: icoutils,
+ imagemagick
+Standards-Version: 4.3.0
+Vcs-Browser: https://salsa.debian.org/med-team/ncbi-tools6
+Vcs-Git: https://salsa.debian.org/med-team/ncbi-tools6.git
+Homepage: http://www.ncbi.nlm.nih.gov/IEB/ToolBox/
+Rules-Requires-Root: no
+
+Package: libncbi6
+Architecture: any
+Multi-Arch: same
+Section: libs
+Depends: ncbi-data (= ${source:Version}),
+ ${misc:Depends},
+ ${shlibs:Depends}
+Pre-Depends: ${misc:Pre-Depends}
+Description: NCBI libraries for biology applications
+ The NCBI Software Development Toolkit was developed for the production and
+ distribution of GenBank, Entrez, BLAST, and related services by NCBI. It
+ allows you to read and write NCBI ASN.1 files, builds Blast or Entrez, etc.
+
+Package: libncbi6-dev
+Architecture: any
+Multi-Arch: same
+Depends: libncbi6 (= ${binary:Version}),
+ ${misc:Depends}
+Recommends: ncbi-tools-bin
+Provides: ncbi-tools-dev
+Description: NCBI libraries for biology applications (development files)
+ This package supplies development versions of NCBI's non-graphical C
+ libraries, along with the corresponding header files.
+
+Package: ncbi-data
+Architecture: all
+Multi-Arch: foreign
+Section: libs
+Depends: ${misc:Depends}
+Breaks: ncbi-rrna-data (<< 6.1.20160908)
+Replaces: ncbi-rrna-data (<< 6.1.20160908)
+Description: Platform-independent data for the NCBI toolkit
+ This package contains support files needed by the NCBI toolkit on all
+ platforms.
+
+Package: ncbi-rrna-data
+Architecture: all
+Multi-Arch: foreign
+Section: science
+Depends: ncbi-data,
+ ${misc:Depends}
+Recommends: ncbi-blast+
+Breaks: ncbi-data (<< 6.1.20160908)
+Replaces: ncbi-data (<< 6.1.20160908)
+Description: large rRNA BLAST databases distributed with the NCBI toolkit
+ This package contains some ribosomal RNA BLAST databases distributed
+ as part of the NCBI C Toolkit that are too large and specialized to
+ include in ncbi-data. Specifically, it contains the databases
+ Combined16SrRNA, LSURef_93.fasta, LSU_nomito_nochloro_noplastid,
+ SSURef_93.fasta, and SSU_nomito_nochloro_noplastid, along with alias
+ files to facilitate searching some of them in conjunction with
+ databases included in ncbi-data.
+
+Package: ncbi-tools-bin
+Architecture: any
+Multi-Arch: foreign
+Section: science
+Depends: libncbi6 (<< ${source:Upstream-Version}.1),
+ libncbi6 (>= ${source:Upstream-Version}),
+ ${misc:Depends},
+ ${shlibs:Depends}
+Suggests: libvibrant6b,
+ ncbi-blast+,
+ ncbi-cn3d,
+ ncbi-tools-x11
+Breaks: blast2 (<< 1:2.2.26.20160908)
+Replaces: blast2 (<< 1:2.2.26.20160908)
+Description: NCBI libraries for biology applications (text-based utilities)
+ This package includes various utilities distributed with the NCBI C SDK,
+ including the development tools asntool and errhdr (formerly of
+ libncbi6-dev). None of the programs in this package require X; you can
+ find the X-based utilities in the ncbi-tools-x11 package. BLAST and
+ related tools now come from a separate source base, corresponding to the
+ ncbi-blast+ and ncbi-blast+-legacy packages.
+
+Package: ncbi-tools-x11
+Architecture: any
+Multi-Arch: foreign
+Section: science
+Depends: libncbi6 (<< ${source:Upstream-Version}.1),
+ libncbi6 (>= ${source:Upstream-Version}),
+ libvibrant6b (<< ${source:Upstream-Version}.1),
+ libvibrant6b (>= ${source:Upstream-Version}),
+ ncbi-cn3d,
+ ${misc:Depends},
+ ${shlibs:Depends}
+Suggests: ncbi-tools-bin
+Description: NCBI libraries for biology applications (X-based utilities)
+ This package includes some X-based utilities distributed with the
+ NCBI C SDK: Network Entrez, Sequin, ddv, and udv. These programs
+ are not part of ncbi-tools-bin because they depend on several
+ additional library packages.
+
+Package: ncbi-cn3d
+Architecture: any
+Multi-Arch: foreign
+Section: science
+Depends: libncbi6 (<< ${source:Upstream-Version}.1),
+ libncbi6 (>= ${source:Upstream-Version}),
+ libvibrant6b (<< ${source:Upstream-Version}.1),
+ libvibrant6b (>= ${source:Upstream-Version}),
+ ${misc:Depends},
+ ${shlibs:Depends}
+Suggests: ncbi-tools-bin,
+ ncbi-tools-x11
+Breaks: ncbi-tools-x11 (<< 6.1.20170106-7~)
+Replaces: ncbi-tools-x11 (<< 6.1.20170106-7~)
+Description: 3-dimensional viewer for biological molecules
+ Cn3D is a helper application for your web browser that allows you to
+ view 3-dimensional structures from NCBI's Entrez retrieval service.
+
+Package: libvibrant6b
+Architecture: any
+Multi-Arch: same
+Section: libs
+Depends: libncbi6 (<< ${source:Upstream-Version}.1),
+ libncbi6 (>= ${source:Upstream-Version}),
+ ${misc:Depends},
+ ${shlibs:Depends}
+Pre-Depends: ${misc:Pre-Depends}
+Recommends: sensible-utils,
+Conflicts: libvibrant6,
+ libvibrant6a
+Replaces: libvibrant6,
+ libvibrant6a
+Description: NCBI libraries for graphic biology applications
+ This is the library for those who just want to run Vibrant applications.
+ It also includes a wrapper (vibrate) that allows many NCBI applications to
+ provide a GUI for selecting options.
+
+Package: libvibrant6-dev
+Architecture: any
+Multi-Arch: same
+Depends: libglu1-mesa-dev | libglu-dev,
+ libmotif-dev,
+ libncbi6-dev (= ${binary:Version}),
+ libvibrant6b (= ${binary:Version}),
+ libxmu-dev,
+ ${misc:Depends}
+Description: NCBI libraries for graphic biology applications (development files)
+ Vibrant allows you to develop portable (Motif, MS-Windows, Mac-OS) graphic
+ biological applications.
diff --git a/debian/copyright b/debian/copyright
new file mode 100644
index 00000000..4e3a3c8f
--- /dev/null
+++ b/debian/copyright
@@ -0,0 +1,64 @@
+Format: https://www.debian.org/doc/packaging-manuals/copyright-format/1.0/
+Upstream-Contact: toolbox@ncbi.nlm.nih.gov
+Upstream-Name: ncbi
+Source: http://ftp.ncbi.nih.gov/toolbox/ncbi_tools/old/
+
+Files: *
+Copyright: 1996-2017 NCBI
+License: public_domain
+
+Files: debian/*
+Copyright: 1998-1999 Stephane Bortzmeyer <bortzmeyer@pasteur.fr>
+ 2001 Dr. Guenter Bechly <gbechly@debian.org>
+ 2001-2018 Aaron M. Ucko <ucko@debian.org>
+License: public_domain
+
+Files: debian/tests/test-data/* (except for trnascan-se_sample.output)
+Copyright: 1996-2018 NCBI
+License: public_domain
+Comment:
+ nc0225.aso.gz and dsRNA_viruses.* can be dowloaded by running:
+ wget ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc/nc0225.aso.gz
+ wget ftp://ftp.ncbi.nlm.nih.gov/gene/DATA/ASN_BINARY/Viruses/dsRNA_viruses.ags.gz
+ wget ftp://ftp.ncbi.nlm.nih.gov/gene/DATA/GENE_INFO/Viruses/dsRNA_viruses.gene_info.gz
+ .
+ spidey_* can be downloaded using their accession numbers with help of idfetch, e.g.:
+ idfetch -dn -t 5 -c 1 -g 1327850419 -o spidey_mRNA.fasta
+ idfetch -dn -t 5 -c 1 -g 568802167 -o spidey_genome.fasta
+ .
+ Based on the example provided in /usr/share/doc/ncbi-tools-bin/tbl2asn.txt.gz,
+ Sc_16.sbt was generated using NCBI Submission Portal:
+ https://submit.ncbi.nlm.nih.gov/genbank/template/submission/
+ .
+ The examples for Sc_16.fsa and Sc_16.tbl were taken from here:
+ https://www.ncbi.nlm.nih.gov/genbank/tbl2asn2/
+
+Files: debian/tests/test-data/trnascan-se_sample.output
+Copyright: 2018 Liubov Chuprikova <chuprikovalv@gmail.com>
+License: public_domain
+Comment:
+ The file was generated by tRNAscan-SE 2.0:
+ tRNAscan-SE -d -y -o trnascan-se_sample.output /usr/share/doc/trnascan-se/examples/Example1.fa
+
+License: public_domain
+ The NCBI toolkit has been put into the public domain, completely unfettered:
+ .
+ PUBLIC DOMAIN NOTICE
+ National Center for Biotechnology Information
+ .
+ This software/database is a "United States Government Work" under the
+ terms of the United States Copyright Act. It was written as part of
+ the author's official duties as a United States Government employee and
+ thus cannot be copyrighted. This software/database is freely available
+ to the public for use. The National Library of Medicine and the U.S.
+ Government have not placed any restriction on its use or reproduction.
+ .
+ Although all reasonable efforts have been taken to ensure the accuracy
+ and reliability of the software and data, the NLM and the U.S.
+ Government do not and cannot warrant the performance or results that
+ may be obtained by using this software or data. The NLM and the U.S.
+ Government disclaim all warranties, express or implied, including
+ warranties of performance, merchantability or fitness for any particular
+ purpose.
+ .
+ Please cite the author in any work or product based on this material.
diff --git a/debian/ddv.desktop.in b/debian/ddv.desktop.in
new file mode 100644
index 00000000..dd991172
--- /dev/null
+++ b/debian/ddv.desktop.in
@@ -0,0 +1,3 @@
+Name=DDV Sequence Alignment Viewer
+GenericName=Sequence Alignment Viewer
+Comment=View multiple sequence alignment for GenBank
diff --git a/debian/entrez2.desktop.in b/debian/entrez2.desktop.in
new file mode 100644
index 00000000..dee021ce
--- /dev/null
+++ b/debian/entrez2.desktop.in
@@ -0,0 +1,3 @@
+Name=Entrez NCBI Database Querying Tool
+GenericName=Database Querying Tool
+Comment=Query NCBI databases and retrieve documents
diff --git a/debian/header-deps b/debian/header-deps
new file mode 100644
index 00000000..7c082c51
--- /dev/null
+++ b/debian/header-deps
@@ -0,0 +1,5 @@
+#!/bin/sh
+for f in include/*; do
+ cpp -H -Iinclude -DWIN_MOTIF "$f" 2>&1 >/dev/null \
+ | sed -e "/usr/d; s@^ *@$f: @" | sort -u
+done
diff --git a/debian/help2man b/debian/help2man
new file mode 100644
index 00000000..0c9c7e9d
--- /dev/null
+++ b/debian/help2man
@@ -0,0 +1,127 @@
+#!/usr/bin/perl -w
+use strict;
+
+use POSIX qw(strftime);
+
+my $AUTHOR = 'Aaron M. Ucko <ucko@debian.org>';
+
+# Generates initial Debian manpages based on help output ("-" flag).
+# bod's help2man won't work here, since it assumes GNU conventions.
+
+# Sigh...vibrant and non-vibrant versions only agree on T/F, Integer,
+# and String.
+my %type_map = ( 'Data In' => 'filename',
+ 'Data Out' => 'filename',
+ 'File In' => 'filename',
+ 'File Out' => 'filename',
+ 'Float' => 'X',
+ 'Input-Data' => 'filename',
+ 'Input-File' => 'filename',
+ 'Integer' => 'N',
+ 'Output-Data' => 'filename',
+ 'Output-File' => 'filename',
+ 'Real' => 'X',
+ 'String' => 'str',
+ 'T/F' => undef );
+
+foreach my $prog (@ARGV) {
+ my $base = $prog;
+ $base =~ s@.*/@@;
+ open(MAN, ">doc/man/$base.1") or die;
+ print MAN '.TH ', uc($base), ' 1 ', strftime('%Y-%m-%d', localtime),
+ " NCBI \"NCBI Tools User's Manual\"\n";
+ print MAN ".SH NAME\n$base \\- ...\n";
+
+ my %options = parse_options($prog);
+ my $key;
+
+ print MAN ".SH SYNOPSIS\n.B $base\n", synopsis(\%options);
+ print MAN <<EOF;
+.SH DESCRIPTION
+\\fB$base\\fP is ...
+.SH OPTIONS
+EOF
+ if (keys %options) {
+ print MAN "A summary of options is included below.\n";
+ foreach my $key (sort keys %options) {
+ my $desc = $options{$key};
+ $desc =~ s/\s+\[T\/F\]//;
+ $desc =~ s/\s+Optional//;
+ $desc =~ s/\n(.)/\n.br\n$1/g;
+ print MAN ".TP\n", format_arg($key, $desc), "\n", $desc;
+ }
+ } else {
+ print MAN "None.\n";
+ }
+ print MAN <<EOF;
+.SH AUTHOR
+The National Center for Biotechnology Information.
+EOF
+}
+
+sub parse_options
+{
+ my $prog = $_[0];
+ my %options;
+ my $last_option;
+ my $last_description;
+
+ open(HELP, "$prog - </dev/null |") or die;
+
+ while (<HELP>) {
+ if (/^ (-\S+)\s*(.*)/) {
+ $options{$last_option} = $last_description if defined $last_option;
+ $last_option = $1;
+ $last_description = "$2\n";
+ } elsif (defined $last_option) {
+ $last_description .= $_;
+ }
+ }
+
+ if (defined $last_option) {
+ $options{$last_option} = $last_description;
+ $options{'-'} = "Print usage message\n";
+ }
+
+ close(HELP);
+
+ foreach my $key (keys %options) {
+ if ($options{$key} =~ s@(\[T/F\](\s+Optional)?)\s+default = T@$1@) {
+ $options{"$key\\ F"} = "NOT $options{$key}";
+ delete $options{$key};
+ } else {
+ $options{$key} =~ s@(\[T/F\](\s+Optional)?)(\s+default = F)?@$1@;
+ }
+ }
+
+ return %options;
+}
+
+sub synopsis
+{
+ my %options = %{$_[0]};
+ my $result = '';
+
+ foreach my $key (sort keys %options) {
+ my $desc = $options{$key};
+ my $optional = ($desc =~ /Optional/ || $desc =~ /default = /
+ || $key eq '-' || $desc =~ /\[T\/F\]/);
+ $result .= '[\|' if $optional;
+ $result .= format_arg($key, $desc);
+ $result .= '\|]' if $optional;
+ $result .= "\n";
+ }
+
+ return $result;
+}
+
+sub format_arg
+{
+ my ($arg, $desc) = @_;
+ my $result = "\\fB\\$arg\\fP";
+ if ($desc =~ /\[(.*?)\]/) {
+ my $contents = $type_map{$1};
+ $result .= '\ \fI' . $contents . '\fP' if defined $contents;
+ }
+ return $result;
+}
diff --git a/debian/installman b/debian/installman
new file mode 100644
index 00000000..9384e4fb
--- /dev/null
+++ b/debian/installman
@@ -0,0 +1,56 @@
+#!/usr/bin/perl -w
+use strict;
+use IO::File;
+
+my $pkg = shift;
+my $outdir = "debian/$pkg/usr/share/man/man1";
+my $USD = "/usr/share/doc";
+system("mkdir", "-p", $outdir) && die "Couldn't create $outdir";
+
+foreach my $x (@ARGV ? @ARGV : <debian/$pkg/usr/bin/*>) {
+ my $full_x = $x;
+ $x =~ s:.*/::;
+ my $xin = $x;
+# gone as of 6.1.20040616
+# if ($x eq 'fastamerge') {
+# $xin = 'fmerge'; # renamed in Debian per #155791
+# }
+ if (-l $full_x) {
+ symlink readlink($full_x) . ".1", "$outdir/$x.1";
+ next;
+ }
+ foreach my $dir ('doc/man', 'debian/man') {
+ if (-f "$dir/$xin.1") {
+ my $in = new IO::File("<$dir/$xin.1")
+ or die "Couldn't open $dir/$xin.1: $!";
+ my $out = new IO::File(">$outdir/$x.1")
+ or die "Couldn't open $outdir/$x.1: $!";
+ while (<$in>) {
+ # s/fmerge/fastamerge/g;
+ # s/FMERGE/FASTAMERGE/g;
+ s:(\w+)/README:README.$1:g;
+ while (/^(.*)(?<!\S)(README\.\w+|\w+\.txt|\w+\.html?)(.*)$/) {
+ my ($pre, $main, $post) = ($1, $2, $3);
+ my @matches = <debian/*$USD/*/$main>;
+ if (!@matches) {
+ warn "[$x] $USD/*/$main not found in any package";
+ } elsif (@matches > 1) {
+ warn "[$x] $USD/*/$main found in multiple packages";
+ } else {
+ my $m = $matches[0];
+ $m .= '.gz' if ((-s $m) > 4096 && $m !~ /\.html?$/);
+ $m =~ s:^debian/[^/]*::;
+ print $out $pre . $m;
+ }
+ # Consider just the remaining text next time,
+ # and make sure it ends with exactly one newline.
+ chomp $post;
+ $_ = "$post\n";
+ }
+ print $out $_;
+ }
+ last;
+ }
+ }
+ -f "$outdir/$x.1" || warn "Unable to find a man page for $x";
+}
diff --git a/debian/left.gif b/debian/left.gif
new file mode 100644
index 00000000..59620f51
--- /dev/null
+++ b/debian/left.gif
Binary files differ
diff --git a/debian/libncbi6-dev.NEWS.debian b/debian/libncbi6-dev.NEWS.debian
new file mode 100644
index 00000000..d0736223
--- /dev/null
+++ b/debian/libncbi6-dev.NEWS.debian
@@ -0,0 +1,7 @@
+ncbi-tools6 (6.1.20110713-3) unstable; urgency=low
+
+ * The asntool and errhdr executables have moved to ncbi-tools-bin to
+ allow side-by-side installations of builds of libncbi6-dev (which
+ historically shipped them) for different architectures.
+
+ -- Aaron M. Ucko <ucko@debian.org> Sat, 29 Oct 2011 22:21:10 -0400
diff --git a/debian/libncbi6-dev.README.debian b/debian/libncbi6-dev.README.debian
new file mode 100644
index 00000000..59e2d566
--- /dev/null
+++ b/debian/libncbi6-dev.README.debian
@@ -0,0 +1,5 @@
+The (outdated) SDK manual also exists in HTML form at
+ftp://ncbi.nlm.nih.gov/toolbox/ncbi_tools/sdkdoc/index.html
+
+Aaron M. Ucko <ucko@debian.org>, Mon Sep 10 10:40:35 EDT 2001
+
diff --git a/debian/libncbi6-dev.docs b/debian/libncbi6-dev.docs
new file mode 100644
index 00000000..dfc39a8b
--- /dev/null
+++ b/debian/libncbi6-dev.docs
@@ -0,0 +1,4 @@
+doc/README.sdk
+doc/access.txt
+doc/asn2*.txt
+doc/sdk.doc
diff --git a/debian/libncbi6-dev.install b/debian/libncbi6-dev.install
new file mode 100644
index 00000000..c9532b3e
--- /dev/null
+++ b/debian/libncbi6-dev.install
@@ -0,0 +1,203 @@
+usr/include/ncbi/PubStructAsn.h
+usr/include/ncbi/a2f*.h
+usr/include/ncbi/acc*.h
+usr/include/ncbi/acer*.h
+usr/include/ncbi/actutils.h
+usr/include/ncbi/algo
+usr/include/ncbi/ali*.h
+usr/include/ncbi/all.h
+usr/include/ncbi/allpub.h
+usr/include/ncbi/asn*.h
+usr/include/ncbi/bandalgn.h
+usr/include/ncbi/binary.h
+usr/include/ncbi/bl*.h
+usr/include/ncbi/bxmlobj.h
+usr/include/ncbi/casn.h
+usr/include/ncbi/cdconfig.h
+usr/include/ncbi/cdd*.h
+usr/include/ncbi/cdentrez.h
+usr/include/ncbi/cdnewlib.h
+usr/include/ncbi/cdrom*.h
+usr/include/ncbi/codon.h
+usr/include/ncbi/connect
+usr/include/ncbi/corematx.h
+usr/include/ncbi/ctools
+usr/include/ncbi/db_list.h
+usr/include/ncbi/ddvcolor.h
+usr/include/ncbi/dotseq.h
+usr/include/ncbi/dust.h
+usr/include/ncbi/dvncode.h
+usr/include/ncbi/edutil.h
+usr/include/ncbi/egkludge.h
+usr/include/ncbi/ent2api.h
+usr/include/ncbi/errdefn.h
+usr/include/ncbi/explore.h
+usr/include/ncbi/fastadl.h
+usr/include/ncbi/fdl*.h
+usr/include/ncbi/ffprint.h
+usr/include/ncbi/findrepl.h
+usr/include/ncbi/ftusrstr.h
+usr/include/ncbi/gapxdrop.h
+usr/include/ncbi/gather.h
+usr/include/ncbi/gb*.h
+usr/include/ncbi/gifgen.h
+usr/include/ncbi/id1*.h
+usr/include/ncbi/id2*.h
+usr/include/ncbi/jsavlt.h
+usr/include/ncbi/jz*.h
+usr/include/ncbi/list.h
+usr/include/ncbi/lnfac.h
+usr/include/ncbi/lookup.h
+usr/include/ncbi/lsqfetch.h
+usr/include/ncbi/macroapi.h
+usr/include/ncbi/mapcn3d.h
+usr/include/ncbi/mapmime.h
+usr/include/ncbi/mapmla.h
+usr/include/ncbi/mapproj.h
+usr/include/ncbi/mappubme.h
+usr/include/ncbi/maputil.h
+usr/include/ncbi/matrix.h
+usr/include/ncbi/mb*.h
+usr/include/ncbi/mconsist.h
+usr/include/ncbi/mdrcherr.h
+usr/include/ncbi/medarch.h
+usr/include/ncbi/medutil.h
+usr/include/ncbi/mimapi.h
+usr/include/ncbi/mkbioseq.h
+usr/include/ncbi/mla2api.h
+usr/include/ncbi/mlkludge.h
+usr/include/ncbi/mmdb*.h
+usr/include/ncbi/ncbi.h
+usr/include/ncbi/ncbi_skew_guard.h
+usr/include/ncbi/ncbibs.h
+usr/include/ncbi/ncbienv.h
+usr/include/ncbi/ncbierr.h
+usr/include/ncbi/ncbifile.h
+usr/include/ncbi/ncbilang.h
+usr/include/ncbi/ncbilcl.h
+usr/include/ncbi/ncbimain.h
+usr/include/ncbi/ncbimath.h
+usr/include/ncbi/ncbimem.h
+usr/include/ncbi/ncbimisc.h
+usr/include/ncbi/ncbimsg.h
+usr/include/ncbi/ncbinet.h
+usr/include/ncbi/ncbiopt.h
+usr/include/ncbi/ncbiprop.h
+usr/include/ncbi/ncbisam.h
+usr/include/ncbi/ncbisami.h
+usr/include/ncbi/ncbisgml.h
+usr/include/ncbi/ncbisort.h
+usr/include/ncbi/ncbisrti.h
+usr/include/ncbi/ncbistd.h
+usr/include/ncbi/ncbistr.h
+usr/include/ncbi/ncbithr.h
+usr/include/ncbi/ncbitime.h
+usr/include/ncbi/ncbiwin.h
+usr/include/ncbi/ncbiwww.h
+usr/include/ncbi/needleman.h
+usr/include/ncbi/netblap3.h
+usr/include/ncbi/netcnfg.h
+usr/include/ncbi/netentr.h
+usr/include/ncbi/netlib.h
+usr/include/ncbi/netpriv.h
+usr/include/ncbi/ni_*.h
+usr/include/ncbi/obj*.h
+usr/include/ncbi/parsegb.h
+usr/include/ncbi/pdiagnos.h
+usr/include/ncbi/pgppop.h
+usr/include/ncbi/pmfapi.h
+usr/include/ncbi/pobutil.h
+usr/include/ncbi/posit.h
+usr/include/ncbi/profiles.h
+usr/include/ncbi/prtutil.h
+usr/include/ncbi/prunebsc.h
+usr/include/ncbi/puberr.h
+usr/include/ncbi/qblastapi.h
+usr/include/ncbi/readdb.h
+usr/include/ncbi/regex.h
+usr/include/ncbi/rpsutil.h
+usr/include/ncbi/salign.h
+usr/include/ncbi/salmedia.h
+usr/include/ncbi/salpacc.h
+usr/include/ncbi/salpedit.h
+usr/include/ncbi/salprop.h
+usr/include/ncbi/salpstat.h
+usr/include/ncbi/salptool.h
+usr/include/ncbi/salsa.h
+usr/include/ncbi/salsap.h
+usr/include/ncbi/salstruc.h
+usr/include/ncbi/salutil.h
+usr/include/ncbi/samutil.h
+usr/include/ncbi/satutil.h
+usr/include/ncbi/scoremat.h
+usr/include/ncbi/sec.h
+usr/include/ncbi/seed.h
+usr/include/ncbi/seg.h
+usr/include/ncbi/seqmgr.h
+usr/include/ncbi/seqport.h
+usr/include/ncbi/seqsplit.h
+usr/include/ncbi/sequtil.h
+usr/include/ncbi/simple.h
+usr/include/ncbi/simutil.h
+usr/include/ncbi/spell*.h
+usr/include/ncbi/spidey.h
+usr/include/ncbi/splutil.h
+usr/include/ncbi/sqnutils.h
+usr/include/ncbi/strimprt.h
+usr/include/ncbi/strucapi.h
+usr/include/ncbi/stsutil.h
+usr/include/ncbi/subutil.h
+usr/include/ncbi/sug*.h
+usr/include/ncbi/tax*.h
+usr/include/ncbi/terr.h
+usr/include/ncbi/tfuns.h
+usr/include/ncbi/thrd*.h
+usr/include/ncbi/to*.h
+usr/include/ncbi/tree.h
+usr/include/ncbi/treemgr.h
+usr/include/ncbi/tsprintf.h
+usr/include/ncbi/tx*.h
+usr/include/ncbi/undefwin.h
+usr/include/ncbi/urkbias.h
+usr/include/ncbi/urkcnsrt.h
+usr/include/ncbi/urkdust.h
+usr/include/ncbi/urkepi.h
+usr/include/ncbi/urkfltr.h
+usr/include/ncbi/urkpcc.h
+usr/include/ncbi/urkptpf.h
+usr/include/ncbi/urksigu.h
+usr/include/ncbi/urktree.h
+usr/include/ncbi/urkutil.h
+usr/include/ncbi/urlquery.h
+usr/include/ncbi/util*
+usr/include/ncbi/valapi.h
+usr/include/ncbi/valid*.h
+usr/include/ncbi/vast*.h
+usr/include/ncbi/vecsc*.h
+usr/include/ncbi/viewmgr.h
+usr/include/ncbi/xmlblast.h
+usr/lib/*/libblast*.a
+usr/lib/*/libblast*.so
+usr/lib/*/libconnssl.a
+usr/lib/*/libconnssl.so
+usr/lib/*/libncbi*acc.a
+usr/lib/*/libncbi*acc.so
+usr/lib/*/libncbi.a
+usr/lib/*/libncbi.so
+usr/lib/*/libncbicdr.a
+usr/lib/*/libncbicdr.so
+usr/lib/*/libncbiid1.a
+usr/lib/*/libncbiid1.so
+usr/lib/*/libncbimla.a
+usr/lib/*/libncbimla.so
+usr/lib/*/libncbimmdb.a
+usr/lib/*/libncbimmdb.so
+usr/lib/*/libncbiobj.a
+usr/lib/*/libncbiobj.so
+usr/lib/*/libncbitool.a
+usr/lib/*/libncbitool.so
+usr/lib/*/libncbitxc2.a
+usr/lib/*/libncbitxc2.so
+usr/lib/*/libnet*.a
+usr/lib/*/libnet*.so
+usr/lib/*/ncbithr.o
diff --git a/debian/libncbi6.doc-base b/debian/libncbi6.doc-base
new file mode 100644
index 00000000..7d97b6f3
--- /dev/null
+++ b/debian/libncbi6.doc-base
@@ -0,0 +1,13 @@
+Document: ncbi-tools-dispatcher
+Title: NCBI Dispatcher Parameters
+Author: The National Center for Biotechnology Information
+Abstract: Problems connecting to NCBI databases may be due to the
+ presence of a firewall at your site, especially if you receive error
+ messages about the inability to connect to a dispatcher. This
+ document details how to configure clients to use firewalls, and how
+ to configure firewalls to let clients through.
+Section: System/Administration
+
+Format: HTML
+Index: /usr/share/doc/libncbi6/dispatcher.html
+Files: /usr/share/doc/libncbi6/dispatcher.html
diff --git a/debian/libncbi6.docs b/debian/libncbi6.docs
new file mode 100644
index 00000000..e9013983
--- /dev/null
+++ b/debian/libncbi6.docs
@@ -0,0 +1,7 @@
+README
+README.htm
+debian/*.css
+debian/*.gif
+doc/FAQ.txt
+doc/dispatcher.html
+doc/ncbixml.txt
diff --git a/debian/libncbi6.examples b/debian/libncbi6.examples
new file mode 100644
index 00000000..cf954aff
--- /dev/null
+++ b/debian/libncbi6.examples
@@ -0,0 +1 @@
+doc/fwd_check.sh
diff --git a/debian/libncbi6.install b/debian/libncbi6.install
new file mode 100644
index 00000000..f849f1f7
--- /dev/null
+++ b/debian/libncbi6.install
@@ -0,0 +1,13 @@
+usr/lib/*/libblast*.so.*
+usr/lib/*/libconnssl.so.*
+usr/lib/*/libncbi*acc.so.*
+usr/lib/*/libncbi.so.*
+usr/lib/*/libncbicdr.so.*
+usr/lib/*/libncbiid1.so.*
+usr/lib/*/libncbimla.so.*
+usr/lib/*/libncbimmdb.so.*
+usr/lib/*/libncbiobj.so.*
+usr/lib/*/libncbitool.so.*
+usr/lib/*/libncbitxc2.so.*
+usr/lib/*/libnet*.so.*
+usr/lib/*/libvibgif.so.*
diff --git a/debian/libncbi6.symbols b/debian/libncbi6.symbols
new file mode 100644
index 00000000..8faf3643
--- /dev/null
+++ b/debian/libncbi6.symbols
@@ -0,0 +1,11649 @@
+libblast.so.6 libncbi6 #MINVER#
+ ALIGN_EX@Base 6.1.20040616
+ AMINOACID_TO_NCBISTDAA@Base 6.1.20040505
+ AdjustSubjectRange@Base 6.1.20040505
+ BLASTNA_TO_IUPACNA@Base 6.1.20080302
+ BLASTNA_TO_NCBI4NA@Base 6.1.20040505
+ BLAST_AffineGreedyAlign@Base 6.1.20040204
+ BLAST_CalcEffLengths@Base 6.1.20040204
+ BLAST_CheckRewardPenaltyScores@Base 6.1.20081116
+ BLAST_ComplementMaskLocations@Base 6.1.20040204
+ BLAST_ComputeLengthAdjustment@Base 6.1.20040505
+ BLAST_ComputeTraceback@Base 6.1.20040204
+ BLAST_ComputeTraceback_MT@Base 6.1.20160908
+ BLAST_ContextToFrame@Base 6.1.20040204
+ BLAST_CreateMixedFrameDNATranslation@Base 6.1.20060507
+ BLAST_Cutoffs@Base 6.1.20040204
+ BLAST_Erf@Base 6.1.20120620
+ BLAST_ErfC@Base 6.1.20120620
+ BLAST_Expm1@Base 6.1.20040204
+ BLAST_Factorial@Base 6.1.20040204
+ BLAST_FillEffectiveLengthsOptions@Base 6.1.20040204
+ BLAST_FillExtensionOptions@Base 6.1.20040204
+ BLAST_FillHitSavingOptions@Base 6.1.20040204
+ BLAST_FillInitialWordOptions@Base 6.1.20040204
+ BLAST_FillLookupTableOptions@Base 6.1.20040204
+ BLAST_FillQuerySetUpOptions@Base 6.1.20040204
+ BLAST_FillScoringOptions@Base 6.1.20040204
+ BLAST_FindBestNucleotideWordSize@Base 6.1.20060507
+ BLAST_FrameToContext@Base 6.1.20061015
+ BLAST_GapAlignSetUp@Base 6.1.20040505
+ BLAST_GapAlignStructFree@Base 6.1.20040204
+ BLAST_GapAlignStructNew@Base 6.1.20040204
+ BLAST_GapDecayDivisor@Base 6.1.20040505
+ BLAST_GappedAlignmentWithTraceback@Base 6.1.20040204
+ BLAST_Gcd@Base 6.1.20040204
+ BLAST_Gdb3@Base 6.1.20050429
+ BLAST_GetAllTranslations@Base 6.1.20040204
+ BLAST_GetAlphaBeta@Base 6.1.20040204
+ BLAST_GetGappedScore@Base 6.1.20040204
+ BLAST_GetNucleotideGapExistenceExtendParams@Base 6.1.20051206
+ BLAST_GetNumberOfContexts@Base 6.1.20051206
+ BLAST_GetProteinGapExistenceExtendParams@Base 6.1.20051206
+ BLAST_GetStandardAaProbabilities@Base 6.1.20050429
+ BLAST_GetSubjectTotals@Base 6.1.20061015
+ BLAST_GetSuggestedThreshold@Base 6.1.20051206
+ BLAST_GetSuggestedWindowSize@Base 6.1.20051206
+ BLAST_GetTranslatedProteinLength@Base 6.1.20061015
+ BLAST_GetTranslation@Base 6.1.20040204
+ BLAST_GetUngappedHSPList@Base 6.1.20040204
+ BLAST_GreedyAlign@Base 6.1.20040204
+ BLAST_GreedyGappedAlignment@Base 6.1.20040204
+ BLAST_InitDefaultOptions@Base 6.1.20040204
+ BLAST_InitHitListFree@Base 6.1.20040505
+ BLAST_InitHitListNew@Base 6.1.20040204
+ BLAST_KarlinEtoP@Base 6.1.20061015
+ BLAST_KarlinPtoE@Base 6.1.20061015
+ BLAST_KarlinStoE_simple@Base 6.1.20040204
+ BLAST_LargeGapSumE@Base 6.1.20040204
+ BLAST_LinkHsps@Base 6.1.20040204
+ BLAST_LnFactorial@Base 6.1.20040204
+ BLAST_LnGammaInt@Base 6.1.20040204
+ BLAST_Log1p@Base 6.1.20040204
+ BLAST_MainSetUp@Base 6.1.20040204
+ BLAST_Nint@Base 6.1.20040204
+ BLAST_OneSubjectUpdateParameters@Base 6.1.20040505
+ BLAST_PackDNA@Base 6.1.20040204
+ BLAST_Powi@Base 6.1.20040204
+ BLAST_PreliminarySearchEngine@Base 6.1.20041020
+ BLAST_PrintAllowedValues@Base 6.1.20040204
+ BLAST_PrintMatrixMessage@Base 6.1.20040204
+ BLAST_RombergIntegrate@Base 6.1.20040204
+ BLAST_SaveInitialHit@Base 6.1.20040204
+ BLAST_ScoreSetAmbigRes@Base 6.1.20040204
+ BLAST_SetupPartialFetching@Base 6.1.20120620
+ BLAST_SmallGapSumE@Base 6.1.20040204
+ BLAST_SmithWatermanGetGappedScore@Base 6.1.20061015
+ BLAST_SpougeEtoS@Base 6.1.20120620
+ BLAST_SpougeStoE@Base 6.1.20110713
+ BLAST_StrToUpper@Base 6.1.20050605
+ BLAST_TranslateCompressedSequence@Base 6.1.20040204
+ BLAST_UnevenGapSumE@Base 6.1.20040204
+ BLAST_ValidateOptions@Base 6.1.20040505
+ BSearchContextInfo@Base 6.1.20050429
+ BSearchInt4@Base 6.1.20040204
+ BackboneCellFree@Base 6.1.20160908
+ BackboneCellInit@Base 6.1.20170106
+ BackboneCellNew@Base 6.1.20160908
+ BlastAaLookupFinalize@Base 6.1.20070822
+ BlastAaLookupIndexQuery@Base 6.1.20041020
+ BlastAaLookupTableDestruct@Base 6.1.20070822
+ BlastAaLookupTableNew@Base 6.1.20070822
+ BlastAaWordFinder@Base 6.1.20040204
+ BlastChooseNaExtend@Base 6.1.20070822
+ BlastChooseNaLookupTable@Base 6.1.20070822
+ BlastChooseNucleotideScanSubject@Base 6.1.20070822
+ BlastChooseNucleotideScanSubjectAny@Base 6.1.20090719
+ BlastChooseProteinScanSubject@Base 6.1.20070822
+ BlastCompressBlastnaSequence@Base 6.1.20070822
+ BlastCompressedAaLookupTableDestruct@Base 6.1.20070822
+ BlastCompressedAaLookupTableNew@Base 6.1.20070822
+ BlastDatabaseOptionsFree@Base 6.1.20040204
+ BlastDatabaseOptionsNew@Base 6.1.20040204
+ BlastEffectiveLengthsOptionsFree@Base 6.1.20040204
+ BlastEffectiveLengthsOptionsNew@Base 6.1.20040204
+ BlastEffectiveLengthsOptions_IsSearchSpaceSet@Base 6.1.20061015
+ BlastEffectiveLengthsParametersFree@Base 6.1.20040505
+ BlastEffectiveLengthsParametersNew@Base 6.1.20040505
+ BlastExtendWordFree@Base 6.1.20040204
+ BlastExtendWordNew@Base 6.1.20040505
+ BlastExtensionOptionsFree@Base 6.1.20040204
+ BlastExtensionOptionsNew@Base 6.1.20040204
+ BlastExtensionOptionsValidate@Base 6.1.20040204
+ BlastExtensionParametersFree@Base 6.1.20040204
+ BlastExtensionParametersNew@Base 6.1.20040204
+ BlastFilteringOptionsFromString@Base 6.1.20050429
+ BlastFilteringOptionsToString@Base 6.1.20081116
+ BlastGetOffsetsForGappedAlignment@Base 6.1.20110713
+ BlastGetStartForGappedAlignment@Base 6.1.20040505
+ BlastGetStartForGappedAlignmentNucl@Base 6.1.20160908
+ BlastHSPBestHitOptionsFree@Base 6.1.20090719
+ BlastHSPBestHitOptionsNew@Base 6.1.20090719
+ BlastHSPBestHitOptionsValidate@Base 6.1.20090719
+ BlastHSPCollectorInfoNew@Base 6.1.20090719
+ BlastHSPCollectorParamsFree@Base 6.1.20090719
+ BlastHSPCollectorParamsNew@Base 6.1.20090719
+ BlastHSPCullingOptionsFree@Base 6.1.20090719
+ BlastHSPCullingOptionsNew@Base 6.1.20090719
+ BlastHSPCullingOptionsValidate@Base 6.1.20090719
+ BlastHSPFilteringOptionsFree@Base 6.1.20090719
+ BlastHSPFilteringOptionsNew@Base 6.1.20090719
+ BlastHSPFilteringOptionsValidate@Base 6.1.20090719
+ BlastHSPFilteringOptions_AddBestHit@Base 6.1.20090719
+ BlastHSPFilteringOptions_AddCulling@Base 6.1.20090719
+ BlastHSPListDup@Base 6.1.20070822
+ BlastHSPMappingInfoFree@Base 6.1.20160908
+ BlastHSPMappingInfoNew@Base 6.1.20160908
+ BlastHSPPipeInfo_Add@Base 6.1.20090719
+ BlastHSPPipeNew@Base 6.1.20090719
+ BlastHSPStreamBatchRead@Base 6.1.20070822
+ BlastHSPStreamClose@Base 6.1.20040616
+ BlastHSPStreamFree@Base 6.1.20040616
+ BlastHSPStreamMappingClose@Base 6.1.20160908
+ BlastHSPStreamMerge@Base 6.1.20070822
+ BlastHSPStreamNew@Base 6.1.20040616
+ BlastHSPStreamRead@Base 6.1.20040616
+ BlastHSPStreamRegisterMTLock@Base 6.1.20090719
+ BlastHSPStreamRegisterPipe@Base 6.1.20090719
+ BlastHSPStreamResultsBatchArrayFree@Base 6.1.20160908
+ BlastHSPStreamResultsBatchNew@Base 6.1.20160908
+ BlastHSPStreamSimpleClose@Base 6.1.20160908
+ BlastHSPStreamTBackClose@Base 6.1.20090719
+ BlastHSPStreamToHSPStreamResultsBatch@Base 6.1.20160908
+ BlastHSPStreamWrite@Base 6.1.20040616
+ BlastHSPWriterNew@Base 6.1.20090719
+ BlastHashLookupIndexQueryExactMatches@Base 6.1.20160908
+ BlastHitSavingOptionsFree@Base 6.1.20040204
+ BlastHitSavingOptionsNew@Base 6.1.20040204
+ BlastHitSavingOptionsValidate@Base 6.1.20040204
+ BlastHitSavingParametersFree@Base 6.1.20040204
+ BlastHitSavingParametersNew@Base 6.1.20040204
+ BlastHitSavingParametersUpdate@Base 6.1.20040505
+ BlastHspNumMax@Base 6.1.20060507
+ BlastInitHitListMove@Base 6.1.20061015
+ BlastInitHitListReset@Base 6.1.20040505
+ BlastInitialWordOptionsFree@Base 6.1.20040204
+ BlastInitialWordOptionsNew@Base 6.1.20040204
+ BlastInitialWordOptionsValidate@Base 6.1.20041020
+ BlastInitialWordParametersFree@Base 6.1.20040204
+ BlastInitialWordParametersNew@Base 6.1.20040204
+ BlastInitialWordParametersUpdate@Base 6.1.20040505
+ BlastIntervalTreeAddHSP@Base 6.1.20050429
+ BlastIntervalTreeContainsHSP@Base 6.1.20050429
+ BlastIntervalTreeMasksHSP@Base 6.1.20110713
+ BlastIntervalTreeNumRedundant@Base 6.1.20050429
+ BlastLinkHSPParametersFree@Base 6.1.20041020
+ BlastLinkHSPParametersNew@Base 6.1.20041020
+ BlastLinkHSPParametersUpdate@Base 6.1.20041020
+ BlastLookupAddWordHit@Base 6.1.20070822
+ BlastLookupIndexQueryExactMatches@Base 6.1.20070822
+ BlastMBLookupTableDestruct@Base 6.1.20070822
+ BlastMBLookupTableNew@Base 6.1.20070822
+ BlastMaskLocDNAToProtein@Base 6.1.20050429
+ BlastMaskLocDup@Base 6.1.20061015
+ BlastMaskLocFree@Base 6.1.20040204
+ BlastMaskLocNew@Base 6.1.20040505
+ BlastMaskLocProteinToDNA@Base 6.1.20050429
+ BlastMemDup@Base 6.1.20040204
+ BlastNaExtendJumper@Base 6.1.20160908
+ BlastNaHashLookupTableDestruct@Base 6.1.20160908
+ BlastNaHashLookupTableNew@Base 6.1.20160908
+ BlastNaLookupTableDestruct@Base 6.1.20070822
+ BlastNaLookupTableNew@Base 6.1.20070822
+ BlastNaWordFinder@Base 6.1.20040204
+ BlastNumber2Program@Base 6.1.20040204
+ BlastProgram2Number@Base 6.1.20040204
+ BlastQueryInfoDup@Base 6.1.20040616
+ BlastQueryInfoFree@Base 6.1.20040204
+ BlastQueryInfoGetEffSearchSpace@Base 6.1.20060507
+ BlastQueryInfoGetQueryLength@Base 6.1.20051206
+ BlastQueryInfoNew@Base 6.1.20060301
+ BlastQueryInfoSetEffSearchSpace@Base 6.1.20060507
+ BlastQuerySetUpOptionsFree@Base 6.1.20040204
+ BlastQuerySetUpOptionsNew@Base 6.1.20040204
+ BlastRPSScanSubject@Base 6.1.20040505
+ BlastRPSWordFinder@Base 6.1.20070822
+ BlastSaveInitHsp@Base 6.1.20040204
+ BlastScoreBlkCheck@Base 6.1.20100808
+ BlastScoreBlkFree@Base 6.1.20040204
+ BlastScoreBlkNew@Base 6.1.20040204
+ BlastScoreBlkNuclMatrixCreate@Base 6.1.20041020
+ BlastScoringOptionsDup@Base 6.1.20040505
+ BlastScoringOptionsFree@Base 6.1.20040204
+ BlastScoringOptionsNew@Base 6.1.20040204
+ BlastScoringOptionsSetMatrix@Base 6.1.20050429
+ BlastScoringOptionsValidate@Base 6.1.20040204
+ BlastScoringParametersFree@Base 6.1.20040616
+ BlastScoringParametersNew@Base 6.1.20040616
+ BlastSeqBlkNew@Base 6.1.20040204
+ BlastSeqBlkSetCompressedSequence@Base 6.1.20040204
+ BlastSeqBlkSetSeqRanges@Base 6.1.20081116
+ BlastSeqBlkSetSequence@Base 6.1.20040204
+ BlastSeqLocAppend@Base 6.1.20051206
+ BlastSeqLocCombine@Base 6.1.20051206
+ BlastSeqLocFree@Base 6.1.20040204
+ BlastSeqLocListDup@Base 6.1.20051206
+ BlastSeqLocListReverse@Base 6.1.20080302
+ BlastSeqLocNew@Base 6.1.20040204
+ BlastSeqLocNodeFree@Base 6.1.20051206
+ BlastSeqLocReverse@Base 6.1.20050828
+ BlastSeqLoc_RestrictToInterval@Base 6.1.20050429
+ BlastSeqSrcCopy@Base 6.1.20040616
+ BlastSeqSrcFree@Base 6.1.20040204
+ BlastSeqSrcGetAvgSeqLen@Base 6.1.20050429
+ BlastSeqSrcGetInitError@Base 6.1.20050429
+ BlastSeqSrcGetIsProt@Base 6.1.20050429
+ BlastSeqSrcGetMaxSeqLen@Base 6.1.20050429
+ BlastSeqSrcGetMinSeqLen@Base 6.1.20120620
+ BlastSeqSrcGetName@Base 6.1.20050429
+ BlastSeqSrcGetNumSeqs@Base 6.1.20050429
+ BlastSeqSrcGetNumSeqsStats@Base 6.1.20070822
+ BlastSeqSrcGetSeqLen@Base 6.1.20050429
+ BlastSeqSrcGetSequence@Base 6.1.20050429
+ BlastSeqSrcGetSupportsPartialFetching@Base 6.1.20110713
+ BlastSeqSrcGetTotLen@Base 6.1.20050429
+ BlastSeqSrcGetTotLenStats@Base 6.1.20070822
+ BlastSeqSrcIteratorFree@Base 6.1.20040204
+ BlastSeqSrcIteratorNew@Base 6.1.20040204
+ BlastSeqSrcIteratorNewEx@Base 6.1.20050429
+ BlastSeqSrcIteratorNext@Base 6.1.20040204
+ BlastSeqSrcNew@Base 6.1.20040204
+ BlastSeqSrcReleaseSequence@Base 6.1.20050429
+ BlastSeqSrcResetChunkIterator@Base 6.1.20070822
+ BlastSeqSrcSetNumberOfThreads@Base 6.1.20090719
+ BlastSeqSrcSetRangesArgAddRange@Base 6.1.20120620
+ BlastSeqSrcSetRangesArgBuild@Base 6.1.20120620
+ BlastSeqSrcSetRangesArgFree@Base 6.1.20110713
+ BlastSeqSrcSetRangesArgNew@Base 6.1.20110713
+ BlastSeqSrcSetSeqRanges@Base 6.1.20110713
+ BlastSequenceBlkClean@Base 6.1.20040204
+ BlastSequenceBlkCopy@Base 6.1.20040505
+ BlastSequenceBlkFree@Base 6.1.20040204
+ BlastSetUp_Filter@Base 6.1.20040204
+ BlastSetUp_GetFilteringLocations@Base 6.1.20040505
+ BlastSetUp_MaskQuery@Base 6.1.20040505
+ BlastSetUp_SeqBlkNew@Base 6.1.20040204
+ BlastSetup_ScoreBlkInit@Base 6.1.20050429
+ BlastSetup_Validate@Base 6.1.20070822
+ BlastSmallNaLookupTableDestruct@Base 6.1.20070822
+ BlastSmallNaLookupTableNew@Base 6.1.20070822
+ BlastTargetTranslationFree@Base 6.1.20090301
+ BlastTargetTranslationNew@Base 6.1.20090301
+ Blast_DiagnosticsCopy@Base 6.1.20110713
+ Blast_DiagnosticsFree@Base 6.1.20040616
+ Blast_DiagnosticsInit@Base 6.1.20040616
+ Blast_DiagnosticsInitMT@Base 6.1.20041020
+ Blast_DiagnosticsUpdate@Base 6.1.20041020
+ Blast_ExtendWordExit@Base 6.1.20061015
+ Blast_FillResidueProbability@Base 6.1.20040616
+ Blast_GetNuclAlphaBeta@Base 6.1.20050828
+ Blast_GetOneQueryStructs@Base 6.1.20050429
+ Blast_GetPartialTranslation@Base 6.1.20050429
+ Blast_GetQueryIndexFromContext@Base 6.1.20040616
+ Blast_GetQueryIndexFromQueryOffset@Base 6.1.20120620
+ Blast_GetStdAlphabet@Base 6.1.20040616
+ Blast_GumbelBlkCalc@Base 6.1.20110713
+ Blast_GumbelBlkLoadFromTables@Base 6.1.20110713
+ Blast_HSPAdjustSubjectOffset@Base 6.1.20050429
+ Blast_HSPCalcLengthAndGaps@Base 6.1.20040616
+ Blast_HSPChainFree@Base 6.1.20160908
+ Blast_HSPChainNew@Base 6.1.20160908
+ Blast_HSPClone@Base 6.1.20160908
+ Blast_HSPFree@Base 6.1.20040505
+ Blast_HSPGetAdjustedOffsets@Base 6.1.20040616
+ Blast_HSPGetNumIdentities@Base 6.1.20040505
+ Blast_HSPGetNumIdentitiesAndPositives@Base 6.1.20120620
+ Blast_HSPGetPartialSubjectTranslation@Base 6.1.20050429
+ Blast_HSPGetQueryCoverage@Base 6.1.20160908
+ Blast_HSPGetTargetTranslation@Base 6.1.20090301
+ Blast_HSPInit@Base 6.1.20040505
+ Blast_HSPListAdjustOddBlastnScores@Base 6.1.20050828
+ Blast_HSPListAdjustOffsets@Base 6.1.20040505
+ Blast_HSPListAppend@Base 6.1.20040505
+ Blast_HSPListFree@Base 6.1.20040505
+ Blast_HSPListGetBitScores@Base 6.1.20040616
+ Blast_HSPListGetEvalues@Base 6.1.20040505
+ Blast_HSPListIsSortedByScore@Base 6.1.20050429
+ Blast_HSPListNew@Base 6.1.20040505
+ Blast_HSPListPHIGetBitScores@Base 6.1.20050429
+ Blast_HSPListPHIGetEvalues@Base 6.1.20040505
+ Blast_HSPListPurgeHSPsWithCommonEndpoints@Base 6.1.20050605
+ Blast_HSPListPurgeNullHSPs@Base 6.1.20040505
+ Blast_HSPListReapByEvalue@Base 6.1.20040505
+ Blast_HSPListReapByQueryCoverage@Base 6.1.20160908
+ Blast_HSPListReapByRawScore@Base 6.1.20110713
+ Blast_HSPListReevaluateUngapped@Base 6.1.20100808
+ Blast_HSPListSaveHSP@Base 6.1.20040505
+ Blast_HSPListSortByEvalue@Base 6.1.20041020
+ Blast_HSPListSortByScore@Base 6.1.20041020
+ Blast_HSPListSwap@Base 6.1.20070822
+ Blast_HSPList_IsEmpty@Base 6.1.20061015
+ Blast_HSPListsMerge@Base 6.1.20040505
+ Blast_HSPNew@Base 6.1.20040505
+ Blast_HSPQueryCoverageTest@Base 6.1.20160908
+ Blast_HSPReevaluateWithAmbiguitiesGapped@Base 6.1.20050429
+ Blast_HSPReevaluateWithAmbiguitiesUngapped@Base 6.1.20050429
+ Blast_HSPResultsApplyMasklevel@Base 6.1.20110713
+ Blast_HSPResultsFree@Base 6.1.20040505
+ Blast_HSPResultsFromHSPStream@Base 6.1.20060301
+ Blast_HSPResultsFromHSPStreamWithLimit@Base 6.1.20060301
+ Blast_HSPResultsFromHSPStreamWithLimitEx@Base 6.1.20120620
+ Blast_HSPResultsInsertHSPList@Base 6.1.20040616
+ Blast_HSPResultsNew@Base 6.1.20050429
+ Blast_HSPResultsReverseOrder@Base 6.1.20041020
+ Blast_HSPResultsReverseSort@Base 6.1.20080302
+ Blast_HSPResultsSortByEvalue@Base 6.1.20040505
+ Blast_HSPStreamResultBatchFree@Base 6.1.20070822
+ Blast_HSPStreamResultBatchInit@Base 6.1.20070822
+ Blast_HSPStreamResultBatchReset@Base 6.1.20070822
+ Blast_HSPTest@Base 6.1.20120620
+ Blast_HSPTestIdentityAndLength@Base 6.1.20050429
+ Blast_HSPUpdateWithTraceback@Base 6.1.20050429
+ Blast_HitListFree@Base 6.1.20040505
+ Blast_HitListHSPListsFree@Base 6.1.20040505
+ Blast_HitListMerge@Base 6.1.20070822
+ Blast_HitListNew@Base 6.1.20040505
+ Blast_HitListPurgeNullHSPLists@Base 6.1.20061015
+ Blast_HitListSortByEvalue@Base 6.1.20160908
+ Blast_HitListUpdate@Base 6.1.20040505
+ Blast_InitHitListIsSortedByScore@Base 6.1.20050429
+ Blast_InitHitListSortByScore@Base 6.1.20050429
+ Blast_IntervalTreeFree@Base 6.1.20050429
+ Blast_IntervalTreeInit@Base 6.1.20050429
+ Blast_IntervalTreeReset@Base 6.1.20050429
+ Blast_KarlinBlkCopy@Base 6.1.20050429
+ Blast_KarlinBlkFree@Base 6.1.20050429
+ Blast_KarlinBlkGappedCalc@Base 6.1.20040505
+ Blast_KarlinBlkGappedLoadFromTables@Base 6.1.20050429
+ Blast_KarlinBlkNew@Base 6.1.20050429
+ Blast_KarlinBlkNuclGappedCalc@Base 6.1.20050828
+ Blast_KarlinBlkUngappedCalc@Base 6.1.20050429
+ Blast_KarlinLambdaNR@Base 6.1.20040505
+ Blast_MappingResultsFree@Base 6.1.20160908
+ Blast_MappingResultsNew@Base 6.1.20160908
+ Blast_MaskTheResidues@Base 6.1.20040505
+ Blast_MaskUnsupportedAA@Base 6.1.20061015
+ Blast_MessageFree@Base 6.1.20040204
+ Blast_MessagePost@Base 6.1.20040204
+ Blast_MessageWrite@Base 6.1.20040204
+ Blast_Perror@Base 6.1.20050429
+ Blast_PerrorEx@Base 6.1.20060301
+ Blast_PrelimEditBlockToGapEditScript@Base 6.1.20050429
+ Blast_ProgramIsMapping@Base 6.1.20160908
+ Blast_ProgramIsNucleotide@Base 6.1.20160908
+ Blast_ProgramIsPhiBlast@Base 6.1.20050828
+ Blast_ProgramIsPsiBlast@Base 6.1.20050828
+ Blast_ProgramIsRpsBlast@Base 6.1.20050828
+ Blast_ProgramIsValid@Base 6.1.20070822
+ Blast_QueryIsNucleotide@Base 6.1.20050828
+ Blast_QueryIsPattern@Base 6.1.20160908
+ Blast_QueryIsProtein@Base 6.1.20050828
+ Blast_QueryIsPssm@Base 6.1.20050828
+ Blast_QueryIsTranslated@Base 6.1.20050828
+ Blast_RedoAlignmentCore@Base 6.1.20051206
+ Blast_RedoAlignmentCore_MT@Base 6.1.20160908
+ Blast_ResFreqFree@Base 6.1.20050429
+ Blast_ResFreqNew@Base 6.1.20040505
+ Blast_ResFreqStdComp@Base 6.1.20040505
+ Blast_RunFullSearch@Base 6.1.20050429
+ Blast_RunPreliminarySearch@Base 6.1.20050429
+ Blast_RunPreliminarySearchWithInterrupt@Base 6.1.20110713
+ Blast_RunTracebackSearch@Base 6.1.20050429
+ Blast_RunTracebackSearchWithInterrupt@Base 6.1.20110713
+ Blast_ScoreBlkKbpGappedCalc@Base 6.1.20050429
+ Blast_ScoreBlkKbpIdealCalc@Base 6.1.20050429
+ Blast_ScoreBlkKbpUngappedCalc@Base 6.1.20050429
+ Blast_ScoreBlkMatrixFill@Base 6.1.20050429
+ Blast_ScoreBlkMatrixInit@Base 6.1.20050429
+ Blast_ScoreFreqFree@Base 6.1.20050429
+ Blast_ScoreFreqNew@Base 6.1.20040616
+ Blast_SemiGappedAlign@Base 6.1.20050429
+ Blast_SetPHIPatternInfo@Base 6.1.20050429
+ Blast_SubjectIsNucleotide@Base 6.1.20050828
+ Blast_SubjectIsProtein@Base 6.1.20050828
+ Blast_SubjectIsPssm@Base 6.1.20050828
+ Blast_SubjectIsTranslated@Base 6.1.20050828
+ Blast_TracebackFromHSPList@Base 6.1.20040505
+ Blast_TracebackGetEncoding@Base 6.1.20040616
+ Blast_TrimHSPListByMaxHsps@Base 6.1.20160908
+ Blast_UngappedStatsUpdate@Base 6.1.20040616
+ CalculateLinkHSPCutoffs@Base 6.1.20040505
+ ContextOffsetsToOffsetArray@Base 6.1.20050429
+ DynamicInt4ArrayFree@Base 6.1.20070822
+ DynamicInt4ArrayNew@Base 6.1.20070822
+ DynamicInt4Array_Append@Base 6.1.20070822
+ DynamicSGenCodeNodeArrayFree@Base 6.1.20070822
+ DynamicSGenCodeNodeArrayNew@Base 6.1.20070822
+ DynamicSGenCodeNodeArray_Append@Base 6.1.20070822
+ DynamicSGenCodeNodeArray_Find@Base 6.1.20070822
+ DynamicUint4ArrayFree@Base 6.1.20070822
+ DynamicUint4ArrayNew@Base 6.1.20070822
+ DynamicUint4ArrayNewEx@Base 6.1.20070822
+ DynamicUint4Array_Append@Base 6.1.20070822
+ DynamicUint4Array_AreEqual@Base 6.1.20070822
+ DynamicUint4Array_Copy@Base 6.1.20070822
+ DynamicUint4Array_Dup@Base 6.1.20070822
+ Erf@Base 6.1.20160908
+ ErfC@Base 6.1.20160908
+ EstimateNumTableEntries@Base 6.1.20060301
+ FindPatternHits@Base 6.1.20040204
+ GapEditScriptCombine@Base 6.1.20160908
+ GapEditScriptDelete@Base 6.1.20040204
+ GapEditScriptDup@Base 6.1.20060301
+ GapEditScriptNew@Base 6.1.20040204
+ GapEditScriptPartialCopy@Base 6.1.20060301
+ GapPrelimEditBlockAdd@Base 6.1.20050429
+ GapPrelimEditBlockAppend@Base 6.1.20050429
+ GapPrelimEditBlockFree@Base 6.1.20050429
+ GapPrelimEditBlockNew@Base 6.1.20050429
+ GapPrelimEditBlockReset@Base 6.1.20050429
+ GapStateFree@Base 6.1.20040204
+ GenCodeSingletonAdd@Base 6.1.20070822
+ GenCodeSingletonFind@Base 6.1.20070822
+ GenCodeSingletonFini@Base 6.1.20070822
+ GenCodeSingletonInit@Base 6.1.20070822
+ GetOffsetArraySize@Base 6.1.20040204
+ GetReverseNuclSequence@Base 6.1.20040204
+ IUPACNA_TO_BLASTNA@Base 6.1.20040505
+ IUPACNA_TO_NCBI4NA@Base 6.1.20040505
+ JumperEditsBlockCombine@Base 6.1.20160908
+ JumperEditsBlockDup@Base 6.1.20160908
+ JumperEditsBlockFree@Base 6.1.20160908
+ JumperEditsBlockNew@Base 6.1.20160908
+ JumperExtendLeft@Base 6.1.20160908
+ JumperExtendLeftCompressed@Base 6.1.20160908
+ JumperExtendLeftCompressedWithTraceback@Base 6.1.20160908
+ JumperExtendLeftCompressedWithTracebackOptimal@Base 6.1.20160908
+ JumperExtendRight@Base 6.1.20160908
+ JumperExtendRightCompressed@Base 6.1.20160908
+ JumperExtendRightCompressedWithTraceback@Base 6.1.20160908
+ JumperExtendRightCompressedWithTracebackOptimal@Base 6.1.20160908
+ JumperExtendRightWithTraceback@Base 6.1.20160908
+ JumperFindEdits@Base 6.1.20160908
+ JumperFindSpliceSignals@Base 6.1.20160908
+ JumperGapAlignFree@Base 6.1.20160908
+ JumperGapAlignNew@Base 6.1.20160908
+ JumperGappedAlignmentCompressedWithTraceback@Base 6.1.20160908
+ JumperGoodAlign@Base 6.1.20160908
+ JumperNaWordFinder@Base 6.1.20160908
+ JumperPrelimEditBlockAdd@Base 6.1.20160908
+ JumperPrelimEditBlockToGapEditScript@Base 6.1.20160908
+ Kappa_compactSearchItemsFree@Base 6.1.20050429
+ Kappa_compactSearchItemsNew@Base 6.1.20050429
+ Kappa_impalaScaling@Base 6.1.20050429
+ Kappa_posSearchItemsFree@Base 6.1.20050429
+ Kappa_posSearchItemsNew@Base 6.1.20050429
+ ListNodeAdd@Base 6.1.20040204
+ ListNodeAddPointer@Base 6.1.20040204
+ ListNodeCopyStr@Base 6.1.20040204
+ ListNodeFree@Base 6.1.20040204
+ ListNodeFreeData@Base 6.1.20040204
+ ListNodeNew@Base 6.1.20040204
+ LookupTableOptionsFree@Base 6.1.20040204
+ LookupTableOptionsNew@Base 6.1.20040204
+ LookupTableOptionsValidate@Base 6.1.20040204
+ LookupTableWrapFree@Base 6.1.20040204
+ LookupTableWrapInit@Base 6.1.20040204
+ LookupTableWrapInit_MT@Base 6.1.20170106
+ MBSpaceFree@Base 6.1.20040204
+ MBSpaceNew@Base 6.1.20040204
+ MB_IndexedWordFinder@Base 6.1.20061015
+ MapperWordHitsFree@Base 6.1.20160908
+ MapperWordHitsNew@Base 6.1.20160908
+ NCBI4NA_TO_BLASTNA@Base 6.1.20040204
+ NCBI4NA_TO_IUPACNA@Base 6.1.20080302
+ NCBISTDAA_TO_AMINOACID@Base 6.1.20061015
+ OffsetArrayToContextOffsets@Base 6.1.20050429
+ PHIBlastScanSubject@Base 6.1.20040204
+ PHIBlastWordFinder@Base 6.1.20040204
+ PHIBlast_HSPResultsSplit@Base 6.1.20050605
+ PHIGappedAlignmentWithTraceback@Base 6.1.20040204
+ PHIGetGappedScore@Base 6.1.20040204
+ PHIGetPatternOccurrences@Base 6.1.20050429
+ PSIBlastOptionsFree@Base 6.1.20040204
+ PSIBlastOptionsNew@Base 6.1.20040204
+ PSIBlastOptionsValidate@Base 6.1.20050429
+ PSICreatePssm@Base 6.1.20041020
+ PSICreatePssmFromCDD@Base 6.1.20120620
+ PSICreatePssmFromFrequencyRatios@Base 6.1.20050605
+ PSICreatePssmWithDiagnostics@Base 6.1.20041020
+ PSIDiagnosticsRequestFree@Base 6.1.20050429
+ PSIDiagnosticsRequestNew@Base 6.1.20050429
+ PSIDiagnosticsRequestNewEx@Base 6.1.20090719
+ PSIDiagnosticsResponseFree@Base 6.1.20041020
+ PSIDiagnosticsResponseNew@Base 6.1.20041020
+ PSIMatrixFree@Base 6.1.20040616
+ PSIMatrixNew@Base 6.1.20040616
+ PSIMsaFree@Base 6.1.20041020
+ PSIMsaNew@Base 6.1.20041020
+ PhiBlastGetEffectiveNumberOfPatterns@Base 6.1.20061015
+ QueryInfo_GetSeqBufLen@Base 6.1.20050429
+ RPSLookupTableDestruct@Base 6.1.20040505
+ RPSLookupTableNew@Base 6.1.20040505
+ RPSPsiMatrixAttach@Base 6.1.20050429
+ RPSPsiMatrixDetach@Base 6.1.20050429
+ RPSRescalePssm@Base 6.1.20050429
+ SBlastFilterOptionsFree@Base 6.1.20050429
+ SBlastFilterOptionsMaskAtHash@Base 6.1.20050429
+ SBlastFilterOptionsMerge@Base 6.1.20070822
+ SBlastFilterOptionsNew@Base 6.1.20050429
+ SBlastFilterOptionsNoFiltering@Base 6.1.20081116
+ SBlastFilterOptionsValidate@Base 6.1.20050429
+ SBlastHitsParametersDup@Base 6.1.20061015
+ SBlastHitsParametersFree@Base 6.1.20050605
+ SBlastHitsParametersNew@Base 6.1.20050605
+ SBlastProgressFree@Base 6.1.20060507
+ SBlastProgressNew@Base 6.1.20060507
+ SBlastProgressReset@Base 6.1.20060507
+ SBlastScoreMatrixFree@Base 6.1.20160908
+ SBlastScoreMatrixNew@Base 6.1.20160908
+ SCompressedAlphabetFree@Base 6.1.20070822
+ SCompressedAlphabetNew@Base 6.1.20070822
+ SDustOptionsFree@Base 6.1.20050429
+ SDustOptionsNew@Base 6.1.20050429
+ SMessageOriginFree@Base 6.1.20060301
+ SMessageOriginNew@Base 6.1.20060301
+ SPHIPatternSearchBlkFree@Base 6.1.20050429
+ SPHIPatternSearchBlkNew@Base 6.1.20050429
+ SPHIQueryInfoCopy@Base 6.1.20050429
+ SPHIQueryInfoFree@Base 6.1.20050429
+ SPHIQueryInfoNew@Base 6.1.20050429
+ SPsiBlastScoreMatrixFree@Base 6.1.20050429
+ SPsiBlastScoreMatrixNew@Base 6.1.20050429
+ SRepeatFilterOptionsFree@Base 6.1.20050429
+ SRepeatFilterOptionsNew@Base 6.1.20050429
+ SRepeatFilterOptionsResetDB@Base 6.1.20050429
+ SSegOptionsFree@Base 6.1.20050429
+ SSegOptionsNew@Base 6.1.20050429
+ SSeqRangeArrayLessThanOrEqual@Base 6.1.20090301
+ SSeqRangeNew@Base 6.1.20081116
+ SThreadLocalDataArrayConsolidateResults@Base 6.1.20160908
+ SThreadLocalDataArrayFree@Base 6.1.20160908
+ SThreadLocalDataArrayNew@Base 6.1.20160908
+ SThreadLocalDataArraySetup@Base 6.1.20160908
+ SThreadLocalDataArrayTrim@Base 6.1.20160908
+ SThreadLocalDataFree@Base 6.1.20160908
+ SThreadLocalDataNew@Base 6.1.20160908
+ SUBJECT_SPLIT_DONE@Base 6.1.20100808
+ SUBJECT_SPLIT_NO_RANGE@Base 6.1.20100808
+ SUBJECT_SPLIT_OK@Base 6.1.20100808
+ SWindowMaskerOptionsFree@Base 6.1.20081116
+ SWindowMaskerOptionsNew@Base 6.1.20081116
+ SWindowMaskerOptionsResetDB@Base 6.1.20081116
+ ScoreCompareHSPs@Base 6.1.20050429
+ SegParametersFree@Base 6.1.20040204
+ SegParametersNewAa@Base 6.1.20040204
+ SeqBufferSeg@Base 6.1.20040204
+ SequenceOverhangsFree@Base 6.1.20160908
+ ShortRead_IndexedWordFinder@Base 6.1.20160908
+ SmithWatermanScoreWithTraceback@Base 6.1.20061015
+ SplitQueryBlkFree@Base 6.1.20070822
+ SplitQueryBlkNew@Base 6.1.20070822
+ SplitQueryBlk_AddContextOffsetToChunk@Base 6.1.20070822
+ SplitQueryBlk_AddContextToChunk@Base 6.1.20070822
+ SplitQueryBlk_AddQueryToChunk@Base 6.1.20070822
+ SplitQueryBlk_AllowGap@Base 6.1.20100808
+ SplitQueryBlk_GetChunkBounds@Base 6.1.20070822
+ SplitQueryBlk_GetChunkOverlapSize@Base 6.1.20070822
+ SplitQueryBlk_GetContextOffsetsForChunk@Base 6.1.20070822
+ SplitQueryBlk_GetNumQueriesForChunk@Base 6.1.20070822
+ SplitQueryBlk_GetQueryContextsForChunk@Base 6.1.20070822
+ SplitQueryBlk_GetQueryIndicesForChunk@Base 6.1.20070822
+ SplitQueryBlk_SetChunkBounds@Base 6.1.20070822
+ SplitQueryBlk_SetChunkOverlapSize@Base 6.1.20070822
+ SubjectIndexFree@Base 6.1.20160908
+ SubjectIndexIteratorFree@Base 6.1.20160908
+ SubjectIndexIteratorNew@Base 6.1.20160908
+ SubjectIndexIteratorNext@Base 6.1.20160908
+ SubjectIndexIteratorPrev@Base 6.1.20160908
+ SubjectIndexNew@Base 6.1.20160908
+ _BlastSeqSrcImpl_GetCopyFnPtr@Base 6.1.20050429
+ _BlastSeqSrcImpl_GetDataStructure@Base 6.1.20050429
+ _BlastSeqSrcImpl_GetDeleteFnPtr@Base 6.1.20050429
+ _BlastSeqSrcImpl_GetGetAvgSeqLen@Base 6.1.20050429
+ _BlastSeqSrcImpl_GetGetIsProt@Base 6.1.20050429
+ _BlastSeqSrcImpl_GetGetMaxSeqLen@Base 6.1.20050429
+ _BlastSeqSrcImpl_GetGetMinSeqLen@Base 6.1.20120620
+ _BlastSeqSrcImpl_GetGetName@Base 6.1.20050429
+ _BlastSeqSrcImpl_GetGetNumSeqs@Base 6.1.20050429
+ _BlastSeqSrcImpl_GetGetNumSeqsStats@Base 6.1.20070822
+ _BlastSeqSrcImpl_GetGetSeqLen@Base 6.1.20050429
+ _BlastSeqSrcImpl_GetGetSequence@Base 6.1.20050429
+ _BlastSeqSrcImpl_GetGetSupportsPartialFetching@Base 6.1.20110713
+ _BlastSeqSrcImpl_GetGetTotLen@Base 6.1.20050429
+ _BlastSeqSrcImpl_GetGetTotLenStats@Base 6.1.20070822
+ _BlastSeqSrcImpl_GetInitErrorStr@Base 6.1.20050429
+ _BlastSeqSrcImpl_GetIterNext@Base 6.1.20050429
+ _BlastSeqSrcImpl_GetNewFnPtr@Base 6.1.20050429
+ _BlastSeqSrcImpl_GetReleaseSequence@Base 6.1.20050429
+ _BlastSeqSrcImpl_GetResetChunkIterator@Base 6.1.20070822
+ _BlastSeqSrcImpl_GetSetNumberOfThreads@Base 6.1.20090719
+ _BlastSeqSrcImpl_GetSetSeqRange@Base 6.1.20110713
+ _BlastSeqSrcImpl_SetCopyFnPtr@Base 6.1.20050429
+ _BlastSeqSrcImpl_SetDataStructure@Base 6.1.20050429
+ _BlastSeqSrcImpl_SetDeleteFnPtr@Base 6.1.20050429
+ _BlastSeqSrcImpl_SetGetAvgSeqLen@Base 6.1.20050429
+ _BlastSeqSrcImpl_SetGetIsProt@Base 6.1.20050429
+ _BlastSeqSrcImpl_SetGetMaxSeqLen@Base 6.1.20050429
+ _BlastSeqSrcImpl_SetGetMinSeqLen@Base 6.1.20120620
+ _BlastSeqSrcImpl_SetGetName@Base 6.1.20050429
+ _BlastSeqSrcImpl_SetGetNumSeqs@Base 6.1.20050429
+ _BlastSeqSrcImpl_SetGetNumSeqsStats@Base 6.1.20070822
+ _BlastSeqSrcImpl_SetGetSeqLen@Base 6.1.20050429
+ _BlastSeqSrcImpl_SetGetSequence@Base 6.1.20050429
+ _BlastSeqSrcImpl_SetGetSupportsPartialFetching@Base 6.1.20110713
+ _BlastSeqSrcImpl_SetGetTotLen@Base 6.1.20050429
+ _BlastSeqSrcImpl_SetGetTotLenStats@Base 6.1.20070822
+ _BlastSeqSrcImpl_SetInitErrorStr@Base 6.1.20050429
+ _BlastSeqSrcImpl_SetIterNext@Base 6.1.20050429
+ _BlastSeqSrcImpl_SetNewFnPtr@Base 6.1.20050429
+ _BlastSeqSrcImpl_SetReleaseSequence@Base 6.1.20050429
+ _BlastSeqSrcImpl_SetResetChunkIterator@Base 6.1.20070822
+ _BlastSeqSrcImpl_SetSetNumberOfThreads@Base 6.1.20090719
+ _BlastSeqSrcImpl_SetSetSeqRange@Base 6.1.20110713
+ _IMPALAScaleMatrix@Base 6.1.20050429
+ _PHIBlastFindHitsShort@Base 6.1.20050429
+ _PHIGetRightOneBits@Base 6.1.20050429
+ _PHIPatternWordsBitwiseAnd@Base 6.1.20050429
+ _PHIPatternWordsBitwiseOr@Base 6.1.20050429
+ _PHIPatternWordsLeftShift@Base 6.1.20050429
+ _PSIAlignedBlockFree@Base 6.1.20040616
+ _PSIAlignedBlockNew@Base 6.1.20040616
+ _PSIAllocateMatrix@Base 6.1.20040505
+ _PSICalculateInformationContentFromFreqRatios@Base 6.1.20050429
+ _PSICalculateInformationContentFromScoreMatrix@Base 6.1.20041020
+ _PSIComputeAlignmentBlocks@Base 6.1.20041020
+ _PSIComputeFreqRatios@Base 6.1.20050429
+ _PSIComputeFreqRatiosFromCDs@Base 6.1.20120620
+ _PSIComputeFrequenciesFromCDs@Base 6.1.20120620
+ _PSIComputeScoreProbabilities@Base 6.1.20040616
+ _PSIComputeSequenceWeights@Base 6.1.20041020
+ _PSIConvertFreqRatiosToPSSM@Base 6.1.20050429
+ _PSICopyMatrix_double@Base 6.1.20050429
+ _PSICopyMatrix_int@Base 6.1.20050429
+ _PSIDeallocateMatrix@Base 6.1.20040505
+ _PSIInternalPssmDataFree@Base 6.1.20041020
+ _PSIInternalPssmDataNew@Base 6.1.20041020
+ _PSIMatrixFrequencyRatiosFree@Base 6.1.20040616
+ _PSIMatrixFrequencyRatiosNew@Base 6.1.20040616
+ _PSIMsaFree@Base 6.1.20041020
+ _PSIMsaNew@Base 6.1.20041020
+ _PSIPackedMsaFree@Base 6.1.20070822
+ _PSIPackedMsaGetNumberOfAlignedSeqs@Base 6.1.20070822
+ _PSIPackedMsaNew@Base 6.1.20070822
+ _PSIPurgeAlignedRegion@Base 6.1.20040616
+ _PSIPurgeBiasedSegments@Base 6.1.20041020
+ _PSISaveCDDiagnostics@Base 6.1.20120620
+ _PSISaveDiagnostics@Base 6.1.20040616
+ _PSIScaleMatrix@Base 6.1.20041020
+ _PSISequenceLengthWithoutX@Base 6.1.20040616
+ _PSISequenceWeightsFree@Base 6.1.20040616
+ _PSISequenceWeightsNew@Base 6.1.20040616
+ _PSIStructureGroupCustomization@Base 6.1.20060507
+ _PSIUpdateLambdaK@Base 6.1.20040616
+ _PSIUpdatePositionCounts@Base 6.1.20041020
+ _PSIValidateCdMSA@Base 6.1.20120620
+ _PSIValidateMSA@Base 6.1.20041020
+ _PSIValidateMSA_StructureGroup@Base 6.1.20060507
+ __sfree@Base 6.1.20040204
+ debruijn@Base 6.1.20040204
+ iexp@Base 6.1.20040204
+ ilog2@Base 6.1.20040204
+ ir_hash_create@Base 6.1.20070822
+ ir_hash_destroy@Base 6.1.20070822
+ ir_locate@Base 6.1.20070822
+ jumper_default@Base 6.1.20160908
+ jumper_edge@Base 6.1.20160908
+ jumper_ungapped@Base 6.1.20160908
+ kBadParameter@Base 6.1.20070822
+ kBlastErrMsg_CantCalculateUngappedKAParams@Base 6.1.20160908
+ kBlastHSPStream_Eof@Base 6.1.20040616
+ kBlastHSPStream_Error@Base 6.1.20040616
+ kBlastHSPStream_Success@Base 6.1.20040616
+ kBlastMajorVersion@Base 6.1.20050828
+ kBlastMessageNoContext@Base 6.1.20060507
+ kBlastMinorVersion@Base 6.1.20050828
+ kBlastPatchVersion@Base 6.1.20050828
+ kBlastReleaseDate@Base 6.1.20050828
+ kBlastSeqSrcDefaultChunkSize@Base 6.1.20041020
+ kDustLevel@Base 6.1.20050429
+ kDustLinker@Base 6.1.20050429
+ kDustWindow@Base 6.1.20050429
+ kEpsilon@Base 6.1.20040616
+ kInvalidContext@Base 6.1.20070822
+ kMaskAaAlphabetBits@Base 6.1.20050429
+ kNuclMask@Base 6.1.20050429
+ kNuclSentinel@Base 6.1.20060507
+ kOutOfMemory@Base 6.1.20070822
+ kPSIIdentical@Base 6.1.20041020
+ kPSINearIdentical@Base 6.1.20041020
+ kPSIScaleFactor@Base 6.1.20041020
+ kPSSM_NoImpalaScaling@Base 6.1.20050605
+ kPosEpsilon@Base 6.1.20081116
+ kPositScalingNumIterations@Base 6.1.20050429
+ kPositScalingPercent@Base 6.1.20050429
+ kProtAlphabet@Base 6.1.20050429
+ kProtMask@Base 6.1.20050429
+ kProtSentinel@Base 6.1.20060507
+ kQueryIndex@Base 6.1.20040616
+ kResizeFactor@Base 6.1.20080302
+ kSegHicut@Base 6.1.20050429
+ kSegLocut@Base 6.1.20050429
+ kSegWindow@Base 6.1.20050429
+ lnfact@Base 6.1.20040204
+ log_win10@Base 6.1.20160908
+ printAllParameters@Base 6.1.20110713
+ printBlastExtensionParameters@Base 6.1.20110713
+ printBlastHitSavingParameters@Base 6.1.20110713
+ printBlastInitialWordParamters@Base 6.1.20110713
+ printBlastScoringParameters@Base 6.1.20110713
+ s_GetSubjectLength@Base 6.1.20160908
+ trueCharPositions@Base 6.1.20040616
+libblastapi.so.6 libncbi6 #MINVER#
+ BLAST_FormatResults@Base 6.1.20040204
+ BLAST_GeneticCodeFind@Base 6.1.20040204
+ BLAST_GetQuerySeqLoc@Base 6.1.20040204
+ BLAST_PrintOutputHeader@Base 6.1.20040204
+ BLAST_ResultsToSeqAlign@Base 6.1.20040204
+ BLAST_SetUpQuery@Base 6.1.20040204
+ BLAST_SetUpSubject@Base 6.1.20040204
+ BLAST_SummaryOptionsFree@Base 6.1.20040505
+ BLAST_SummaryOptionsInit@Base 6.1.20040505
+ BLAST_TwoSeqLocSets@Base 6.1.20040616
+ BLAST_TwoSequencesSearch@Base 6.1.20040505
+ BlastFormattingInfoFree@Base 6.1.20050605
+ BlastFormattingInfoNew@Base 6.1.20050605
+ BlastFormattingInfoNewBasic@Base 6.1.20050605
+ BlastFormattingInfoSetUpOptions@Base 6.1.20050605
+ BlastHSPQueueInfoNew@Base 6.1.20090719
+ BlastHSPQueueParamsFree@Base 6.1.20090719
+ BlastHSPQueueParamsNew@Base 6.1.20090719
+ BlastHSPQueueRead@Base 6.1.20090719
+ BlastHSPToSeqAlign@Base 6.1.20061015
+ BlastMaskLocFromSeqLoc@Base 6.1.20050429
+ BlastMaskLocToSeqLoc@Base 6.1.20040204
+ BlastPrelimSearchThreadDataFree@Base 6.1.20041020
+ BlastPrelimSearchThreadDataInit@Base 6.1.20041020
+ BlastPrintLogReport@Base 6.1.20041020
+ BlastSeqlocsHaveDuplicateIDs@Base 6.1.20060507
+ BlastTabularFormatDataClean@Base 6.1.20050429
+ BlastTabularFormatDataFree@Base 6.1.20040616
+ BlastTabularFormatDataNew@Base 6.1.20050429
+ Blast_DatabaseSearch@Base 6.1.20050429
+ Blast_FindDustSeqLoc@Base 6.1.20050828
+ Blast_FindRepeatFilterSeqLoc@Base 6.1.20050429
+ Blast_GetDbInfo@Base 6.1.20041020
+ Blast_GetParametersBuffer@Base 6.1.20040616
+ Blast_MT_LOCKInit@Base 6.1.20041020
+ Blast_MessageToSBlastMessage@Base 6.1.20060507
+ Blast_PosReadCheckpoint@Base 6.1.20070822
+ Blast_PrelimSearchThreadRun@Base 6.1.20041020
+ Blast_PrintOutputFooter@Base 6.1.20041020
+ Blast_PsiCheckpointLocFree@Base 6.1.20070822
+ Blast_PsiCheckpointLocNew@Base 6.1.20070822
+ Blast_RunSearch@Base 6.1.20050429
+ Blast_SearchOptionsFromSummaryOptions@Base 6.1.20050605
+ Blast_SearchParamsFill@Base 6.1.20050605
+ Blast_SeqIdGetDefLine@Base 6.1.20040616
+ Blast_SummaryReturnClean@Base 6.1.20050429
+ Blast_SummaryReturnFill@Base 6.1.20040616
+ Blast_SummaryReturnFree@Base 6.1.20041020
+ Blast_SummaryReturnNew@Base 6.1.20050429
+ Blast_SummaryReturnUpdate@Base 6.1.20050605
+ Blast_SummaryReturnsPostError@Base 6.1.20050429
+ Blast_TabularFormatDataSetUp@Base 6.1.20050429
+ Blast_TabularFormatThread@Base 6.1.20040616
+ Blast_TwoSeqLocSetsAdvanced@Base 6.1.20050429
+ Blast_ValNodeMaskListFree@Base 6.1.20050429
+ GapCollectDataForSeqalign@Base 6.1.20040204
+ GeneticCodeSingletonFini@Base 6.1.20070822
+ GeneticCodeSingletonInit@Base 6.1.20070822
+ GetOldAlignType@Base 6.1.20061015
+ GetScoreSetFromBlastHsp@Base 6.1.20061015
+ MultiSeqBlastSeqSrcInit@Base 6.1.20050429
+ OOFBlastHSPToSeqAlign@Base 6.1.20061015
+ PHIBlastFormatResults@Base 6.1.20050429
+ PHIBlastResultsFree@Base 6.1.20050429
+ PHIBlastRunSearch@Base 6.1.20050429
+ ReaddbBlastSeqSrcAttach@Base 6.1.20050429
+ ReaddbBlastSeqSrcInit@Base 6.1.20040505
+ SBlastMessageDup@Base 6.1.20060507
+ SBlastMessageErrPost@Base 6.1.20060507
+ SBlastMessageFree@Base 6.1.20060507
+ SBlastMessageWrite@Base 6.1.20060507
+ SBlastOptionsFree@Base 6.1.20050429
+ SBlastOptionsGetBelieveQuery@Base 6.1.20060507
+ SBlastOptionsGetMaskAtHash@Base 6.1.20051206
+ SBlastOptionsNew@Base 6.1.20050429
+ SBlastOptionsSetBelieveQuery@Base 6.1.20060507
+ SBlastOptionsSetDbGeneticCode@Base 6.1.20050429
+ SBlastOptionsSetDiscMbParams@Base 6.1.20050429
+ SBlastOptionsSetEvalue@Base 6.1.20050429
+ SBlastOptionsSetFilterString@Base 6.1.20050429
+ SBlastOptionsSetMatrixAndGapCosts@Base 6.1.20050429
+ SBlastOptionsSetRewardPenaltyAndGapCosts@Base 6.1.20051206
+ SBlastOptionsSetThreshold@Base 6.1.20051206
+ SBlastOptionsSetWindowSize@Base 6.1.20051206
+ SBlastOptionsSetWordSize@Base 6.1.20050429
+ SBlastSeqalignArrayFree@Base 6.1.20060301
+ SBlastSeqalignArrayNew@Base 6.1.20060301
+ k_MatrixSize@Base 6.1.20081116
+ s_Context2SeqLoc@Base 6.1.20060507
+ s_EBlastSeverity2ErrSev@Base 6.1.20060507
+ s_SBlastMessageCompare@Base 6.1.20060507
+ s_SeqBufferDust@Base 6.1.20070822
+libblastcompadj.so.6 libncbi6 #MINVER#
+ BlastCompo_AlignmentNew@Base 6.1.20051206
+ BlastCompo_AlignmentsFree@Base 6.1.20051206
+ BlastCompo_EarlyTermination@Base 6.1.20051206
+ BlastCompo_HeapFilledToCutoff@Base 6.1.20051206
+ BlastCompo_HeapInitialize@Base 6.1.20051206
+ BlastCompo_HeapInsert@Base 6.1.20051206
+ BlastCompo_HeapPop@Base 6.1.20051206
+ BlastCompo_HeapRelease@Base 6.1.20051206
+ BlastCompo_HeapWouldInsert@Base 6.1.20051206
+ Blast_AdjustScores@Base 6.1.20051206
+ Blast_ApplyPseudocounts@Base 6.1.20060507
+ Blast_CalcFreqRatios@Base 6.1.20060507
+ Blast_CalcLambdaFullPrecision@Base 6.1.20060507
+ Blast_ChooseMatrixAdjustRule@Base 6.1.20060301
+ Blast_CompositionBasedStats@Base 6.1.20051206
+ Blast_CompositionMatrixAdj@Base 6.1.20051206
+ Blast_CompositionPvalue@Base 6.1.20060507
+ Blast_CompositionWorkspaceFree@Base 6.1.20051206
+ Blast_CompositionWorkspaceInit@Base 6.1.20051206
+ Blast_CompositionWorkspaceNew@Base 6.1.20051206
+ Blast_EntropyOldFreqNewContext@Base 6.1.20060507
+ Blast_ForbiddenRangesClear@Base 6.1.20051206
+ Blast_ForbiddenRangesInitialize@Base 6.1.20051206
+ Blast_ForbiddenRangesPush@Base 6.1.20051206
+ Blast_ForbiddenRangesRelease@Base 6.1.20051206
+ Blast_FreqRatioToScore@Base 6.1.20060507
+ Blast_FrequencyDataIsAvailable@Base 6.1.20051206
+ Blast_GetCompositionRange@Base 6.1.20051206
+ Blast_GetJointProbsForMatrix@Base 6.1.20051206
+ Blast_GetMatrixBackgroundFreq@Base 6.1.20051206
+ Blast_GetRelativeEntropy@Base 6.1.20051206
+ Blast_Int4MatrixFromFreq@Base 6.1.20051206
+ Blast_MatrixEntropy@Base 6.1.20060507
+ Blast_MatrixInfoFree@Base 6.1.20051206
+ Blast_MatrixInfoNew@Base 6.1.20051206
+ Blast_OptimizeTargetFrequencies@Base 6.1.20051206
+ Blast_Overall_P_Value@Base 6.1.20060507
+ Blast_ReadAaComposition@Base 6.1.20051206
+ Blast_RedoAlignParamsFree@Base 6.1.20051206
+ Blast_RedoAlignParamsNew@Base 6.1.20051206
+ Blast_RedoOneMatch@Base 6.1.20051206
+ Blast_RedoOneMatchSmithWaterman@Base 6.1.20051206
+ Blast_SmithWatermanFindStart@Base 6.1.20051206
+ Blast_SmithWatermanScoreOnly@Base 6.1.20051206
+ Blast_TargetFreqEntropy@Base 6.1.20060507
+ Blast_TrueAaToStdTargetFreqs@Base 6.1.20061015
+ Nlm_AddVectors@Base 6.1.20051206
+ Nlm_DenseMatrixFree@Base 6.1.20051206
+ Nlm_DenseMatrixNew@Base 6.1.20051206
+ Nlm_EuclideanNorm@Base 6.1.20051206
+ Nlm_FactorLtriangPosDef@Base 6.1.20051206
+ Nlm_Int4MatrixFree@Base 6.1.20051206
+ Nlm_Int4MatrixNew@Base 6.1.20051206
+ Nlm_LtriangMatrixNew@Base 6.1.20051206
+ Nlm_SolveLtriangPosDef@Base 6.1.20051206
+ Nlm_StepBound@Base 6.1.20051206
+libconnssl.so.6 libncbi6 #MINVER#
+ NcbiCredGnuTls@Base 6.1.20160908
+ NcbiSetupGnuTls@Base 6.1.20160908
+libncbi.so.6 libncbi6 #MINVER#
+ AsnAllModPtr@Base 6.1.20030421
+ AsnBinBufWrite@Base 6.1.20030421
+ AsnBinReadId@Base 6.1.20030421
+ AsnBinReadVal@Base 6.1.20030421
+ AsnBinWrite@Base 6.1.20030421
+ AsnBufWrite@Base 6.1.20030421
+ AsnCheckExpOpt@Base 6.1.20030421
+ AsnCheckModule@Base 6.1.20030421
+ AsnClassTypeMatch@Base 6.1.20030421
+ AsnCloseStruct@Base 6.1.20030421
+ AsnDeBinDecr@Base 6.1.20030421
+ AsnDeBinFindElement@Base 6.1.20030421
+ AsnDeBinFindType@Base 6.1.20030421
+ AsnDeBinReadBigInt@Base 6.1.20030421
+ AsnDeBinReadBoolean@Base 6.1.20030421
+ AsnDeBinReadInteger@Base 6.1.20030421
+ AsnDeBinReadNull@Base 6.1.20030421
+ AsnDeBinReadOctets@Base 6.1.20030421
+ AsnDeBinReadReal@Base 6.1.20030421
+ AsnDeBinReadString@Base 6.1.20030421
+ AsnDeBinScanTag@Base 6.1.20030421
+ AsnDeBinSkipOctets@Base 6.1.20030421
+ AsnDeBinSkipString@Base 6.1.20030421
+ AsnDeBinSkipStruct@Base 6.1.20030421
+ AsnElementTypeNew@Base 6.1.20030421
+ AsnEnBinBigInt@Base 6.1.20030421
+ AsnEnBinBoolean@Base 6.1.20030421
+ AsnEnBinCloseStruct@Base 6.1.20030421
+ AsnEnBinEndIndef@Base 6.1.20030421
+ AsnEnBinInteger@Base 6.1.20030421
+ AsnEnBinLen@Base 6.1.20030421
+ AsnEnBinNull@Base 6.1.20030421
+ AsnEnBinOctets@Base 6.1.20030421
+ AsnEnBinOpenStruct@Base 6.1.20030421
+ AsnEnBinReal@Base 6.1.20030421
+ AsnEnBinStartIndef@Base 6.1.20030421
+ AsnEnBinString@Base 6.1.20030421
+ AsnEnBinTags@Base 6.1.20030421
+ AsnEnBinTheBytes@Base 6.1.20030421
+ AsnEnumStr@Base 6.1.20030421
+ AsnEnumTypeStr@Base 6.1.20030421
+ AsnErrGetTypeName@Base 6.1.20030421
+ AsnExpOptFree@Base 6.1.20030421
+ AsnExpOptNew@Base 6.1.20030421
+ AsnFindBaseIsa@Base 6.1.20030421
+ AsnFindBaseName@Base 6.1.20030421
+ AsnFindBaseType@Base 6.1.20030421
+ AsnFindBaseTypeDTD@Base 6.1.20040204
+ AsnFindNthPieceOfObject@Base 6.1.20030421
+ AsnFindPrimName@Base 6.1.20030421
+ AsnGenericBaseSeqOfAsnRead@Base 6.1.20030421
+ AsnGenericBaseSeqOfAsnWrite@Base 6.1.20030421
+ AsnGenericBaseSeqOfFree@Base 6.1.20030421
+ AsnGenericChoiceSeqOfAsnRead@Base 6.1.20030421
+ AsnGenericChoiceSeqOfAsnWrite@Base 6.1.20030421
+ AsnGenericChoiceSeqOfFree@Base 6.1.20030421
+ AsnGenericUserSeqOfAsnRead@Base 6.1.20030421
+ AsnGenericUserSeqOfAsnWrite@Base 6.1.20030421
+ AsnGenericUserSeqOfFree@Base 6.1.20030421
+ AsnGenericValNodeSetAsnRead@Base 6.1.20100808
+ AsnGenericValNodeSetAsnWrite@Base 6.1.20100808
+ AsnGenericValNodeSetFree@Base 6.1.20100808
+ AsnGetLevel@Base 6.1.20030421
+ AsnGetType@Base 6.1.20030421
+ AsnGetXMLmodulePrefix@Base 6.1.20030421
+ AsnIoBSClose@Base 6.1.20030421
+ AsnIoBSOpen@Base 6.1.20030421
+ AsnIoBSRead@Base 6.1.20030421
+ AsnIoBSWrite@Base 6.1.20030421
+ AsnIoClose@Base 6.1.20030421
+ AsnIoCopy@Base 6.1.20030421
+ AsnIoErrorMsg@Base 6.1.20030421
+ AsnIoFlush@Base 6.1.20030421
+ AsnIoFree@Base 6.1.20030421
+ AsnIoGets@Base 6.1.20030421
+ AsnIoHash@Base 6.1.20030421
+ AsnIoMemClose@Base 6.1.20030421
+ AsnIoMemComp@Base 6.1.20030421
+ AsnIoMemCopy@Base 6.1.20030421
+ AsnIoMemOpen@Base 6.1.20030421
+ AsnIoMemRead@Base 6.1.20030421
+ AsnIoMemReset@Base 6.1.20030421
+ AsnIoMemWrite@Base 6.1.20030421
+ AsnIoNew@Base 6.1.20030421
+ AsnIoOpen@Base 6.1.20030421
+ AsnIoOptionFree@Base 6.1.20030421
+ AsnIoOptionGet@Base 6.1.20030421
+ AsnIoOptionNew@Base 6.1.20030421
+ AsnIoPuts@Base 6.1.20030421
+ AsnIoReadBlock@Base 6.1.20030421
+ AsnIoReset@Base 6.1.20030421
+ AsnIoSeek@Base 6.1.20030421
+ AsnIoSetBufsize@Base 6.1.20030421
+ AsnIoSetErrorMsg@Base 6.1.20030421
+ AsnIoTell@Base 6.1.20030421
+ AsnIoWriteBlock@Base 6.1.20030421
+ AsnKillValue@Base 6.1.20030421
+ AsnLexBigInt@Base 6.1.20030421
+ AsnLexFindElement@Base 6.1.20030421
+ AsnLexFindType@Base 6.1.20030421
+ AsnLexInteger@Base 6.1.20030421
+ AsnLexReadBigInt@Base 6.1.20030421
+ AsnLexReadBoolean@Base 6.1.20030421
+ AsnLexReadInteger@Base 6.1.20030421
+ AsnLexReadNull@Base 6.1.20030421
+ AsnLexReadOctets@Base 6.1.20030421
+ AsnLexReadReal@Base 6.1.20030421
+ AsnLexReadString@Base 6.1.20030421
+ AsnLexSaveWord@Base 6.1.20030421
+ AsnLexSkipOctets@Base 6.1.20030421
+ AsnLexSkipString@Base 6.1.20030421
+ AsnLexSkipStruct@Base 6.1.20030421
+ AsnLexTMatchToken@Base 6.1.20030421
+ AsnLexTReadAlternativeTypeList@Base 6.1.20030421
+ AsnLexTReadElementTypeList@Base 6.1.20030421
+ AsnLexTReadModule@Base 6.1.20030421
+ AsnLexTReadType@Base 6.1.20030421
+ AsnLexTReadTypeAssign@Base 6.1.20030421
+ AsnLexTStartModule@Base 6.1.20030421
+ AsnLexTWord@Base 6.1.20030421
+ AsnLexWord@Base 6.1.20030421
+ AsnLinkType@Base 6.1.20030421
+ AsnLoadModules@Base 6.1.20030421
+ AsnModuleLink@Base 6.1.20030421
+ AsnNullValueMsg@Base 6.1.20030421
+ AsnOpenStruct@Base 6.1.20030421
+ AsnOptionFree@Base 6.1.20030421
+ AsnOptionGet@Base 6.1.20030421
+ AsnOptionNew@Base 6.1.20030421
+ AsnOutAddType@Base 6.1.20030421
+ AsnOutDefineElement@Base 6.1.20030421
+ AsnOutDefineType@Base 6.1.20030421
+ AsnOutFindType@Base 6.1.20030421
+ AsnOutFindValue@Base 6.1.20030421
+ AsnOutNewType@Base 6.1.20030421
+ AsnOutNewValueChain@Base 6.1.20030421
+ AsnOutput@Base 6.1.20030421
+ AsnPrintBigInt@Base 6.1.20030421
+ AsnPrintBoolean@Base 6.1.20030421
+ AsnPrintChar@Base 6.1.20030421
+ AsnPrintCharBlock@Base 6.1.20030421
+ AsnPrintCloseStruct@Base 6.1.20030421
+ AsnPrintGetWordBreak@Base 6.1.20030421
+ AsnPrintIndent@Base 6.1.20030421
+ AsnPrintInteger@Base 6.1.20030421
+ AsnPrintModule@Base 6.1.20030421
+ AsnPrintModuleXML@Base 6.1.20030421
+ AsnPrintModuleXMLInc@Base 6.1.20030421
+ AsnPrintNewLine@Base 6.1.20030421
+ AsnPrintOctets@Base 6.1.20030421
+ AsnPrintOpenStruct@Base 6.1.20030421
+ AsnPrintReal@Base 6.1.20030421
+ AsnPrintStrStore@Base 6.1.20030421
+ AsnPrintStream@Base 6.1.20031028
+ AsnPrintString@Base 6.1.20030421
+ AsnPrintTreeModule@Base 6.1.20030421
+ AsnPrintType@Base 6.1.20030421
+ AsnReadId@Base 6.1.20030421
+ AsnReadVal@Base 6.1.20030421
+ AsnSetTags@Base 6.1.20030421
+ AsnSetXMLmodulePrefix@Base 6.1.20030421
+ AsnSetXMLmodulePrefixToDefault@Base 6.1.20030421
+ AsnSkipValue@Base 6.1.20030421
+ AsnStoreTree@Base 6.1.20030421
+ AsnTreeLoad@Base 6.1.20030421
+ AsnTxtBufWrite@Base 6.1.20030421
+ AsnTxtReadId@Base 6.1.20030421
+ AsnTxtReadVal@Base 6.1.20030421
+ AsnTxtWrite@Base 6.1.20030421
+ AsnTxtWriteEx@Base 6.1.20031028
+ AsnTypeDumpStack@Base 6.1.20030421
+ AsnTypeFind@Base 6.1.20030421
+ AsnTypeFindType@Base 6.1.20030421
+ AsnTypeNew@Base 6.1.20030421
+ AsnTypePathFind@Base 6.1.20030421
+ AsnTypeSetIndent@Base 6.1.20030421
+ AsnTypeStringToHex@Base 6.1.20030421
+ AsnTypeValidateOut@Base 6.1.20030421
+ AsnUnlinkType@Base 6.1.20030421
+ AsnValxNodeNew@Base 6.1.20030421
+ AsnWrite@Base 6.1.20030421
+ AsnWriteChoice@Base 6.1.20030421
+ AsnWriteEx@Base 6.1.20031028
+ BUF_Append@Base 6.1.20050429
+ BUF_AppendEx@Base 6.1.20100808
+ BUF_Destroy@Base 6.1.20030421
+ BUF_Erase@Base 6.1.20050429
+ BUF_Peek@Base 6.1.20030421
+ BUF_PeekAt@Base 6.1.20030421
+ BUF_PeekAtCB@Base 6.1.20070822
+ BUF_Prepend@Base 6.1.20050429
+ BUF_PrependEx@Base 6.1.20100808
+ BUF_Pushback@Base 6.1.20160908
+ BUF_Read@Base 6.1.20030421
+ BUF_SetChunkSize@Base 6.1.20030421
+ BUF_Size@Base 6.1.20030421
+ BUF_Splice@Base 6.1.20160908
+ BUF_StripToPattern@Base 6.1.20030421
+ BUF_Write@Base 6.1.20030421
+ B_DeleteGlobal@Base 6.1.20030421
+ B_Get@Base 6.1.20030421
+ B_GetBag@Base 6.1.20030421
+ B_GetFirst@Base 6.1.20030421
+ B_Insert@Base 6.1.20030421
+ B_NewGlobal@Base 6.1.20030421
+ BreakString@Base 6.1.20030421
+ BytesToUint8@Base 6.1.20030421
+ CONNECT_BASE64_Decode@Base 6.1.20100808
+ CONNECT_BASE64_Encode@Base 6.1.20100808
+ CONNECT_Init@Base 6.1.20030421
+ CONN_Close@Base 6.1.20030421
+ CONN_Create@Base 6.1.20030421
+ CONN_CreateEx@Base 6.1.20110713
+ CONN_Description@Base 6.1.20031028
+ CONN_Flush@Base 6.1.20030421
+ CONN_GetFlags@Base 6.1.20120620
+ CONN_GetPosition@Base 6.1.20110713
+ CONN_GetSOCK@Base 6.1.20120620
+ CONN_GetTimeout@Base 6.1.20030421
+ CONN_GetType@Base 6.1.20030421
+ CONN_GetUserData@Base 6.1.20160908
+ CONN_Pushback@Base 6.1.20160908
+ CONN_ReInit@Base 6.1.20030421
+ CONN_Read@Base 6.1.20030421
+ CONN_ReadLine@Base 6.1.20040616
+ CONN_SetCallback@Base 6.1.20030421
+ CONN_SetFlags@Base 6.1.20120620
+ CONN_SetTimeout@Base 6.1.20030421
+ CONN_SetUserData@Base 6.1.20160908
+ CONN_Status@Base 6.1.20030421
+ CONN_StripToPattern@Base 6.1.20030421
+ CONN_Wait@Base 6.1.20030421
+ CONN_Write@Base 6.1.20030421
+ CORE_GetAppName@Base 6.1.20110713
+ CORE_GetLOCK@Base 6.1.20030421
+ CORE_GetLOG@Base 6.1.20030421
+ CORE_GetNcbiRequestID@Base 6.1.20160908
+ CORE_GetPlatform@Base 6.1.20030421
+ CORE_GetREG@Base 6.1.20030421
+ CORE_GetUsername@Base 6.1.20061015
+ CORE_GetUsernameEx@Base 6.1.20160908
+ CORE_GetVMPageSize@Base 6.1.20061015
+ CORE_SendMail@Base 6.1.20030421
+ CORE_SendMailEx@Base 6.1.20030421
+ CORE_SetLOCK@Base 6.1.20030421
+ CORE_SetLOG@Base 6.1.20030421
+ CORE_SetLOGFILE@Base 6.1.20030421
+ CORE_SetLOGFILE_Ex@Base 6.1.20070822
+ CORE_SetLOGFILE_NAME@Base 6.1.20030421
+ CORE_SetLOGFILE_NAME_Ex@Base 6.1.20070822
+ CORE_SetLOGFormatFlags@Base 6.1.20030421
+ CORE_SetREG@Base 6.1.20030421
+ CleanSpaces@Base 6.1.20030421
+ ConnNetInfo_AppendArg@Base 6.1.20030421
+ ConnNetInfo_AppendUserHeader@Base 6.1.20030421
+ ConnNetInfo_Boolean@Base 6.1.20100808
+ ConnNetInfo_Clone@Base 6.1.20030421
+ ConnNetInfo_Create@Base 6.1.20030421
+ ConnNetInfo_DeleteAllArgs@Base 6.1.20060301
+ ConnNetInfo_DeleteArg@Base 6.1.20030421
+ ConnNetInfo_DeleteUserHeader@Base 6.1.20030421
+ ConnNetInfo_Destroy@Base 6.1.20030421
+ ConnNetInfo_ExtendUserHeader@Base 6.1.20030421
+ ConnNetInfo_GetValue@Base 6.1.20060507
+ ConnNetInfo_Log@Base 6.1.20160908
+ ConnNetInfo_OverrideUserHeader@Base 6.1.20030421
+ ConnNetInfo_ParseURL@Base 6.1.20030421
+ ConnNetInfo_PostOverrideArg@Base 6.1.20030421
+ ConnNetInfo_PreOverrideArg@Base 6.1.20030421
+ ConnNetInfo_PrependArg@Base 6.1.20030421
+ ConnNetInfo_SetTimeout@Base 6.1.20110713
+ ConnNetInfo_SetUserHeader@Base 6.1.20030421
+ ConnNetInfo_SetupStandardArgs@Base 6.1.20060301
+ ConnNetInfo_URL@Base 6.1.20100808
+ CountChar@Base 6.1.20030421
+ CountSet@Base 6.1.20030421
+ CountStrings@Base 6.1.20030421
+ CreateAsnConn@Base 6.1.20030421
+ CreateAsnConn_Service@Base 6.1.20030421
+ CreateAsnConn_ServiceEx@Base 6.1.20030421
+ DSOCK_Bind@Base 6.1.20031028
+ DSOCK_Connect@Base 6.1.20031028
+ DSOCK_Create@Base 6.1.20030421
+ DSOCK_CreateEx@Base 6.1.20030421
+ DSOCK_GetMessageCount@Base 6.1.20110713
+ DSOCK_RecvMsg@Base 6.1.20030421
+ DSOCK_SendMsg@Base 6.1.20030421
+ DSOCK_SetBroadcast@Base 6.1.20030421
+ DSOCK_WaitMsg@Base 6.1.20030421
+ DSOCK_WipeMsg@Base 6.1.20030421
+ DecodeXml@Base 6.1.20120620
+ DeleteChar@Base 6.1.20030421
+ EncodeXml@Base 6.1.20120620
+ EncodeXmlEx@Base 6.1.20160908
+ ErrClearOptFlags@Base 6.1.20030421
+ ErrGetExplanation@Base 6.1.20030421
+ ErrGetFatalLevel@Base 6.1.20030421
+ ErrGetLogLevel@Base 6.1.20030421
+ ErrGetMessageLevel@Base 6.1.20030421
+ ErrGetMsgRoot@Base 6.1.20030421
+ ErrRestoreOptions@Base 6.1.20030421
+ ErrSaveOptions@Base 6.1.20030421
+ ErrSetFatalLevel@Base 6.1.20030421
+ ErrSetLogLevel@Base 6.1.20030421
+ ErrSetMessageLevel@Base 6.1.20030421
+ ErrSetOptFlags@Base 6.1.20030421
+ ErrTestOptFlags@Base 6.1.20030421
+ FILE_CreateConnector@Base 6.1.20030421
+ FILE_CreateConnectorEx@Base 6.1.20030421
+ FTP_CreateConnector@Base 6.1.20100808
+ FTP_CreateConnectorSimple@Base 6.1.20110713
+ FreeXmlObject@Base 6.1.20110713
+ GetAppParamBoolean@Base 6.1.20030421
+ GetAppParamLong@Base 6.1.20030421
+ HEAP_AddRef@Base 6.1.20060507
+ HEAP_Alloc@Base 6.1.20030421
+ HEAP_Attach@Base 6.1.20030421
+ HEAP_AttachFast@Base 6.1.20070822
+ HEAP_Base@Base 6.1.20030421
+ HEAP_Copy@Base 6.1.20060507
+ HEAP_Create@Base 6.1.20030421
+ HEAP_Destroy@Base 6.1.20030421
+ HEAP_Detach@Base 6.1.20030421
+ HEAP_Free@Base 6.1.20030421
+ HEAP_FreeFast@Base 6.1.20070822
+ HEAP_Next@Base 6.1.20160908
+ HEAP_Options@Base 6.1.20070822
+ HEAP_Serial@Base 6.1.20030421
+ HEAP_Size@Base 6.1.20030421
+ HEAP_Trim@Base 6.1.20031028
+ HEAP_Walk@Base 6.1.20030421
+ HINFO_AffinityArgument@Base 6.1.20060507
+ HINFO_AffinityArgvalue@Base 6.1.20060507
+ HINFO_CpuClock@Base 6.1.20081116
+ HINFO_CpuCount@Base 6.1.20030421
+ HINFO_CpuUnits@Base 6.1.20081116
+ HINFO_Create@Base 6.1.20030421
+ HINFO_Environment@Base 6.1.20030421
+ HINFO_HostAddr@Base 6.1.20081116
+ HINFO_LoadAverage@Base 6.1.20030421
+ HINFO_MachineParams@Base 6.1.20090301
+ HINFO_Memusage@Base 6.1.20081116
+ HINFO_Status@Base 6.1.20030421
+ HINFO_TaskCount@Base 6.1.20030421
+ HTTP_CreateConnector@Base 6.1.20030421
+ HTTP_CreateConnectorEx@Base 6.1.20030421
+ HTTP_CreateTunnel@Base 6.1.20110713
+ HTTP_CreateTunnelEx@Base 6.1.20110713
+ HTTP_SetNcbiMessageHook@Base 6.1.20060301
+ IO_StatusStr@Base 6.1.20030421
+ LBOS_Announce@Base 6.1.20160908
+ LBOS_AnnounceFromRegistry@Base 6.1.20160908
+ LBOS_Deannounce@Base 6.1.20160908
+ LBOS_DeannounceAll@Base 6.1.20160908
+ LBOS_ServiceVersionDelete@Base 6.1.20160908
+ LBOS_ServiceVersionGet@Base 6.1.20160908
+ LBOS_ServiceVersionSet@Base 6.1.20160908
+ LBSMD_FastHeapAccess@Base 6.1.20070822
+ LBSMD_GetConfig@Base 6.1.20050605
+ LBSMD_GetHeapCopy@Base 6.1.20060507
+ LBSMD_GetHostParameter@Base 6.1.20090301
+ LBSMD_GetLocalHostAddress@Base 6.1.20160908
+ LBSM_HINFO_CpuClock@Base 6.1.20081116
+ LBSM_HINFO_CpuCount@Base 6.1.20030421
+ LBSM_HINFO_CpuUnits@Base 6.1.20081116
+ LBSM_HINFO_LoadAverage@Base 6.1.20030421
+ LBSM_HINFO_MachineParams@Base 6.1.20090301
+ LBSM_HINFO_Memusage@Base 6.1.20081116
+ LBSM_HINFO_Status@Base 6.1.20030421
+ LBSM_HINFO_TaskCount@Base 6.1.20030421
+ LB_Select@Base 6.1.20060301
+ LOG_AddRef@Base 6.1.20030421
+ LOG_ComposeMessage@Base 6.1.20030421
+ LOG_Create@Base 6.1.20030421
+ LOG_Delete@Base 6.1.20030421
+ LOG_LevelStr@Base 6.1.20030421
+ LOG_Reset@Base 6.1.20030421
+ LOG_ToFILE@Base 6.1.20030421
+ LOG_ToFILE_Ex@Base 6.1.20070822
+ LOG_Write@Base 6.1.20090301
+ LOG_WriteInternal@Base 6.1.20030421
+ LOG_c2c@Base 6.1.20030421
+ LSOCK_Accept@Base 6.1.20030421
+ LSOCK_AcceptEx@Base 6.1.20081116
+ LSOCK_Close@Base 6.1.20030421
+ LSOCK_Create@Base 6.1.20030421
+ LSOCK_CreateEx@Base 6.1.20030421
+ LSOCK_CreateUNIX@Base 6.1.20050429
+ LSOCK_GetOSHandle@Base 6.1.20030421
+ LSOCK_GetOSHandleEx@Base 6.1.20120620
+ LSOCK_GetPort@Base 6.1.20110713
+ ListBreakRing@Base 6.1.20030421
+ ListConnectRing@Base 6.1.20030421
+ ListDelete@Base 6.1.20030421
+ ListGetNext@Base 6.1.20030421
+ ListInsert@Base 6.1.20030421
+ ListInsertPrev@Base 6.1.20030421
+ ListSort@Base 6.1.20030421
+ ListStrCopy@Base 6.1.20030421
+ ListStrDel@Base 6.1.20030421
+ ListSwapAdj@Base 6.1.20030421
+ MEMORY_CreateConnector@Base 6.1.20030421
+ MEMORY_CreateConnectorEx@Base 6.1.20050429
+ METACONN_Insert@Base 6.1.20170106
+ METACONN_Remove@Base 6.1.20030421
+ MIME_ComposeContentTypeEx@Base 6.1.20030421
+ MIME_ParseContentTypeEx@Base 6.1.20030421
+ MT_LOCK_AddRef@Base 6.1.20030421
+ MT_LOCK_Create@Base 6.1.20030421
+ MT_LOCK_Delete@Base 6.1.20030421
+ MT_LOCK_DoInternal@Base 6.1.20030421
+ MT_LOCK_c2c@Base 6.1.20030421
+ MergeStringArray@Base 6.1.20120620
+ NCBISM_Blosum45@Base 6.1.20031028
+ NCBISM_Blosum50@Base 6.1.20061015
+ NCBISM_Blosum62@Base 6.1.20031028
+ NCBISM_Blosum80@Base 6.1.20031028
+ NCBISM_Blosum90@Base 6.1.20061015
+ NCBISM_GetIndex@Base 6.1.20031028
+ NCBISM_GetScore@Base 6.1.20031028
+ NCBISM_GetStandardMatrix@Base 6.1.20081116
+ NCBISM_Identity@Base 6.1.20160908
+ NCBISM_Pam250@Base 6.1.20040204
+ NCBISM_Pam30@Base 6.1.20031028
+ NCBISM_Pam70@Base 6.1.20031028
+ NCBISM_Unpack@Base 6.1.20031028
+ NCBI_memcchr@Base 6.1.20170106
+ NCBI_simple_atof@Base 6.1.20160908
+ NCBI_simple_ftoa@Base 6.1.20160908
+ NCBI_strlwr@Base 6.1.20030421
+ NCBI_strupr@Base 6.1.20030421
+ NcbiAddrToDNS@Base 6.1.20170106
+ NcbiAddrToString@Base 6.1.20170106
+ NcbiIPToAddr@Base 6.1.20170106
+ NcbiIPv4ToIPv6@Base 6.1.20170106
+ NcbiIPv4ToString@Base 6.1.20170106
+ NcbiIPv6ToIPv4@Base 6.1.20170106
+ NcbiIPv6ToString@Base 6.1.20170106
+ NcbiIsEmptyIPv6@Base 6.1.20170106
+ NcbiIsIPv4@Base 6.1.20170106
+ NcbiIsInIPv6Network@Base 6.1.20170106
+ NcbiMessagePlusError@Base 6.1.20081116
+ NcbiMsToTimeout@Base 6.1.20070822
+ NcbiStringToAddr@Base 6.1.20170106
+ NcbiStringToIPv4@Base 6.1.20170106
+ NcbiStringToIPv6@Base 6.1.20170106
+ NcbiTimeoutToMs@Base 6.1.20070822
+ NlmCPUNumber@Base 6.1.20030421
+ NlmMutexDestroy@Base 6.1.20030421
+ NlmMutexInit@Base 6.1.20030421
+ NlmMutexLock@Base 6.1.20030421
+ NlmMutexLockEx@Base 6.1.20030421
+ NlmMutexTryLock@Base 6.1.20030421
+ NlmMutexTryLockEx@Base 6.1.20030421
+ NlmMutexUnlock@Base 6.1.20030421
+ NlmRWdestroy@Base 6.1.20030421
+ NlmRWinit@Base 6.1.20030421
+ NlmRWprintout@Base 6.1.20030421
+ NlmRWrdlockEx@Base 6.1.20030421
+ NlmRWtryrdlockEx@Base 6.1.20030421
+ NlmRWtrywrlockEx@Base 6.1.20030421
+ NlmRWunlockEx@Base 6.1.20030421
+ NlmRWwrlockEx@Base 6.1.20030421
+ NlmSemaDestroy@Base 6.1.20030421
+ NlmSemaInit@Base 6.1.20030421
+ NlmSemaPost@Base 6.1.20030421
+ NlmSemaTryWait@Base 6.1.20030421
+ NlmSemaWait@Base 6.1.20030421
+ NlmThreadAddOnExit@Base 6.1.20030421
+ NlmThreadCompare@Base 6.1.20030421
+ NlmThreadCreate@Base 6.1.20030421
+ NlmThreadCreateEx@Base 6.1.20030421
+ NlmThreadDestroyAll@Base 6.1.20030421
+ NlmThreadExit@Base 6.1.20030421
+ NlmThreadJoin@Base 6.1.20030421
+ NlmThreadJoinAll@Base 6.1.20030421
+ NlmThreadMemFree@Base 6.1.20030421
+ NlmThreadRemoveOnExit@Base 6.1.20030421
+ NlmThreadSelf@Base 6.1.20030421
+ NlmThreadsAvailable@Base 6.1.20030421
+ NlmTlsGetValue@Base 6.1.20030421
+ NlmTlsSetValue@Base 6.1.20030421
+ Nlm_AbnormalExit@Base 6.1.20030421
+ Nlm_AbnormalExitPure@Base 6.1.20030421
+ Nlm_AssertionFailed@Base 6.1.20030421
+ Nlm_BSAdd@Base 6.1.20030421
+ Nlm_BSDelete@Base 6.1.20030421
+ Nlm_BSDup@Base 6.1.20030421
+ Nlm_BSDupAndSwapUint4@Base 6.1.20030421
+ Nlm_BSEqual@Base 6.1.20090301
+ Nlm_BSFree@Base 6.1.20030421
+ Nlm_BSGetByte@Base 6.1.20030421
+ Nlm_BSGetUint2@Base 6.1.20030421
+ Nlm_BSGetUint4@Base 6.1.20030421
+ Nlm_BSInsert@Base 6.1.20030421
+ Nlm_BSInsertFromBS@Base 6.1.20030421
+ Nlm_BSLen@Base 6.1.20030421
+ Nlm_BSMerge@Base 6.1.20030421
+ Nlm_BSNew@Base 6.1.20030421
+ Nlm_BSPutByte@Base 6.1.20030421
+ Nlm_BSPutUint2@Base 6.1.20030421
+ Nlm_BSPutUint4@Base 6.1.20030421
+ Nlm_BSRead@Base 6.1.20030421
+ Nlm_BSSeek@Base 6.1.20030421
+ Nlm_BSTell@Base 6.1.20030421
+ Nlm_BSUint2Read@Base 6.1.20030421
+ Nlm_BSUint2Write@Base 6.1.20030421
+ Nlm_BSUint4Read@Base 6.1.20030421
+ Nlm_BSUint4Write@Base 6.1.20030421
+ Nlm_BSWrite@Base 6.1.20030421
+ Nlm_Beep@Base 6.1.20030421
+ Nlm_CPUTimeFree@Base 6.1.20030421
+ Nlm_CPUTimeGetSys@Base 6.1.20030421
+ Nlm_CPUTimeGetUser@Base 6.1.20030421
+ Nlm_CPUTimeMeasure@Base 6.1.20030421
+ Nlm_CacheAppParam@Base 6.1.20030421
+ Nlm_CallErrHandlerOnly@Base 6.1.20030421
+ Nlm_CallocViaMalloc@Base 6.1.20030421
+ Nlm_CompressSpaces@Base 6.1.20110713
+ Nlm_CreateDir@Base 6.1.20030421
+ Nlm_DayTimeStr@Base 6.1.20030421
+ Nlm_DiGamma@Base 6.1.20030421
+ Nlm_DirCatalog@Base 6.1.20030421
+ Nlm_DirExplore@Base 6.1.20070822
+ Nlm_EnumAppProperties@Base 6.1.20030421
+ Nlm_ErrClear@Base 6.1.20030421
+ Nlm_ErrCopy@Base 6.1.20030421
+ Nlm_ErrFetch@Base 6.1.20030421
+ Nlm_ErrGetLogfile@Base 6.1.20030421
+ Nlm_ErrGetOpts@Base 6.1.20030421
+ Nlm_ErrGetUserStrings@Base 6.1.20030421
+ Nlm_ErrLogPrintStr@Base 6.1.20030421
+ Nlm_ErrLogPrintf@Base 6.1.20030421
+ Nlm_ErrPathReset@Base 6.1.20030421
+ Nlm_ErrPost@Base 6.1.20030421
+ Nlm_ErrPostEx@Base 6.1.20030421
+ Nlm_ErrPostStr@Base 6.1.20030421
+ Nlm_ErrSetContext@Base 6.1.20030421
+ Nlm_ErrSetHandler@Base 6.1.20030421
+ Nlm_ErrSetLogfile@Base 6.1.20030421
+ Nlm_ErrSetOpts@Base 6.1.20030421
+ Nlm_ErrShow@Base 6.1.20030421
+ Nlm_ErrUserClear@Base 6.1.20030421
+ Nlm_ErrUserDelete@Base 6.1.20030421
+ Nlm_ErrUserInstall@Base 6.1.20030421
+ Nlm_Expm1@Base 6.1.20030421
+ Nlm_Factorial@Base 6.1.20030421
+ Nlm_FileBuildPath@Base 6.1.20030421
+ Nlm_FileCacheFree@Base 6.1.20040616
+ Nlm_FileCacheGetString@Base 6.1.20040616
+ Nlm_FileCacheReadLine@Base 6.1.20040616
+ Nlm_FileCacheSeek@Base 6.1.20040616
+ Nlm_FileCacheSetup@Base 6.1.20040616
+ Nlm_FileCacheTell@Base 6.1.20040616
+ Nlm_FileClose@Base 6.1.20030421
+ Nlm_FileCreate@Base 6.1.20030421
+ Nlm_FileGets@Base 6.1.20030421
+ Nlm_FileLength@Base 6.1.20030421
+ Nlm_FileLengthEx@Base 6.1.20030421
+ Nlm_FileNameFind@Base 6.1.20030421
+ Nlm_FileOpen@Base 6.1.20030421
+ Nlm_FilePathFind@Base 6.1.20030421
+ Nlm_FilePuts@Base 6.1.20030421
+ Nlm_FileRead@Base 6.1.20030421
+ Nlm_FileRemove@Base 6.1.20030421
+ Nlm_FileRename@Base 6.1.20030421
+ Nlm_FileWrite@Base 6.1.20030421
+ Nlm_FindPath@Base 6.1.20030421
+ Nlm_FlushAppParam@Base 6.1.20030421
+ Nlm_FreeArgs@Base 6.1.20030421
+ Nlm_FreeCmdLineArguments@Base 6.1.20030421
+ Nlm_FreeConfigStruct@Base 6.1.20030421
+ Nlm_Gamma@Base 6.1.20030421
+ Nlm_GammaCoeffSet@Base 6.1.20030421
+ Nlm_Gcd@Base 6.1.20030421
+ Nlm_GetAppParam@Base 6.1.20030421
+ Nlm_GetAppProcessID@Base 6.1.20030421
+ Nlm_GetAppProperty@Base 6.1.20030421
+ Nlm_GetArgc@Base 6.1.20030421
+ Nlm_GetArgs@Base 6.1.20030421
+ Nlm_GetArgsSilent@Base 6.1.20030421
+ Nlm_GetArgv@Base 6.1.20030421
+ Nlm_GetChecksum@Base 6.1.20030421
+ Nlm_GetDayTime@Base 6.1.20030421
+ Nlm_GetElapsedTime@Base 6.1.20030421
+ Nlm_GetEnvParam@Base 6.1.20030421
+ Nlm_GetEnvParamEx@Base 6.1.20030421
+ Nlm_GetErrLongText@Base 6.1.20030421
+ Nlm_GetLanguage@Base 6.1.20030421
+ Nlm_GetOpSysString@Base 6.1.20030421
+ Nlm_GetScratchBuffer@Base 6.1.20030421
+ Nlm_GetSecs@Base 6.1.20030421
+ Nlm_HeapSort@Base 6.1.20030421
+ Nlm_InitAppContext@Base 6.1.20030421
+ Nlm_Int8ToString@Base 6.1.20030421
+ Nlm_Int8tostr@Base 6.1.20030421
+ Nlm_LabelCopy@Base 6.1.20030421
+ Nlm_LabelCopyExtra@Base 6.1.20030421
+ Nlm_LabelCopyNext@Base 6.1.20030421
+ Nlm_LetterByte@Base 6.1.20030421
+ Nlm_LnFactorial@Base 6.1.20030421
+ Nlm_LnGamma@Base 6.1.20030421
+ Nlm_LnGammaInt@Base 6.1.20030421
+ Nlm_Log1p@Base 6.1.20030421
+ Nlm_LogDerivative@Base 6.1.20030421
+ Nlm_Ltostr@Base 6.1.20030421
+ Nlm_Lwidth@Base 6.1.20030421
+ Nlm_MD5Final@Base 6.1.20030421
+ Nlm_MD5Init@Base 6.1.20030421
+ Nlm_MD5Transform@Base 6.1.20030421
+ Nlm_MD5Update@Base 6.1.20030421
+ Nlm_MatrixColumn@Base 6.1.20030421
+ Nlm_MatrixCompare@Base 6.1.20030421
+ Nlm_MatrixCopy@Base 6.1.20030421
+ Nlm_MatrixDelete@Base 6.1.20030421
+ Nlm_MatrixInvert@Base 6.1.20030421
+ Nlm_MatrixMultiply@Base 6.1.20030421
+ Nlm_MatrixNew@Base 6.1.20030421
+ Nlm_MatrixNode@Base 6.1.20030421
+ Nlm_MatrixPrint@Base 6.1.20030421
+ Nlm_MatrixRow@Base 6.1.20030421
+ Nlm_MatrixSetColumn@Base 6.1.20030421
+ Nlm_MatrixSetNode@Base 6.1.20030421
+ Nlm_MatrixSetRow@Base 6.1.20030421
+ Nlm_MatrixSolve@Base 6.1.20030421
+ Nlm_MatrixTranspose@Base 6.1.20030421
+ Nlm_MemCopy@Base 6.1.20030421
+ Nlm_MemDup@Base 6.1.20030421
+ Nlm_MemExtend@Base 6.1.20030421
+ Nlm_MemFill@Base 6.1.20030421
+ Nlm_MemFree@Base 6.1.20030421
+ Nlm_MemGet@Base 6.1.20030421
+ Nlm_MemMapAdvise@Base 6.1.20030421
+ Nlm_MemMapAdvisePtr@Base 6.1.20030421
+ Nlm_MemMapAvailable@Base 6.1.20030421
+ Nlm_MemMapFini@Base 6.1.20030421
+ Nlm_MemMapInit@Base 6.1.20030421
+ Nlm_MemMore@Base 6.1.20030421
+ Nlm_MemMove@Base 6.1.20030421
+ Nlm_MemNew@Base 6.1.20030421
+ Nlm_MemSearch@Base 6.1.20030421
+ Nlm_MeshStringICmp@Base 6.1.20030421
+ Nlm_Message@Base 6.1.20030421
+ Nlm_MonitorFree@Base 6.1.20030421
+ Nlm_MonitorIntNewEx@Base 6.1.20030421
+ Nlm_MonitorIntValue@Base 6.1.20030421
+ Nlm_MonitorStrNewEx@Base 6.1.20030421
+ Nlm_MonitorStrValue@Base 6.1.20030421
+ Nlm_MsgAlert@Base 6.1.20030421
+ Nlm_MsgAlertStr@Base 6.1.20030421
+ Nlm_NRBis@Base 6.1.20030421
+ Nlm_NaturalStringCmp@Base 6.1.20120620
+ Nlm_NaturalStringICmp@Base 6.1.20120620
+ Nlm_Nint@Base 6.1.20030421
+ Nlm_ParseCmdLineArguments@Base 6.1.20030421
+ Nlm_PlatformName@Base 6.1.20030421
+ Nlm_PolyGamma@Base 6.1.20030421
+ Nlm_Powi@Base 6.1.20030421
+ Nlm_ProgMon@Base 6.1.20030421
+ Nlm_ProgramPath@Base 6.1.20030421
+ Nlm_RandomNum@Base 6.1.20030421
+ Nlm_RandomSeed@Base 6.1.20030421
+ Nlm_ReleaseAppContext@Base 6.1.20030421
+ Nlm_RemoveAppProperty@Base 6.1.20030421
+ Nlm_RombergIntegrate@Base 6.1.20030421
+ Nlm_SearchSubString@Base 6.1.20100808
+ Nlm_SetAppParam@Base 6.1.20030421
+ Nlm_SetAppProperty@Base 6.1.20030421
+ Nlm_SetBeepHook@Base 6.1.20030421
+ Nlm_SetFileOpenHook@Base 6.1.20030421
+ Nlm_SetHeapLimit@Base 6.1.20030421
+ Nlm_SetMemFailFlag@Base 6.1.20160908
+ Nlm_SetMessageHook@Base 6.1.20030421
+ Nlm_SetMonitorHook@Base 6.1.20030421
+ Nlm_SetProgMon@Base 6.1.20030421
+ Nlm_SetupArguments@Base 6.1.20030421
+ Nlm_SetupSubString@Base 6.1.20100808
+ Nlm_Sgml2Ascii@Base 6.1.20030421
+ Nlm_Sgml2AsciiLen@Base 6.1.20030421
+ Nlm_SgmlLoadTable@Base 6.1.20030421
+ Nlm_StableMergeSort@Base 6.1.20110713
+ Nlm_StdProgMon@Base 6.1.20030421
+ Nlm_StopWatchFree@Base 6.1.20030421
+ Nlm_StopWatchNew@Base 6.1.20030421
+ Nlm_StopWatchStart@Base 6.1.20030421
+ Nlm_StopWatchStop@Base 6.1.20030421
+ Nlm_StrCnt@Base 6.1.20030421
+ Nlm_StrICmp@Base 6.1.20030421
+ Nlm_StrIPCmp@Base 6.1.20030421
+ Nlm_StrLower@Base 6.1.20030421
+ Nlm_StrMove@Base 6.1.20030421
+ Nlm_StrNICmp@Base 6.1.20030421
+ Nlm_StrNIPCmp@Base 6.1.20030421
+ Nlm_StrSave@Base 6.1.20030421
+ Nlm_StrUpper@Base 6.1.20030421
+ Nlm_StringCSpn@Base 6.1.20030421
+ Nlm_StringCat@Base 6.1.20030421
+ Nlm_StringChr@Base 6.1.20030421
+ Nlm_StringCmp@Base 6.1.20030421
+ Nlm_StringCnt@Base 6.1.20030421
+ Nlm_StringCpy@Base 6.1.20030421
+ Nlm_StringDoesHaveText@Base 6.1.20031028
+ Nlm_StringHasNoText@Base 6.1.20030421
+ Nlm_StringICmp@Base 6.1.20030421
+ Nlm_StringISearch@Base 6.1.20030421
+ Nlm_StringIsAllDigits@Base 6.1.20120620
+ Nlm_StringIsAllLowerCase@Base 6.1.20120620
+ Nlm_StringIsAllPunctuation@Base 6.1.20120620
+ Nlm_StringIsAllUpperCase@Base 6.1.20120620
+ Nlm_StringLen@Base 6.1.20030421
+ Nlm_StringLower@Base 6.1.20030421
+ Nlm_StringMove@Base 6.1.20030421
+ Nlm_StringNCat@Base 6.1.20030421
+ Nlm_StringNCmp@Base 6.1.20030421
+ Nlm_StringNCpy@Base 6.1.20030421
+ Nlm_StringNCpy_0@Base 6.1.20030421
+ Nlm_StringNICmp@Base 6.1.20030421
+ Nlm_StringPBrk@Base 6.1.20030421
+ Nlm_StringPrintable@Base 6.1.20030421
+ Nlm_StringRChr@Base 6.1.20030421
+ Nlm_StringSave@Base 6.1.20030421
+ Nlm_StringSaveNoNull@Base 6.1.20030421
+ Nlm_StringSearch@Base 6.1.20030421
+ Nlm_StringSpn@Base 6.1.20030421
+ Nlm_StringStr@Base 6.1.20030421
+ Nlm_StringToInt8@Base 6.1.20030421
+ Nlm_StringToUint8@Base 6.1.20030421
+ Nlm_StringTok@Base 6.1.20030421
+ Nlm_StringTokMT@Base 6.1.20030421
+ Nlm_StringUpper@Base 6.1.20030421
+ Nlm_SwitchLong@Base 6.1.20030421
+ Nlm_SwitchLongBuff@Base 6.1.20030421
+ Nlm_SwitchUint2@Base 6.1.20030421
+ Nlm_SwitchUint2Buff@Base 6.1.20030421
+ Nlm_SwitchUint4@Base 6.1.20030421
+ Nlm_SwitchUint4Buff@Base 6.1.20030421
+ Nlm_TSPrintf@Base 6.1.20030421
+ Nlm_TSPrintfArgs@Base 6.1.20030421
+ Nlm_TmpNam@Base 6.1.20030421
+ Nlm_Trace@Base 6.1.20030421
+ Nlm_TraceStr@Base 6.1.20030421
+ Nlm_TransientSetAppParam@Base 6.1.20030421
+ Nlm_TriGamma@Base 6.1.20030421
+ Nlm_TrimSpacesAroundString@Base 6.1.20030421
+ Nlm_Uint8ToString@Base 6.1.20030421
+ Nlm_Ultostr@Base 6.1.20030421
+ Nlm_Ulwidth@Base 6.1.20030421
+ Nlm_rule_line@Base 6.1.20030421
+ Nlm_stream2text@Base 6.1.20030421
+ Nlm_text2stream@Base 6.1.20030421
+ NoCaseSkipPastString@Base 6.1.20030421
+ NoCaseSkipToString@Base 6.1.20030421
+ NodeListAppend@Base 6.1.20030421
+ NodeListDelete@Base 6.1.20030421
+ NodeListFind@Base 6.1.20030421
+ NodeListFree@Base 6.1.20030421
+ NodeListInsert@Base 6.1.20030421
+ NodeListLen@Base 6.1.20030421
+ NodeListNew@Base 6.1.20030421
+ NodeListRead@Base 6.1.20030421
+ NodeListReplace@Base 6.1.20030421
+ NodeListWrite@Base 6.1.20030421
+ POLLABLE_FromLSOCK@Base 6.1.20031028
+ POLLABLE_FromSOCK@Base 6.1.20031028
+ POLLABLE_FromTRIGGER@Base 6.1.20070822
+ POLLABLE_Poll@Base 6.1.20031028
+ POLLABLE_ToLSOCK@Base 6.1.20031028
+ POLLABLE_ToSOCK@Base 6.1.20031028
+ POLLABLE_ToTRIGGER@Base 6.1.20070822
+ ParseXmlString@Base 6.1.20110713
+ QUERY_AddToQueue@Base 6.1.20030421
+ QUERY_AsnIoConnClose@Base 6.1.20030421
+ QUERY_AsnIoConnOpen@Base 6.1.20030421
+ QUERY_CheckQueue@Base 6.1.20030421
+ QUERY_CloseQueue@Base 6.1.20030421
+ QUERY_CopyFileToQuery@Base 6.1.20030421
+ QUERY_CopyResultsToFile@Base 6.1.20030421
+ QUERY_CopyResultsToString@Base 6.1.20110713
+ QUERY_OpenServiceQuery@Base 6.1.20030421
+ QUERY_OpenServiceQueryEx@Base 6.1.20060507
+ QUERY_OpenUrlQuery@Base 6.1.20030421
+ QUERY_QueueSize@Base 6.1.20100808
+ QUERY_SendQuery@Base 6.1.20030421
+ QUERY_UrlAsynchronousQuery@Base 6.1.20110713
+ QUERY_UrlSynchronousQuery@Base 6.1.20110713
+ REG_AddRef@Base 6.1.20030421
+ REG_Create@Base 6.1.20030421
+ REG_Delete@Base 6.1.20030421
+ REG_Get@Base 6.1.20030421
+ REG_Reset@Base 6.1.20030421
+ REG_Set@Base 6.1.20030421
+ REG_c2c@Base 6.1.20030421
+ ReleaseAppErrInfo@Base 6.1.20030421
+ ReleaseAppMsgInfo@Base 6.1.20030421
+ SERVICE_CreateConnectorEx@Base 6.1.20030421
+ SERV_AddFirewallPort@Base 6.1.20120620
+ SERV_Close@Base 6.1.20030421
+ SERV_CopyInfo@Base 6.1.20060301
+ SERV_CopyInfoEx@Base 6.1.20060301
+ SERV_CreateDnsInfo@Base 6.1.20030421
+ SERV_CreateDnsInfoEx@Base 6.1.20050828
+ SERV_CreateFirewallInfo@Base 6.1.20030421
+ SERV_CreateFirewallInfoEx@Base 6.1.20050828
+ SERV_CreateHttpInfo@Base 6.1.20030421
+ SERV_CreateHttpInfoEx@Base 6.1.20050828
+ SERV_CreateNcbidInfo@Base 6.1.20030421
+ SERV_CreateNcbidInfoEx@Base 6.1.20050828
+ SERV_CreateStandaloneInfo@Base 6.1.20030421
+ SERV_CreateStandaloneInfoEx@Base 6.1.20050828
+ SERV_CurrentName@Base 6.1.20050828
+ SERV_DISPD_Open@Base 6.1.20030421
+ SERV_DoFastOpens@Base 6.1.20070822
+ SERV_EqualInfo@Base 6.1.20030421
+ SERV_GetInfo@Base 6.1.20050828
+ SERV_GetInfoEx@Base 6.1.20030421
+ SERV_GetInfoP@Base 6.1.20030421
+ SERV_GetInfoSimple@Base 6.1.20160908
+ SERV_GetNextInfo@Base 6.1.20050828
+ SERV_GetNextInfoEx@Base 6.1.20030421
+ SERV_InitFirewallPorts@Base 6.1.20160908
+ SERV_IsFirewallPort@Base 6.1.20120620
+ SERV_LBOS_Open@Base 6.1.20160908
+ SERV_LBSMD_Open@Base 6.1.20030421
+ SERV_LOCAL_Open@Base 6.1.20060507
+ SERV_MapperName@Base 6.1.20030421
+ SERV_NameOfInfo@Base 6.1.20060301
+ SERV_Open@Base 6.1.20050828
+ SERV_OpenEx@Base 6.1.20030421
+ SERV_OpenP@Base 6.1.20031028
+ SERV_OpenSimple@Base 6.1.20030421
+ SERV_Penalize@Base 6.1.20030421
+ SERV_PenalizeEx@Base 6.1.20120620
+ SERV_Print@Base 6.1.20030421
+ SERV_PrintFirewallPorts@Base 6.1.20160908
+ SERV_ReadInfo@Base 6.1.20030421
+ SERV_ReadInfoEx@Base 6.1.20050828
+ SERV_ReadType@Base 6.1.20030421
+ SERV_Rerate@Base 6.1.20090301
+ SERV_Reset@Base 6.1.20030421
+ SERV_ServerPort@Base 6.1.20090301
+ SERV_ServiceName@Base 6.1.20030421
+ SERV_SizeOfInfo@Base 6.1.20030421
+ SERV_TypeStr@Base 6.1.20030421
+ SERV_Update@Base 6.1.20030421
+ SERV_WriteInfo@Base 6.1.20030421
+ SOCK_Abort@Base 6.1.20031028
+ SOCK_AllowSigPipeAPI@Base 6.1.20030421
+ SOCK_Close@Base 6.1.20030421
+ SOCK_CloseEx@Base 6.1.20040204
+ SOCK_CloseOSHandle@Base 6.1.20120620
+ SOCK_Create@Base 6.1.20030421
+ SOCK_CreateConnector@Base 6.1.20030421
+ SOCK_CreateConnectorEx@Base 6.1.20030421
+ SOCK_CreateConnectorOnTop@Base 6.1.20030421
+ SOCK_CreateConnectorOnTopEx@Base 6.1.20110713
+ SOCK_CreateEx@Base 6.1.20030421
+ SOCK_CreateInternal@Base 6.1.20160908
+ SOCK_CreateOnTop@Base 6.1.20030421
+ SOCK_CreateOnTopEx@Base 6.1.20031028
+ SOCK_CreateOnTopInternal@Base 6.1.20160908
+ SOCK_CreateUNIX@Base 6.1.20050429
+ SOCK_DisableOSSendDelay@Base 6.1.20050429
+ SOCK_GetCount@Base 6.1.20110713
+ SOCK_GetLocalHostAddress@Base 6.1.20070822
+ SOCK_GetLocalPort@Base 6.1.20080302
+ SOCK_GetLocalPortEx@Base 6.1.20100808
+ SOCK_GetLoopbackAddress@Base 6.1.20050828
+ SOCK_GetOSHandle@Base 6.1.20030421
+ SOCK_GetOSHandleEx@Base 6.1.20120620
+ SOCK_GetPeerAddress@Base 6.1.20030421
+ SOCK_GetPeerAddressString@Base 6.1.20031028
+ SOCK_GetPeerAddressStringEx@Base 6.1.20090719
+ SOCK_GetPosition@Base 6.1.20110713
+ SOCK_GetRemotePort@Base 6.1.20110713
+ SOCK_GetTimeout@Base 6.1.20030421
+ SOCK_GetTotalCount@Base 6.1.20110713
+ SOCK_HostPortToString@Base 6.1.20060301
+ SOCK_HostToNetLong@Base 6.1.20030421
+ SOCK_HostToNetShort@Base 6.1.20030421
+ SOCK_InitializeAPI@Base 6.1.20030421
+ SOCK_IsClientSide@Base 6.1.20030421
+ SOCK_IsDatagram@Base 6.1.20030421
+ SOCK_IsLoopbackAddress@Base 6.1.20160908
+ SOCK_IsSecure@Base 6.1.20081116
+ SOCK_IsServerSide@Base 6.1.20030421
+ SOCK_IsUNIX@Base 6.1.20050429
+ SOCK_OSHandleSize@Base 6.1.20110713
+ SOCK_Poll@Base 6.1.20030421
+ SOCK_Pushback@Base 6.1.20160908
+ SOCK_Read@Base 6.1.20030421
+ SOCK_ReadLine@Base 6.1.20050429
+ SOCK_Reconnect@Base 6.1.20030421
+ SOCK_SetCork@Base 6.1.20110713
+ SOCK_SetDataLogging@Base 6.1.20030421
+ SOCK_SetDataLoggingAPI@Base 6.1.20030421
+ SOCK_SetErrHookAPI@Base 6.1.20160908
+ SOCK_SetIOWaitSysAPI@Base 6.1.20100808
+ SOCK_SetInterruptOnSignal@Base 6.1.20030421
+ SOCK_SetInterruptOnSignalAPI@Base 6.1.20030421
+ SOCK_SetReadOnWrite@Base 6.1.20030421
+ SOCK_SetReadOnWriteAPI@Base 6.1.20030421
+ SOCK_SetReuseAddress@Base 6.1.20031028
+ SOCK_SetReuseAddressAPI@Base 6.1.20031028
+ SOCK_SetSelectInternalRestartTimeout@Base 6.1.20040204
+ SOCK_SetTimeout@Base 6.1.20030421
+ SOCK_SetupSSL@Base 6.1.20081116
+ SOCK_SetupSSLEx@Base 6.1.20160908
+ SOCK_Shutdown@Base 6.1.20030421
+ SOCK_ShutdownAPI@Base 6.1.20030421
+ SOCK_Status@Base 6.1.20030421
+ SOCK_StringToHostPort@Base 6.1.20060301
+ SOCK_StringToHostPortEx@Base 6.1.20160908
+ SOCK_StripToPattern@Base 6.1.20030421
+ SOCK_Wait@Base 6.1.20030421
+ SOCK_Write@Base 6.1.20030421
+ SOCK_gethostbyaddr@Base 6.1.20030421
+ SOCK_gethostbyaddrEx@Base 6.1.20110713
+ SOCK_gethostbyname@Base 6.1.20030421
+ SOCK_gethostbynameEx@Base 6.1.20110713
+ SOCK_gethostname@Base 6.1.20030421
+ SOCK_gethostnameEx@Base 6.1.20110713
+ SOCK_htonl@Base 6.1.20060301
+ SOCK_htons@Base 6.1.20060301
+ SOCK_isip@Base 6.1.20070822
+ SOCK_isipEx@Base 6.1.20070822
+ SOCK_ntoa@Base 6.1.20030421
+ SendMailInfo_InitEx@Base 6.1.20100808
+ SetAppParamBoolean@Base 6.1.20030421
+ SetAppParamLong@Base 6.1.20030421
+ SkipChar@Base 6.1.20030421
+ SkipPastChar@Base 6.1.20030421
+ SkipPastString@Base 6.1.20030421
+ SkipSet@Base 6.1.20030421
+ SkipSpaces@Base 6.1.20030421
+ SkipToChar@Base 6.1.20030421
+ SkipToSet@Base 6.1.20030421
+ SkipToSpace@Base 6.1.20030421
+ SkipToString@Base 6.1.20030421
+ StrCpyPtr@Base 6.1.20030421
+ StrDupPtr@Base 6.1.20030421
+ StrMatch@Base 6.1.20030421
+ StringDiff@Base 6.1.20030421
+ StringDiffNum@Base 6.1.20030421
+ StringEnd@Base 6.1.20030421
+ StringSub@Base 6.1.20030421
+ StringSubSet@Base 6.1.20030421
+ StringSubString@Base 6.1.20030421
+ StripSpaces@Base 6.1.20030421
+ TRIGGER_Close@Base 6.1.20070822
+ TRIGGER_Create@Base 6.1.20070822
+ TRIGGER_IsSet@Base 6.1.20070822
+ TRIGGER_Reset@Base 6.1.20070822
+ TRIGGER_Set@Base 6.1.20070822
+ TruncateString@Base 6.1.20030421
+ TruncateStringCopy@Base 6.1.20030421
+ URL_Connect@Base 6.1.20030421
+ URL_ConnectEx@Base 6.1.20081116
+ URL_Decode@Base 6.1.20030421
+ URL_DecodeEx@Base 6.1.20030421
+ URL_Encode@Base 6.1.20030421
+ URL_EncodeEx@Base 6.1.20110713
+ UTIL_Adler32_Update@Base 6.1.20100808
+ UTIL_CRC32_Update@Base 6.1.20100808
+ UTIL_GenerateHMAC@Base 6.1.20160908
+ UTIL_MatchesMask@Base 6.1.20050828
+ UTIL_MatchesMaskEx@Base 6.1.20060507
+ UTIL_NcbiLocalHostName@Base 6.1.20080302
+ UTIL_PrintableString@Base 6.1.20090301
+ UTIL_PrintableStringSize@Base 6.1.20090301
+ Uint8ToBytes@Base 6.1.20030421
+ ValNodeAdd@Base 6.1.20030421
+ ValNodeAddBigInt@Base 6.1.20030421
+ ValNodeAddBoolean@Base 6.1.20030421
+ ValNodeAddFloat@Base 6.1.20030421
+ ValNodeAddFunction@Base 6.1.20030421
+ ValNodeAddInt@Base 6.1.20030421
+ ValNodeAddPointer@Base 6.1.20030421
+ ValNodeAddPointerEx@Base 6.1.20110713
+ ValNodeAddStr@Base 6.1.20030421
+ ValNodeCompare@Base 6.1.20081116
+ ValNodeCopyStr@Base 6.1.20030421
+ ValNodeCopyStrEx@Base 6.1.20110713
+ ValNodeCopyStrExEx@Base 6.1.20120620
+ ValNodeDupList@Base 6.1.20110713
+ ValNodeExtract@Base 6.1.20030421
+ ValNodeExtractList@Base 6.1.20030421
+ ValNodeFindNext@Base 6.1.20030421
+ ValNodeFree@Base 6.1.20030421
+ ValNodeFreeData@Base 6.1.20030421
+ ValNodeInsert@Base 6.1.20090301
+ ValNodeIsSorted@Base 6.1.20110713
+ ValNodeLen@Base 6.1.20030421
+ ValNodeLink@Base 6.1.20030421
+ ValNodeMergeStrs@Base 6.1.20070822
+ ValNodeMergeStrsEx@Base 6.1.20110713
+ ValNodeMergeStrsExEx@Base 6.1.20110713
+ ValNodeNew@Base 6.1.20030421
+ ValNodePurge@Base 6.1.20081116
+ ValNodeSort@Base 6.1.20030421
+ ValNodeUnique@Base 6.1.20081116
+ VisitXmlAttributes@Base 6.1.20110713
+ VisitXmlNodes@Base 6.1.20110713
+ WWWFindName@Base 6.1.20030421
+ WWWFindNameEx@Base 6.1.20030421
+ WWWGetAddress@Base 6.1.20030421
+ WWWGetAgent@Base 6.1.20030421
+ WWWGetArgs@Base 6.1.20030421
+ WWWGetArgsAttr_Create@Base 6.1.20030421
+ WWWGetArgsAttr_Destroy@Base 6.1.20030421
+ WWWGetArgsAttr_SetFilter@Base 6.1.20030421
+ WWWGetArgsAttr_SetReadArgv@Base 6.1.20030421
+ WWWGetArgsEx@Base 6.1.20030421
+ WWWGetBrowser@Base 6.1.20030421
+ WWWGetDocRoot@Base 6.1.20030421
+ WWWGetEntries@Base 6.1.20030421
+ WWWGetEntriesEx@Base 6.1.20030421
+ WWWGetEntriesFormData@Base 6.1.20030421
+ WWWGetEntriesFormDataEx@Base 6.1.20030421
+ WWWGetHost@Base 6.1.20030421
+ WWWGetLastValueByName@Base 6.1.20030421
+ WWWGetMethod@Base 6.1.20030421
+ WWWGetNameByIndex@Base 6.1.20030421
+ WWWGetNumEntries@Base 6.1.20030421
+ WWWGetPort@Base 6.1.20030421
+ WWWGetProxiedIP@Base 6.1.20030421
+ WWWGetQuery@Base 6.1.20030421
+ WWWGetServer@Base 6.1.20030421
+ WWWGetValueByIndex@Base 6.1.20030421
+ WWWGetValueByName@Base 6.1.20030421
+ WWWGetValueSizeByIndex@Base 6.1.20030421
+ WWWGetWWWEntries@Base 6.1.20030421
+ WWWInfoFree@Base 6.1.20030421
+ WWWReadFileInMemory@Base 6.1.20030421
+ WWWReadFileInMemoryEx@Base 6.1.20030421
+ WWWReadPosting@Base 6.1.20030421
+ WWWSubstituteValue@Base 6.1.20030421
+ WWWSubstituteValueByName@Base 6.1.20030421
+ WriteXmlObject@Base 6.1.20110713
+ WriteXmlObjectEx@Base 6.1.20110713
+ XmlFileToString@Base 6.1.20110713
+ XmlPathSuffixIs@Base 6.1.20120620
+ corelibMutex@Base 6.1.20030421
+ g_CORE_GetAppName@Base 6.1.20120620
+ g_CORE_GetRequestDtab@Base 6.1.20160908
+ g_CORE_GetRequestID@Base 6.1.20160908
+ g_CORE_Log@Base 6.1.20030421
+ g_CORE_MT_Lock@Base 6.1.20030421
+ g_CORE_MT_Lock_default@Base 6.1.20120620
+ g_CORE_Registry@Base 6.1.20030421
+ g_CORE_RegistryGET@Base 6.1.20030421
+ g_CORE_RegistrySET@Base 6.1.20160908
+ g_CORE_Set@Base 6.1.20160908
+ g_CORE_Sprintf@Base 6.1.20030421
+ g_LBOS_CheckIterator@Base 6.1.20160908
+ g_LBOS_GetLBOSAddress@Base 6.1.20160908
+ g_LBOS_GetLBOSAddressEx@Base 6.1.20160908
+ g_LBOS_RegGet@Base 6.1.20160908
+ g_LBOS_StringConcat@Base 6.1.20160908
+ g_LBOS_StringIsNullOrEmpty@Base 6.1.20160908
+ g_LBOS_StringNConcat@Base 6.1.20160908
+ g_LBOS_UnitTesting_FindAnnouncedServer@Base 6.1.20160908
+ g_LBOS_UnitTesting_GetAnnouncedServers@Base 6.1.20160908
+ g_LBOS_UnitTesting_GetAnnouncedServersNum@Base 6.1.20160908
+ g_LBOS_UnitTesting_GetLBOSFuncs@Base 6.1.20160908
+ g_LBOS_UnitTesting_InitStatus@Base 6.1.20160908
+ g_LBOS_UnitTesting_Instance@Base 6.1.20160908
+ g_LBOS_UnitTesting_Lbosresolver@Base 6.1.20160908
+ g_LBOS_UnitTesting_PowerStatus@Base 6.1.20160908
+ g_LBOS_UnitTesting_SetLBOSFindMethod@Base 6.1.20160908
+ g_LBOS_UnitTesting_SetLBOSResolverFile@Base 6.1.20160908
+ g_LBOS_UnitTesting_SetLBOSaddress@Base 6.1.20160908
+ g_LBOS_strcasestr@Base 6.1.20160908
+ g_NCBI_ConnectRandomSeed@Base 6.1.20050605
+ g_NCBI_ConnectSrandAddend@Base 6.1.20050828
+ g_VersionStr@Base 6.1.20100808
+ g_bBadPtr@Base 6.1.20030421
+ g_corelib@Base 6.1.20030421
+ g_kNcbiSockNameAbbr@Base 6.1.20120620
+ gdImageArc@Base 6.1.20030421
+ gdImageArcEx@Base 6.1.20030421
+ gdImageAutoCrop@Base 6.1.20030421
+ gdImageBoundsSafe@Base 6.1.20030421
+ gdImageChar@Base 6.1.20030421
+ gdImageCharV@Base 6.1.20030421
+ gdImageColorAllocate@Base 6.1.20030421
+ gdImageColorClosest@Base 6.1.20030421
+ gdImageColorDeallocate@Base 6.1.20030421
+ gdImageColorExact@Base 6.1.20030421
+ gdImageColorTransparent@Base 6.1.20030421
+ gdImageCopy@Base 6.1.20030421
+ gdImageCopyBits@Base 6.1.20030421
+ gdImageCopyResized@Base 6.1.20030421
+ gdImageCreate@Base 6.1.20030421
+ gdImageCreateFromGif@Base 6.1.20030421
+ gdImageCrop@Base 6.1.20030421
+ gdImageDashedLine@Base 6.1.20030421
+ gdImageDestroy@Base 6.1.20030421
+ gdImageEllipse@Base 6.1.20030421
+ gdImageFilledPolygon@Base 6.1.20030421
+ gdImageFilledRectangle@Base 6.1.20030421
+ gdImageGetAutoCropRectangle@Base 6.1.20030421
+ gdImageGetColor@Base 6.1.20030421
+ gdImageGetDimensions@Base 6.1.20030421
+ gdImageGetPixel@Base 6.1.20030421
+ gdImageGif@Base 6.1.20030421
+ gdImageGifEx@Base 6.1.20030421
+ gdImageInterlace@Base 6.1.20030421
+ gdImageLine@Base 6.1.20030421
+ gdImagePolygon@Base 6.1.20030421
+ gdImageQuadrant@Base 6.1.20030421
+ gdImageRectangle@Base 6.1.20030421
+ gdImageRoundRectangle@Base 6.1.20030421
+ gdImageSelectPattern@Base 6.1.20030421
+ gdImageSetClip@Base 6.1.20030421
+ gdImageSetColor@Base 6.1.20030421
+ gdImageSetPixel@Base 6.1.20030421
+ gdImageString@Base 6.1.20030421
+ gdImageStringV@Base 6.1.20030421
+ main@Base 6.1.20030421
+ re_compile_fastmap@Base 6.1.20030421
+ re_compile_pattern@Base 6.1.20030421
+ re_match@Base 6.1.20030421
+ re_match_2@Base 6.1.20030421
+ re_max_failures@Base 6.1.20030421
+ re_search@Base 6.1.20030421
+ re_search_2@Base 6.1.20030421
+ re_set_registers@Base 6.1.20030421
+ re_set_syntax@Base 6.1.20030421
+ re_syntax_options@Base 6.1.20030421
+ regcomp@Base 6.1.20030421
+ regerror@Base 6.1.20030421
+ regexec@Base 6.1.20030421
+ regfree@Base 6.1.20030421
+ s_CreateConnector@Base 6.1.20110713
+ s_LBOS_Deannounce@Base 6.1.20160908
+ s_LBOS_ModifyServiceName@Base 6.1.20160908
+ strncpy0@Base 6.1.20030421
+ structTls@Base 6.1.20030421
+ tree_addChild@Base 6.1.20030421
+ tree_addSpy@Base 6.1.20030421
+ tree_child@Base 6.1.20030421
+ tree_closeCursor@Base 6.1.20030421
+ tree_delNode@Base 6.1.20030421
+ tree_delSpy@Base 6.1.20030421
+ tree_delSubtree@Base 6.1.20030421
+ tree_delete@Base 6.1.20030421
+ tree_getAncestor@Base 6.1.20030421
+ tree_getId@Base 6.1.20030421
+ tree_getLevel@Base 6.1.20030421
+ tree_getNode@Base 6.1.20030421
+ tree_getNodeData@Base 6.1.20030421
+ tree_getSpyData@Base 6.1.20030421
+ tree_getUserData@Base 6.1.20030421
+ tree_isDescendant@Base 6.1.20030421
+ tree_merge@Base 6.1.20030421
+ tree_moveChildren@Base 6.1.20030421
+ tree_moveNode@Base 6.1.20030421
+ tree_new@Base 6.1.20030421
+ tree_openCursor@Base 6.1.20030421
+ tree_parent@Base 6.1.20030421
+ tree_restore@Base 6.1.20030421
+ tree_root@Base 6.1.20030421
+ tree_save@Base 6.1.20030421
+ tree_setGetNodeFunc@Base 6.1.20030421
+ tree_setSaveNodeFunc@Base 6.1.20030421
+ tree_setUpdateNodeFunc@Base 6.1.20030421
+ tree_sibling@Base 6.1.20030421
+ tree_toNode@Base 6.1.20030421
+ tree_updateNode@Base 6.1.20030421
+ tree_updateNodeData@Base 6.1.20030421
+ x_NCBI_months@Base 6.1.20030421
+ x_json_array@Base 6.1.20160908
+ x_json_array_append_boolean@Base 6.1.20160908
+ x_json_array_append_null@Base 6.1.20160908
+ x_json_array_append_number@Base 6.1.20160908
+ x_json_array_append_string@Base 6.1.20160908
+ x_json_array_append_value@Base 6.1.20160908
+ x_json_array_clear@Base 6.1.20160908
+ x_json_array_get_array@Base 6.1.20160908
+ x_json_array_get_boolean@Base 6.1.20160908
+ x_json_array_get_count@Base 6.1.20160908
+ x_json_array_get_number@Base 6.1.20160908
+ x_json_array_get_object@Base 6.1.20160908
+ x_json_array_get_string@Base 6.1.20160908
+ x_json_array_get_value@Base 6.1.20160908
+ x_json_array_remove@Base 6.1.20160908
+ x_json_array_replace_boolean@Base 6.1.20160908
+ x_json_array_replace_null@Base 6.1.20160908
+ x_json_array_replace_number@Base 6.1.20160908
+ x_json_array_replace_string@Base 6.1.20160908
+ x_json_array_replace_value@Base 6.1.20160908
+ x_json_boolean@Base 6.1.20160908
+ x_json_free_serialized_string@Base 6.1.20160908
+ x_json_number@Base 6.1.20160908
+ x_json_object@Base 6.1.20160908
+ x_json_object_clear@Base 6.1.20160908
+ x_json_object_dotget_array@Base 6.1.20160908
+ x_json_object_dotget_boolean@Base 6.1.20160908
+ x_json_object_dotget_number@Base 6.1.20160908
+ x_json_object_dotget_object@Base 6.1.20160908
+ x_json_object_dotget_string@Base 6.1.20160908
+ x_json_object_dotget_value@Base 6.1.20160908
+ x_json_object_dotremove@Base 6.1.20160908
+ x_json_object_dotset_boolean@Base 6.1.20160908
+ x_json_object_dotset_null@Base 6.1.20160908
+ x_json_object_dotset_number@Base 6.1.20160908
+ x_json_object_dotset_string@Base 6.1.20160908
+ x_json_object_dotset_value@Base 6.1.20160908
+ x_json_object_get_array@Base 6.1.20160908
+ x_json_object_get_boolean@Base 6.1.20160908
+ x_json_object_get_count@Base 6.1.20160908
+ x_json_object_get_name@Base 6.1.20160908
+ x_json_object_get_number@Base 6.1.20160908
+ x_json_object_get_object@Base 6.1.20160908
+ x_json_object_get_string@Base 6.1.20160908
+ x_json_object_get_value@Base 6.1.20160908
+ x_json_object_get_value_at@Base 6.1.20160908
+ x_json_object_remove@Base 6.1.20160908
+ x_json_object_set_boolean@Base 6.1.20160908
+ x_json_object_set_null@Base 6.1.20160908
+ x_json_object_set_number@Base 6.1.20160908
+ x_json_object_set_string@Base 6.1.20160908
+ x_json_object_set_value@Base 6.1.20160908
+ x_json_parse_file@Base 6.1.20160908
+ x_json_parse_file_with_comments@Base 6.1.20160908
+ x_json_parse_string@Base 6.1.20160908
+ x_json_parse_string_with_comments@Base 6.1.20160908
+ x_json_serialization_size@Base 6.1.20160908
+ x_json_serialization_size_pretty@Base 6.1.20160908
+ x_json_serialize_to_buffer@Base 6.1.20160908
+ x_json_serialize_to_buffer_pretty@Base 6.1.20160908
+ x_json_serialize_to_file@Base 6.1.20160908
+ x_json_serialize_to_file_pretty@Base 6.1.20160908
+ x_json_serialize_to_string@Base 6.1.20160908
+ x_json_serialize_to_string_pretty@Base 6.1.20160908
+ x_json_set_allocation_functions@Base 6.1.20160908
+ x_json_string@Base 6.1.20160908
+ x_json_type@Base 6.1.20160908
+ x_json_validate@Base 6.1.20160908
+ x_json_value_deep_copy@Base 6.1.20160908
+ x_json_value_equals@Base 6.1.20160908
+ x_json_value_free@Base 6.1.20160908
+ x_json_value_get_array@Base 6.1.20160908
+ x_json_value_get_boolean@Base 6.1.20160908
+ x_json_value_get_number@Base 6.1.20160908
+ x_json_value_get_object@Base 6.1.20160908
+ x_json_value_get_string@Base 6.1.20160908
+ x_json_value_get_type@Base 6.1.20160908
+ x_json_value_init_array@Base 6.1.20160908
+ x_json_value_init_boolean@Base 6.1.20160908
+ x_json_value_init_null@Base 6.1.20160908
+ x_json_value_init_number@Base 6.1.20160908
+ x_json_value_init_object@Base 6.1.20160908
+ x_json_value_init_string@Base 6.1.20160908
+libncbiNacc.so.6 libncbi6 #MINVER#
+ AccessionToFasta@Base 6.1.20030421
+ AdaptiveDocSumMatrix@Base 6.1.20030421
+ BiostrucListAsnRead@Base 6.1.20030421
+ BiostrucListAsnWrite@Base 6.1.20030421
+ BiostrucListFree@Base 6.1.20030421
+ BiostrucListNew@Base 6.1.20030421
+ BoolExprAsnRead@Base 6.1.20030421
+ BoolExprAsnWrite@Base 6.1.20030421
+ ClusterArticlesAsnRead@Base 6.1.20030421
+ ClusterArticlesAsnWrite@Base 6.1.20030421
+ ClusterArticlesFree@Base 6.1.20030421
+ ClusterArticlesNew@Base 6.1.20030421
+ ClusterRespAsnRead@Base 6.1.20030421
+ ClusterRespAsnWrite@Base 6.1.20030421
+ ClusterRespFree@Base 6.1.20030421
+ ClusterRespNew@Base 6.1.20030421
+ DateConstraintsAsnRead@Base 6.1.20030421
+ DateConstraintsAsnWrite@Base 6.1.20030421
+ DateConstraintsFree@Base 6.1.20030421
+ DateConstraintsNew@Base 6.1.20030421
+ DateVectorAsnRead@Base 6.1.20030421
+ DateVectorAsnWrite@Base 6.1.20030421
+ DateVectorFree@Base 6.1.20030421
+ DateVectorNew@Base 6.1.20030421
+ DumpNetStats@Base 6.1.20030421
+ EntrezBioseqFetchDisable@Base 6.1.20030421
+ EntrezBioseqFetchEnable@Base 6.1.20030421
+ EntrezBiostrucAnnotSetGet@Base 6.1.20030421
+ EntrezBiostrucAnnotSetGetByFid@Base 6.1.20030421
+ EntrezBiostrucFeatIds@Base 6.1.20030421
+ EntrezBiostrucGet@Base 6.1.20030421
+ EntrezBlastBioseq@Base 6.1.20030421
+ EntrezBlastreqAsnRead@Base 6.1.20030421
+ EntrezBlastreqAsnWrite@Base 6.1.20030421
+ EntrezBlastreqFree@Base 6.1.20030421
+ EntrezBlastreqNew@Base 6.1.20030421
+ EntrezCanBlast@Base 6.1.20030421
+ EntrezCanNeighborText@Base 6.1.20030421
+ EntrezClusterAnalysis@Base 6.1.20030421
+ EntrezCommonHierAncestor@Base 6.1.20030421
+ EntrezCreateNamedUidList@Base 6.1.20030421
+ EntrezCreateNamedUidListX@Base 6.1.20030421
+ EntrezDetailedInfo@Base 6.1.20030421
+ EntrezDoNeighborText@Base 6.1.20030421
+ EntrezDocGetAsnRead@Base 6.1.20030421
+ EntrezDocGetAsnWrite@Base 6.1.20030421
+ EntrezDocGetFree@Base 6.1.20030421
+ EntrezDocGetNew@Base 6.1.20030421
+ EntrezDocSum@Base 6.1.20030421
+ EntrezDocSumListGet@Base 6.1.20030421
+ EntrezExpandedMedlineFeatures@Base 6.1.20030421
+ EntrezExtraInfoAsnRead@Base 6.1.20030421
+ EntrezExtraInfoAsnWrite@Base 6.1.20030421
+ EntrezExtraInfoFree@Base 6.1.20030421
+ EntrezExtraInfoNew@Base 6.1.20030421
+ EntrezFieldToString@Base 6.1.20030421
+ EntrezFindSeqId@Base 6.1.20030421
+ EntrezFindTerm@Base 6.1.20030421
+ EntrezFini@Base 6.1.20030421
+ EntrezGetInfo@Base 6.1.20030421
+ EntrezGetMaxLinks@Base 6.1.20030421
+ EntrezGetUserMaxLinks@Base 6.1.20030421
+ EntrezHierarchyAsnRead@Base 6.1.20030421
+ EntrezHierarchyAsnWrite@Base 6.1.20030421
+ EntrezHierarchyFree@Base 6.1.20030421
+ EntrezHierarchyGet@Base 6.1.20030421
+ EntrezHierarchyNew@Base 6.1.20030421
+ EntrezIdsAsnRead@Base 6.1.20030421
+ EntrezIdsAsnWrite@Base 6.1.20030421
+ EntrezIdsFree@Base 6.1.20030421
+ EntrezIdsNew@Base 6.1.20030421
+ EntrezInit@Base 6.1.20030421
+ EntrezIsInited@Base 6.1.20030421
+ EntrezLinkUidList@Base 6.1.20030421
+ EntrezMedlineEntryGet@Base 6.1.20030421
+ EntrezMedlineEntryListGet@Base 6.1.20030421
+ EntrezMlSumListGet@Base 6.1.20030421
+ EntrezNeighborTextAsnRead@Base 6.1.20030421
+ EntrezNeighborTextAsnWrite@Base 6.1.20030421
+ EntrezNeighborTextFree@Base 6.1.20030421
+ EntrezNeighborTextNew@Base 6.1.20030421
+ EntrezPMTLEval@Base 6.1.20030421
+ EntrezPMTLEvalCount@Base 6.1.20030421
+ EntrezPMTLEvalCountString@Base 6.1.20030421
+ EntrezPMTLEvalString@Base 6.1.20030421
+ EntrezPMTLEvalX@Base 6.1.20030421
+ EntrezPMTLEvalXString@Base 6.1.20030421
+ EntrezPMTLParseString@Base 6.1.20030421
+ EntrezSeqEntryGet@Base 6.1.20030421
+ EntrezSeqEntryListGet@Base 6.1.20030421
+ EntrezSeqGetAsnRead@Base 6.1.20030421
+ EntrezSeqGetAsnWrite@Base 6.1.20030421
+ EntrezSeqGetFree@Base 6.1.20030421
+ EntrezSeqGetNew@Base 6.1.20030421
+ EntrezSeqIdForGI@Base 6.1.20030421
+ EntrezSeqSumListGet@Base 6.1.20030421
+ EntrezSetUserMaxLinks@Base 6.1.20030421
+ EntrezStringToField@Base 6.1.20030421
+ EntrezTLAddAND@Base 6.1.20030421
+ EntrezTLAddBUTNOT@Base 6.1.20030421
+ EntrezTLAddLParen@Base 6.1.20030421
+ EntrezTLAddOR@Base 6.1.20030421
+ EntrezTLAddRParen@Base 6.1.20030421
+ EntrezTLAddTerm@Base 6.1.20030421
+ EntrezTLAddTermWithRange@Base 6.1.20030421
+ EntrezTLEval@Base 6.1.20030421
+ EntrezTLEvalCount@Base 6.1.20030421
+ EntrezTLEvalCountString@Base 6.1.20030421
+ EntrezTLEvalString@Base 6.1.20030421
+ EntrezTLEvalX@Base 6.1.20030421
+ EntrezTLEvalXString@Base 6.1.20030421
+ EntrezTLFree@Base 6.1.20030421
+ EntrezTLNew@Base 6.1.20030421
+ EntrezTLParseString@Base 6.1.20030421
+ EntrezTermListByPage@Base 6.1.20030421
+ EntrezTermListByTerm@Base 6.1.20030421
+ EntrezUidLinks@Base 6.1.20030421
+ ForceNetInit@Base 6.1.20030421
+ GetByFidAsnRead@Base 6.1.20030421
+ GetByFidAsnWrite@Base 6.1.20030421
+ GetByFidFree@Base 6.1.20030421
+ GetByFidNew@Base 6.1.20030421
+ GetClientInfo@Base 6.1.20030421
+ GetFeatIdsAsnRead@Base 6.1.20030421
+ GetFeatIdsAsnWrite@Base 6.1.20030421
+ GetFeatIdsFree@Base 6.1.20030421
+ GetFeatIdsNew@Base 6.1.20030421
+ GetFullEntrezTermList@Base 6.1.20030421
+ LinkSetGetAsnRead@Base 6.1.20030421
+ LinkSetGetAsnWrite@Base 6.1.20030421
+ LinkSetGetFree@Base 6.1.20030421
+ LinkSetGetNew@Base 6.1.20030421
+ LogNetStats@Base 6.1.20030421
+ MarkedLinkSetAsnRead@Base 6.1.20030421
+ MarkedLinkSetAsnWrite@Base 6.1.20030421
+ MarkedLinkSetFree@Base 6.1.20030421
+ MarkedLinkSetNew@Base 6.1.20030421
+ MedlineEntryListAsnRead@Base 6.1.20030421
+ MedlineEntryListAsnWrite@Base 6.1.20030421
+ MedlineEntryListFree@Base 6.1.20030421
+ MedlineEntryListNew@Base 6.1.20030421
+ MlSumAsnRead@Base 6.1.20030421
+ MlSumAsnWrite@Base 6.1.20030421
+ MlSumFree@Base 6.1.20030421
+ MlSumNew@Base 6.1.20030421
+ MlSummaryListAsnRead@Base 6.1.20030421
+ MlSummaryListAsnWrite@Base 6.1.20030421
+ MlSummaryListFree@Base 6.1.20030421
+ MlSummaryListNew@Base 6.1.20030421
+ NamedListAsnRead@Base 6.1.20030421
+ NamedListAsnWrite@Base 6.1.20030421
+ NamedListFree@Base 6.1.20030421
+ NamedListNew@Base 6.1.20030421
+ NetDocSum@Base 6.1.20030421
+ NetDocSumListGet@Base 6.1.20030421
+ NetEInit@Base 6.1.20030421
+ NetEntAsnLoad@Base 6.1.20030421
+ NetEntBlastBioseq@Base 6.1.20030421
+ NetEntCanBlast@Base 6.1.20030421
+ NetEntCanNeighborText@Base 6.1.20030421
+ NetEntClusterAnalysis@Base 6.1.20030421
+ NetEntDoNeighborText@Base 6.1.20030421
+ NetEntExpandedMedlineFeatures@Base 6.1.20030421
+ NetEntGetMaxLinks@Base 6.1.20030421
+ NetEntHierarchyGet@Base 6.1.20030421
+ NetEntMedlineEntryListGet@Base 6.1.20030421
+ NetEntMeshHierarchyGet@Base 6.1.20030421
+ NetEntSeqEntryListGet@Base 6.1.20030421
+ NetEntTLAddTerm@Base 6.1.20030421
+ NetEntTLEval@Base 6.1.20030421
+ NetEntTLEvalCount@Base 6.1.20030421
+ NetEntTLEvalX@Base 6.1.20030421
+ NetEntTLFree@Base 6.1.20030421
+ NetEntTLNew@Base 6.1.20030421
+ NetEntrezBiostrucAnnotSetGet@Base 6.1.20030421
+ NetEntrezBiostrucAnnotSetGetByFid@Base 6.1.20030421
+ NetEntrezBiostrucFeatIds@Base 6.1.20030421
+ NetEntrezBiostrucListGet@Base 6.1.20030421
+ NetEntrezCreateNamedUidList@Base 6.1.20030421
+ NetEntrezCreateNamedUidListX@Base 6.1.20030421
+ NetEntrezDetailedInfo@Base 6.1.20030421
+ NetEntrezFindSeqId@Base 6.1.20030421
+ NetEntrezFindTerm@Base 6.1.20030421
+ NetEntrezFini@Base 6.1.20030421
+ NetEntrezGetInfo@Base 6.1.20030421
+ NetEntrezInit@Base 6.1.20030421
+ NetFini@Base 6.1.20030421
+ NetLinkUidList@Base 6.1.20030421
+ NetSeqIdForGI@Base 6.1.20030421
+ NetServiceGet@Base 6.1.20030421
+ NetTermListByPage@Base 6.1.20030421
+ NetTermListByTerm@Base 6.1.20030421
+ NetUidLinks@Base 6.1.20030421
+ NewSummaryListAsnRead@Base 6.1.20030421
+ NewSummaryListAsnWrite@Base 6.1.20030421
+ NewSummaryListFree@Base 6.1.20030421
+ NewSummaryListNew@Base 6.1.20030421
+ SeqEntryListAsnRead@Base 6.1.20030421
+ SeqEntryListAsnWrite@Base 6.1.20030421
+ SeqEntryListFree@Base 6.1.20030421
+ SeqEntryListNew@Base 6.1.20030421
+ SeqSumAsnRead@Base 6.1.20030421
+ SeqSumAsnWrite@Base 6.1.20030421
+ SeqSumFree@Base 6.1.20030421
+ SeqSumNew@Base 6.1.20030421
+ SeqSummaryListAsnRead@Base 6.1.20030421
+ SeqSummaryListAsnWrite@Base 6.1.20030421
+ SeqSummaryListFree@Base 6.1.20030421
+ SeqSummaryListNew@Base 6.1.20030421
+ TermByPageAsnRead@Base 6.1.20030421
+ TermByPageAsnWrite@Base 6.1.20030421
+ TermByPageFree@Base 6.1.20030421
+ TermByPageNew@Base 6.1.20030421
+ TermByTermAsnRead@Base 6.1.20030421
+ TermByTermAsnWrite@Base 6.1.20030421
+ TermByTermFree@Base 6.1.20030421
+ TermByTermNew@Base 6.1.20030421
+ TermCountsAsnRead@Base 6.1.20030421
+ TermCountsAsnWrite@Base 6.1.20030421
+ TermCountsFree@Base 6.1.20030421
+ TermCountsNew@Base 6.1.20030421
+ TermLookupAsnRead@Base 6.1.20030421
+ TermLookupAsnWrite@Base 6.1.20030421
+ TermLookupFree@Base 6.1.20030421
+ TermLookupNew@Base 6.1.20030421
+ TermPageInfoAsnRead@Base 6.1.20030421
+ TermPageInfoAsnWrite@Base 6.1.20030421
+ TermPageInfoFree@Base 6.1.20030421
+ TermPageInfoNew@Base 6.1.20030421
+ TermRespAsnRead@Base 6.1.20030421
+ TermRespFree@Base 6.1.20030421
+ TermRespNew@Base 6.1.20030421
+ state@Base 6.1.20030421
+libncbicdr.so.6 libncbi6 #MINVER#
+ CASN_Close@Base 6.1.20030421
+ CASN_DocCount@Base 6.1.20030421
+ CASN_DocType@Base 6.1.20030421
+ CASN_Free@Base 6.1.20030421
+ CASN_GetAsnIoPtr@Base 6.1.20030421
+ CASN_New@Base 6.1.20030421
+ CASN_NextBiostruc@Base 6.1.20030421
+ CASN_NextMedlineEntry@Base 6.1.20030421
+ CASN_NextSeqEntry@Base 6.1.20030421
+ CASN_Open@Base 6.1.20030421
+ CASN_Seek@Base 6.1.20030421
+ CdDocSum@Base 6.1.20030421
+ CdDocSumListGet@Base 6.1.20030421
+ CdEntGetMaxLinks@Base 6.1.20030421
+ CdEntMedlineEntryListGet@Base 6.1.20030421
+ CdEntMlSumListGet@Base 6.1.20030421
+ CdEntSeqEntryListGet@Base 6.1.20030421
+ CdEntSeqSumListGet@Base 6.1.20030421
+ CdEntTLAddTerm@Base 6.1.20030421
+ CdEntTLEval@Base 6.1.20030421
+ CdEntTLEvalCount@Base 6.1.20030421
+ CdEntTLEvalX@Base 6.1.20030421
+ CdEntTLFree@Base 6.1.20030421
+ CdEntTLNew@Base 6.1.20030421
+ CdEntrezBiostrucAnnotSetGet@Base 6.1.20030421
+ CdEntrezBiostrucAnnotSetGetByFid@Base 6.1.20030421
+ CdEntrezBiostrucFeatIds@Base 6.1.20030421
+ CdEntrezBiostrucGet@Base 6.1.20030421
+ CdEntrezCreateNamedUidList@Base 6.1.20030421
+ CdEntrezCreateNamedUidListX@Base 6.1.20030421
+ CdEntrezDetailedInfo@Base 6.1.20030421
+ CdEntrezFindSeqId@Base 6.1.20030421
+ CdEntrezFindTerm@Base 6.1.20030421
+ CdEntrezFini@Base 6.1.20030421
+ CdEntrezGetInfo@Base 6.1.20030421
+ CdEntrezInit@Base 6.1.20030421
+ CdIsInserted@Base 6.1.20030421
+ CdLinkUidList@Base 6.1.20030421
+ CdMountEntrezVolume@Base 6.1.20030421
+ CdRomAsnLoad@Base 6.1.20030421
+ CdSeqIdForGI@Base 6.1.20030421
+ CdSeqSumAsnRead@Base 6.1.20030421
+ CdSetEjectHook@Base 6.1.20030421
+ CdSetInsertHook@Base 6.1.20030421
+ CdTermFree@Base 6.1.20030421
+ CdTermListByPage@Base 6.1.20030421
+ CdTermListByTerm@Base 6.1.20030421
+ CdUidLinks@Base 6.1.20030421
+ CdUnmountEntrezVolume@Base 6.1.20030421
+ ConfigFini@Base 6.1.20030421
+ ConfigInit@Base 6.1.20030421
+ CurMediaType@Base 6.1.20030421
+ DocSumAsnRead@Base 6.1.20030421
+ DocSumAsnWrite@Base 6.1.20030421
+ DocSumFree@Base 6.1.20030421
+ DocSumNew@Base 6.1.20030421
+ EntrezInfoAsnRead@Base 6.1.20030421
+ EntrezInfoAsnWrite@Base 6.1.20030421
+ EntrezInfoFree@Base 6.1.20030421
+ EntrezInfoMerge@Base 6.1.20030421
+ GetCurMedia@Base 6.1.20030421
+ ParseMedia@Base 6.1.20030421
+ PreInitMedia@Base 6.1.20030421
+ SelectDataLinksByTypes@Base 6.1.20030421
+ SelectDataSource@Base 6.1.20030421
+ SelectDataSourceByType@Base 6.1.20030421
+ SelectNextDataSource@Base 6.1.20030421
+ SetCurMedia@Base 6.1.20030421
+ SetSoleMedia@Base 6.1.20030421
+ _dir@Base 6.1.20030421
+ _finfo@Base 6.1.20030421
+ _nouveau@Base 6.1.20030421
+ cd3_CdDetailedInfo@Base 6.1.20030421
+ cd3_CdDocAsnClose@Base 6.1.20030421
+ cd3_CdDocAsnOpen@Base 6.1.20030421
+ cd3_CdEnumFiles@Base 6.1.20030421
+ cd3_CdFini@Base 6.1.20030421
+ cd3_CdGetDocSum@Base 6.1.20030421
+ cd3_CdGetInfo@Base 6.1.20030421
+ cd3_CdInit@Base 6.1.20030421
+ cd3_CdLinkUidGet@Base 6.1.20030421
+ cd3_CdTermScan@Base 6.1.20030421
+ cd3_CdTestPath@Base 6.1.20030421
+ cd3_CdTrmFind@Base 6.1.20030421
+ cd3_CdTrmLookup@Base 6.1.20030421
+ cd3_CdTrmPageCt@Base 6.1.20030421
+ cd3_CdTrmUidsFil@Base 6.1.20030421
+ cd3_CdTrmUidsMem@Base 6.1.20030421
+ cd3_EntrezInfoOpen@Base 6.1.20030421
+libncbiid1.so.6 libncbi6 #MINVER#
+ ID1ArcgGIStateGet@Base 6.1.20030421
+ ID1ArchFini@Base 6.1.20030421
+ ID1ArchGIGet@Base 6.1.20030421
+ ID1ArchGIHistGet@Base 6.1.20030421
+ ID1ArchInit@Base 6.1.20030421
+ ID1ArchSeqEntryGet@Base 6.1.20030421
+ ID1ArchSeqIdsGet@Base 6.1.20030421
+ ID1BioseqFetchDisable@Base 6.1.20030421
+ ID1BioseqFetchEnable@Base 6.1.20030421
+ ID1FindSeqId@Base 6.1.20030421
+ ID1Fini@Base 6.1.20030421
+ ID1Init@Base 6.1.20030421
+ ID1SeqEntryGet@Base 6.1.20030421
+ ID1SeqEntryInfoAsnRead@Base 6.1.20030421
+ ID1SeqEntryInfoAsnWrite@Base 6.1.20030421
+ ID1SeqEntryInfoFree@Base 6.1.20030421
+ ID1SeqEntryInfoNew@Base 6.1.20030421
+ ID1SeqHistAsnRead@Base 6.1.20030421
+ ID1SeqHistAsnWrite@Base 6.1.20030421
+ ID1SeqHistFree@Base 6.1.20030421
+ ID1SeqHistNew@Base 6.1.20030421
+ ID1SeqIdForGI@Base 6.1.20030421
+ ID1blobInfoAsnRead@Base 6.1.20030421
+ ID1blobInfoAsnWrite@Base 6.1.20030421
+ ID1blobInfoFree@Base 6.1.20030421
+ ID1blobInfoNew@Base 6.1.20030421
+ ID1serverBackAsnRead@Base 6.1.20030421
+ ID1serverBackAsnWrite@Base 6.1.20030421
+ ID1serverBackFree@Base 6.1.20030421
+ ID1serverDebugAsnRead@Base 6.1.20030421
+ ID1serverDebugAsnWrite@Base 6.1.20030421
+ ID1serverDebugFree@Base 6.1.20030421
+ ID1serverMaxcomplexAsnRead@Base 6.1.20030421
+ ID1serverMaxcomplexAsnWrite@Base 6.1.20030421
+ ID1serverMaxcomplexFree@Base 6.1.20030421
+ ID1serverMaxcomplexNew@Base 6.1.20030421
+ ID1serverRequestAsnRead@Base 6.1.20030421
+ ID1serverRequestAsnWrite@Base 6.1.20030421
+ ID1serverRequestFree@Base 6.1.20030421
+ SeqHistPrintTable@Base 6.1.20030421
+ id1genAsnLoad@Base 6.1.20030421
+ id_print_gi_state@Base 6.1.20030421
+libncbimla.so.6 libncbi6 #MINVER#
+ AllUpperCase@Base 6.1.20030421
+ FetchPub@Base 6.1.20030421
+ FetchPubPmId@Base 6.1.20030421
+ FindPub@Base 6.1.20030421
+ FixPub@Base 6.1.20030421
+ FixPubEquiv@Base 6.1.20030421
+ MedArchCitMatch@Base 6.1.20030421
+ MedArchCitMatchList@Base 6.1.20030421
+ MedArchCitMatchPmId@Base 6.1.20030421
+ MedArchFini@Base 6.1.20030421
+ MedArchGetAccPmids@Base 6.1.20030421
+ MedArchGetAccUids@Base 6.1.20030421
+ MedArchGetMriPmids@Base 6.1.20030421
+ MedArchGetMriUids@Base 6.1.20030421
+ MedArchGetPub@Base 6.1.20030421
+ MedArchGetPubPmId@Base 6.1.20030421
+ MedArchGetTitles@Base 6.1.20030421
+ MedArchInit@Base 6.1.20030421
+ MedArchMedlarsEntryGetPmId@Base 6.1.20030421
+ MedArchMedlarsEntryGetUid@Base 6.1.20030421
+ MedArchMedlineEntryGet@Base 6.1.20030421
+ MedArchMedlineEntryListGet@Base 6.1.20030421
+ MedArchMu2Pm@Base 6.1.20030421
+ MedArchPm2Mu@Base 6.1.20030421
+ MedArchPubSetCreate@Base 6.1.20030421
+ MedArchPubSetCreatePmId@Base 6.1.20030421
+ MedArchPubSetCreateUid@Base 6.1.20030421
+ MedArchPubmedEntryGetPmId@Base 6.1.20030421
+ MedArchPubmedEntryGetUid@Base 6.1.20030421
+ MedArchPubmedEntryListGetPmId@Base 6.1.20030421
+ MedArchPubmedEntryListGetUid@Base 6.1.20030421
+ MedlineToISO@Base 6.1.20030421
+ MlaBackAsnRead@Base 6.1.20030421
+ MlaBackAsnWrite@Base 6.1.20030421
+ MlaBackFree@Base 6.1.20030421
+ MlaRequestAsnRead@Base 6.1.20030421
+ MlaRequestAsnWrite@Base 6.1.20030421
+ MlaRequestFree@Base 6.1.20030421
+ SplitMedlineEntry@Base 6.1.20030421
+ SplitMlAuthorName@Base 6.1.20030421
+ TitleMsgAsnRead@Base 6.1.20030421
+ TitleMsgAsnWrite@Base 6.1.20030421
+ TitleMsgFree@Base 6.1.20030421
+ TitleMsgListAsnRead@Base 6.1.20030421
+ TitleMsgListAsnWrite@Base 6.1.20030421
+ TitleMsgListFree@Base 6.1.20030421
+ TitleMsgListNew@Base 6.1.20030421
+ TitleMsgNew@Base 6.1.20030421
+ get_std_auth@Base 6.1.20030421
+ in_press@Base 6.1.20030421
+ mlabp@Base 6.1.20030421
+ mlarp@Base 6.1.20030421
+ objmlaAsnLoad@Base 6.1.20030421
+ print_pub@Base 6.1.20030421
+ ten_authors@Base 6.1.20030421
+libncbimmdb.so.6 libncbi6 #MINVER#
+ AddLineKin@Base 6.1.20030421
+ AddPFBSelect@Base 6.1.20030421
+ AlgorithmTypeAsnRead@Base 6.1.20031028
+ AlgorithmTypeAsnWrite@Base 6.1.20031028
+ AlgorithmTypeFree@Base 6.1.20031028
+ AlgorithmTypeNew@Base 6.1.20031028
+ AlignAnnotAsnRead@Base 6.1.20030421
+ AlignAnnotAsnWrite@Base 6.1.20030421
+ AlignAnnotFree@Base 6.1.20030421
+ AlignAnnotNew@Base 6.1.20030421
+ AlignAnnotSetAsnRead@Base 6.1.20030421
+ AlignAnnotSetAsnWrite@Base 6.1.20030421
+ AlignAnnotSetFree@Base 6.1.20030421
+ AlignStatsAsnRead@Base 6.1.20030421
+ AlignStatsAsnWrite@Base 6.1.20030421
+ AlignStatsFree@Base 6.1.20030421
+ AlignStatsNew@Base 6.1.20030421
+ AlternateConformationIdsAsnRead@Base 6.1.20030421
+ AlternateConformationIdsAsnWrite@Base 6.1.20030421
+ AlternateConformationIdsFree@Base 6.1.20030421
+ AminoAcidName@Base 6.1.20030421
+ AminoAcidNameFromIdx@Base 6.1.20030421
+ AnisotropicTemperatureFactorsAsnRead@Base 6.1.20030421
+ AnisotropicTemperatureFactorsAsnWrite@Base 6.1.20030421
+ AnisotropicTemperatureFactorsFree@Base 6.1.20030421
+ AnisotropicTemperatureFactorsNew@Base 6.1.20030421
+ AreNeighborsOn@Base 6.1.20030421
+ AssignAtomLocId@Base 6.1.20030421
+ AssignBackBone@Base 6.1.20030421
+ AssignIons@Base 6.1.20030421
+ AssignSurfaceContents@Base 6.1.20030421
+ AssignVirtual@Base 6.1.20030421
+ AtomAsnRead@Base 6.1.20030421
+ AtomAsnWrite@Base 6.1.20030421
+ AtomDistanceSq@Base 6.1.20030421
+ AtomFree@Base 6.1.20030421
+ AtomFromMMDBIndex@Base 6.1.20030421
+ AtomNew@Base 6.1.20030421
+ AtomPntrAsnRead@Base 6.1.20030421
+ AtomPntrAsnWrite@Base 6.1.20030421
+ AtomPntrFree@Base 6.1.20030421
+ AtomPntrNew@Base 6.1.20030421
+ AtomPntrSetAsnRead@Base 6.1.20030421
+ AtomPntrSetAsnWrite@Base 6.1.20030421
+ AtomPntrSetFree@Base 6.1.20030421
+ AtomPntrsAsnRead@Base 6.1.20030421
+ AtomPntrsAsnWrite@Base 6.1.20030421
+ AtomPntrsFree@Base 6.1.20030421
+ AtomPntrsNew@Base 6.1.20030421
+ AtomicCoordinatesAsnRead@Base 6.1.20030421
+ AtomicCoordinatesAsnWrite@Base 6.1.20030421
+ AtomicCoordinatesFree@Base 6.1.20030421
+ AtomicCoordinatesNew@Base 6.1.20030421
+ AtomicOccupanciesAsnRead@Base 6.1.20030421
+ AtomicOccupanciesAsnWrite@Base 6.1.20030421
+ AtomicOccupanciesFree@Base 6.1.20030421
+ AtomicOccupanciesNew@Base 6.1.20030421
+ AtomicTemperatureFactorsAsnRead@Base 6.1.20030421
+ AtomicTemperatureFactorsAsnWrite@Base 6.1.20030421
+ AtomicTemperatureFactorsFree@Base 6.1.20030421
+ AuthorListPDB@Base 6.1.20030421
+ BelongsToSubset@Base 6.1.20030421
+ BiomolDescrAsnRead@Base 6.1.20030421
+ BiomolDescrAsnWrite@Base 6.1.20030421
+ BiomolDescrFree@Base 6.1.20030421
+ BiosToSeq@Base 6.1.20030421
+ BiostrToSeqAnnotSet@Base 6.1.20030421
+ Biostruc2Modelstruc@Base 6.1.20030421
+ BiostrucAddFeature@Base 6.1.20030421
+ BiostrucAlignAsnRead@Base 6.1.20030421
+ BiostrucAlignAsnWrite@Base 6.1.20030421
+ BiostrucAlignFree@Base 6.1.20030421
+ BiostrucAlignNew@Base 6.1.20030421
+ BiostrucAlignSeqAsnRead@Base 6.1.20030421
+ BiostrucAlignSeqAsnWrite@Base 6.1.20030421
+ BiostrucAlignSeqFree@Base 6.1.20030421
+ BiostrucAlignSeqNew@Base 6.1.20030421
+ BiostrucAnnotSetAsnRead@Base 6.1.20030421
+ BiostrucAnnotSetAsnWrite@Base 6.1.20030421
+ BiostrucAnnotSetFree@Base 6.1.20030421
+ BiostrucAnnotSetNew@Base 6.1.20030421
+ BiostrucAnnotSetToSeqAnnot@Base 6.1.20030421
+ BiostrucAsnGet@Base 6.1.20030421
+ BiostrucAsnRead@Base 6.1.20030421
+ BiostrucAsnWrite@Base 6.1.20030421
+ BiostrucAvail@Base 6.1.20030421
+ BiostrucDescrAsnRead@Base 6.1.20030421
+ BiostrucDescrAsnWrite@Base 6.1.20030421
+ BiostrucDescrFree@Base 6.1.20030421
+ BiostrucFeatureAsnRead@Base 6.1.20030421
+ BiostrucFeatureAsnWrite@Base 6.1.20030421
+ BiostrucFeatureFree@Base 6.1.20030421
+ BiostrucFeatureNew@Base 6.1.20030421
+ BiostrucFeatureSetAsnRead@Base 6.1.20030421
+ BiostrucFeatureSetAsnWrite@Base 6.1.20030421
+ BiostrucFeatureSetDescrAsnRead@Base 6.1.20030421
+ BiostrucFeatureSetDescrAsnWrite@Base 6.1.20030421
+ BiostrucFeatureSetDescrFree@Base 6.1.20030421
+ BiostrucFeatureSetFree@Base 6.1.20030421
+ BiostrucFeatureSetNew@Base 6.1.20030421
+ BiostrucFree@Base 6.1.20030421
+ BiostrucGraphAsnRead@Base 6.1.20030421
+ BiostrucGraphAsnWrite@Base 6.1.20030421
+ BiostrucGraphFree@Base 6.1.20030421
+ BiostrucGraphNew@Base 6.1.20030421
+ BiostrucGraphPntrAsnRead@Base 6.1.20030421
+ BiostrucGraphPntrAsnWrite@Base 6.1.20030421
+ BiostrucGraphPntrFree@Base 6.1.20030421
+ BiostrucGraphPntrNew@Base 6.1.20030421
+ BiostrucHistoryAsnRead@Base 6.1.20030421
+ BiostrucHistoryAsnWrite@Base 6.1.20030421
+ BiostrucHistoryFree@Base 6.1.20030421
+ BiostrucHistoryNew@Base 6.1.20030421
+ BiostrucIdAsnRead@Base 6.1.20030421
+ BiostrucIdAsnWrite@Base 6.1.20030421
+ BiostrucIdFree@Base 6.1.20030421
+ BiostrucModel2ModelStruc@Base 6.1.20030421
+ BiostrucModelAsnRead@Base 6.1.20030421
+ BiostrucModelAsnWrite@Base 6.1.20030421
+ BiostrucModelFree@Base 6.1.20030421
+ BiostrucModelNew@Base 6.1.20030421
+ BiostrucMoleculePntrAsnRead@Base 6.1.20110713
+ BiostrucMoleculePntrAsnWrite@Base 6.1.20110713
+ BiostrucMoleculePntrFree@Base 6.1.20110713
+ BiostrucMoleculePntrNew@Base 6.1.20110713
+ BiostrucNew@Base 6.1.20030421
+ BiostrucReplaceAsnRead@Base 6.1.20030421
+ BiostrucReplaceAsnWrite@Base 6.1.20030421
+ BiostrucReplaceFree@Base 6.1.20030421
+ BiostrucReplaceNew@Base 6.1.20030421
+ BiostrucResidueGraphSetAsnRead@Base 6.1.20030421
+ BiostrucResidueGraphSetAsnWrite@Base 6.1.20030421
+ BiostrucResidueGraphSetFree@Base 6.1.20030421
+ BiostrucResidueGraphSetNew@Base 6.1.20030421
+ BiostrucResidueGraphSetPntrAsnRead@Base 6.1.20030421
+ BiostrucResidueGraphSetPntrAsnWrite@Base 6.1.20030421
+ BiostrucResidueGraphSetPntrFree@Base 6.1.20030421
+ BiostrucResidueGraphSetPntrNew@Base 6.1.20030421
+ BiostrucScriptAsnRead@Base 6.1.20030421
+ BiostrucScriptAsnWrite@Base 6.1.20030421
+ BiostrucScriptFree@Base 6.1.20030421
+ BiostrucScriptStepAsnRead@Base 6.1.20030421
+ BiostrucScriptStepAsnWrite@Base 6.1.20030421
+ BiostrucScriptStepFree@Base 6.1.20030421
+ BiostrucScriptStepNew@Base 6.1.20030421
+ BiostrucSeqAsnRead@Base 6.1.20030421
+ BiostrucSeqAsnWrite@Base 6.1.20030421
+ BiostrucSeqFree@Base 6.1.20030421
+ BiostrucSeqNew@Base 6.1.20030421
+ BiostrucSeqsAlignsCddAsnRead@Base 6.1.20030421
+ BiostrucSeqsAlignsCddAsnWrite@Base 6.1.20030421
+ BiostrucSeqsAlignsCddFree@Base 6.1.20030421
+ BiostrucSeqsAlignsCddNew@Base 6.1.20030421
+ BiostrucSeqsAsnRead@Base 6.1.20030421
+ BiostrucSeqsAsnWrite@Base 6.1.20030421
+ BiostrucSeqsFree@Base 6.1.20030421
+ BiostrucSeqsNew@Base 6.1.20030421
+ BiostrucSetAsnRead@Base 6.1.20030421
+ BiostrucSetAsnWrite@Base 6.1.20030421
+ BiostrucSetFree@Base 6.1.20030421
+ BiostrucSetNew@Base 6.1.20030421
+ BiostrucSourceAsnRead@Base 6.1.20030421
+ BiostrucSourceAsnWrite@Base 6.1.20030421
+ BiostrucSourceFree@Base 6.1.20030421
+ BiostrucSourceNew@Base 6.1.20030421
+ BrickAsnRead@Base 6.1.20030421
+ BrickAsnWrite@Base 6.1.20030421
+ BrickFree@Base 6.1.20030421
+ BrickNew@Base 6.1.20030421
+ BundleSeqsAlignsAsnRead@Base 6.1.20030421
+ BundleSeqsAlignsAsnWrite@Base 6.1.20030421
+ BundleSeqsAlignsFree@Base 6.1.20030421
+ BundleSeqsAlignsNew@Base 6.1.20030421
+ Call3DColorProc@Base 6.1.20030421
+ CameraAsnRead@Base 6.1.20030421
+ CameraAsnWrite@Base 6.1.20030421
+ CameraFree@Base 6.1.20030421
+ CameraNew@Base 6.1.20030421
+ CddAccFromPssmId@Base 6.1.20030421
+ CddAlignInform@Base 6.1.20030421
+ CddAsnRead@Base 6.1.20030421
+ CddAsnWrite@Base 6.1.20030421
+ CddAssignDescr@Base 6.1.20030421
+ CddAssignProfileRange@Base 6.1.20030421
+ CddBioseqCopy@Base 6.1.20030421
+ CddBookRefAsnRead@Base 6.1.20031028
+ CddBookRefAsnWrite@Base 6.1.20031028
+ CddBookRefFree@Base 6.1.20031028
+ CddBookRefNew@Base 6.1.20031028
+ CddCalcPSSM@Base 6.1.20030421
+ CddCalculateQuerySim@Base 6.1.20030421
+ CddCalculateTriangle@Base 6.1.20030421
+ CddCheckForRepeats@Base 6.1.20030421
+ CddConsensus@Base 6.1.20030421
+ CddCopyMSLDenDiag@Base 6.1.20030421
+ CddCount3DAlignments@Base 6.1.20030421
+ CddCountDenDiagSeqAligns@Base 6.1.20030421
+ CddCountResTypes@Base 6.1.20040204
+ CddCountSeqAligns@Base 6.1.20030421
+ CddCposComp@Base 6.1.20030421
+ CddCposComputation@Base 6.1.20030421
+ CddDegapSeqAlign@Base 6.1.20030421
+ CddDenDiagCposComp2@Base 6.1.20030421
+ CddDenDiagCposComp2KBP@Base 6.1.20030421
+ CddDenDiagCposComputation@Base 6.1.20030421
+ CddDescrAsnRead@Base 6.1.20030421
+ CddDescrAsnWrite@Base 6.1.20030421
+ CddDescrFree@Base 6.1.20030421
+ CddDescrSetAsnRead@Base 6.1.20030421
+ CddDescrSetAsnWrite@Base 6.1.20030421
+ CddDescrSetFree@Base 6.1.20030421
+ CddDumpPMLinks@Base 6.1.20030421
+ CddDumpTaxLinks@Base 6.1.20030421
+ CddDumpXML@Base 6.1.20030421
+ CddExpAlignAlloc@Base 6.1.20030421
+ CddExpAlignFree@Base 6.1.20030421
+ CddExpAlignNew@Base 6.1.20030421
+ CddExpAlignToSeqAlign@Base 6.1.20030421
+ CddExtractBioseq@Base 6.1.20030421
+ CddFeaturesAreConsistent@Base 6.1.20030421
+ CddFillBlanksInString@Base 6.1.20030421
+ CddFindBioseqInSeqEntry@Base 6.1.20030421
+ CddFindMMDBIdInBioseq@Base 6.1.20030421
+ CddFindSip@Base 6.1.20030421
+ CddFree@Base 6.1.20030421
+ CddFreeCarefully@Base 6.1.20030421
+ CddGetAccession@Base 6.1.20030421
+ CddGetAlignmentLength@Base 6.1.20030421
+ CddGetAnnotNames@Base 6.1.20030421
+ CddGetCreateDate@Base 6.1.20030421
+ CddGetDescr@Base 6.1.20030421
+ CddGetFeatLocList@Base 6.1.20030421
+ CddGetNewIndexForThreading@Base 6.1.20030421
+ CddGetOrgRef@Base 6.1.20030421
+ CddGetPairId@Base 6.1.20030421
+ CddGetPdbSeqId@Base 6.1.20030421
+ CddGetPmIds@Base 6.1.20030421
+ CddGetProperBlocks@Base 6.1.20030421
+ CddGetPssmId@Base 6.1.20030421
+ CddGetSource@Base 6.1.20030421
+ CddGetSourceId@Base 6.1.20030421
+ CddGetStatus@Base 6.1.20030421
+ CddGetUpdateDate@Base 6.1.20030421
+ CddGetVersion@Base 6.1.20030421
+ CddHas3DSuperpos@Base 6.1.20030421
+ CddHasAnnotation@Base 6.1.20030421
+ CddHasConsensus@Base 6.1.20030421
+ CddHasDescription@Base 6.1.20030421
+ CddHasPendingAlignments@Base 6.1.20030421
+ CddIdAsnRead@Base 6.1.20030421
+ CddIdAsnWrite@Base 6.1.20030421
+ CddIdFree@Base 6.1.20030421
+ CddIdSetAsnRead@Base 6.1.20030421
+ CddIdSetAsnWrite@Base 6.1.20030421
+ CddIdSetFree@Base 6.1.20030421
+ CddIdxDataLink@Base 6.1.20030421
+ CddIdxDataNew@Base 6.1.20030421
+ CddKillDescr@Base 6.1.20030421
+ CddMSLDenDiagToMSLDenSeg@Base 6.1.20030421
+ CddMSLDenDiagToMULDenDiag@Base 6.1.20030421
+ CddMSLDenSegToMSLDenDiag@Base 6.1.20030421
+ CddMSLMixedToMSLDenDiag@Base 6.1.20030421
+ CddMasterIs3D@Base 6.1.20030421
+ CddMostDiverse@Base 6.1.20030421
+ CddMostSimilarToQuery@Base 6.1.20030421
+ CddNew@Base 6.1.20030421
+ CddOrgRefAsnRead@Base 6.1.20040204
+ CddOrgRefAsnWrite@Base 6.1.20040204
+ CddOrgRefFree@Base 6.1.20040204
+ CddOrgRefNew@Base 6.1.20040204
+ CddOrgRefSetAsnRead@Base 6.1.20040204
+ CddOrgRefSetAsnWrite@Base 6.1.20040204
+ CddOrgRefSetFree@Base 6.1.20040204
+ CddPosFreqInform@Base 6.1.20030421
+ CddPrefNodeDescrAsnRead@Base 6.1.20040204
+ CddPrefNodeDescrAsnWrite@Base 6.1.20040204
+ CddPrefNodeDescrFree@Base 6.1.20040204
+ CddPrefNodeDescrSetAsnRead@Base 6.1.20040204
+ CddPrefNodeDescrSetAsnWrite@Base 6.1.20040204
+ CddPrefNodeDescrSetFree@Base 6.1.20040204
+ CddPrefNodesAsnRead@Base 6.1.20040204
+ CddPrefNodesAsnWrite@Base 6.1.20040204
+ CddPrefNodesFree@Base 6.1.20040204
+ CddPrefNodesNew@Base 6.1.20040204
+ CddProjectAsnRead@Base 6.1.20040505
+ CddProjectAsnWrite@Base 6.1.20040505
+ CddProjectFree@Base 6.1.20040505
+ CddProjectNew@Base 6.1.20040505
+ CddPssmIdFromAcc@Base 6.1.20030421
+ CddPssmInform@Base 6.1.20030421
+ CddReadDBGetBioseq@Base 6.1.20030421
+ CddReadDBGetBioseqEx@Base 6.1.20031028
+ CddReadFromFile@Base 6.1.20030421
+ CddReadIdx@Base 6.1.20030421
+ CddRegularizeFileName@Base 6.1.20030421
+ CddReindexExpAlign@Base 6.1.20030421
+ CddReindexMSLDenDiagMaster@Base 6.1.20030421
+ CddReindexMSLDenSegMaster@Base 6.1.20030421
+ CddReindexSeqAlign@Base 6.1.20030421
+ CddRemoveConsensus@Base 6.1.20030421
+ CddRepeatAsnRead@Base 6.1.20030421
+ CddRepeatAsnWrite@Base 6.1.20030421
+ CddRepeatFree@Base 6.1.20030421
+ CddRepeatNew@Base 6.1.20030421
+ CddRetrieveBioseqById@Base 6.1.20030421
+ CddSameSip@Base 6.1.20030421
+ CddScriptAsnRead@Base 6.1.20040505
+ CddScriptAsnWrite@Base 6.1.20040505
+ CddScriptFree@Base 6.1.20040505
+ CddScriptNew@Base 6.1.20040505
+ CddSeqAlignDup@Base 6.1.20030421
+ CddSeqAnnotForSeqAlign@Base 6.1.20030421
+ CddSeqIdDupPDBGI@Base 6.1.20030421
+ CddSetAsnRead@Base 6.1.20030421
+ CddSetAsnWrite@Base 6.1.20030421
+ CddSetFree@Base 6.1.20030421
+ CddSetUpSearchWithReadDb@Base 6.1.20030421
+ CddSevError@Base 6.1.20030421
+ CddShrinkBioseq@Base 6.1.20030421
+ CddSimpleHtmlError@Base 6.1.20030421
+ CddTransferAlignAnnot@Base 6.1.20030421
+ CddTreeAsnRead@Base 6.1.20030421
+ CddTreeAsnWrite@Base 6.1.20030421
+ CddTreeFree@Base 6.1.20030421
+ CddTreeNew@Base 6.1.20030421
+ CddTreeReadFromFile@Base 6.1.20030421
+ CddTreeSetAsnRead@Base 6.1.20030421
+ CddTreeSetAsnWrite@Base 6.1.20030421
+ CddTreeSetFree@Base 6.1.20030421
+ CddTreeWriteToFile@Base 6.1.20030421
+ CddTrimSeqAligns@Base 6.1.20030421
+ CddTruncStringAtFirstPunct@Base 6.1.20030421
+ CddViewerAsnRead@Base 6.1.20040505
+ CddViewerAsnWrite@Base 6.1.20040505
+ CddViewerFree@Base 6.1.20040505
+ CddViewerNew@Base 6.1.20040505
+ CddViewerRectAsnRead@Base 6.1.20040505
+ CddViewerRectAsnWrite@Base 6.1.20040505
+ CddViewerRectFree@Base 6.1.20040505
+ CddViewerRectNew@Base 6.1.20040505
+ CddWriteToFile@Base 6.1.20030421
+ CddcopySearchItems@Base 6.1.20030421
+ CddfindDenseDiagThreshSequences@Base 6.1.20030421
+ CddfindThreshSequences@Base 6.1.20030421
+ CddposAllocateMemory@Base 6.1.20030421
+ CddposCheckWeights@Base 6.1.20030421
+ CddposComputeExtents@Base 6.1.20030421
+ CddposComputePseudoFreqs@Base 6.1.20030421
+ CddposComputeSequenceWeights@Base 6.1.20030421
+ CddposDemographics@Base 6.1.20030421
+ CddposDenseDiagDemographics@Base 6.1.20030421
+ CddposFreeMemory2@Base 6.1.20030421
+ CddposFreeMemory@Base 6.1.20030421
+ CddposFreqsToMatrix@Base 6.1.20030421
+ CddposInitializeInformation@Base 6.1.20030421
+ CddposProcessAlignment@Base 6.1.20030421
+ CddposPurgeMatches@Base 6.1.20030421
+ CddposScaling@Base 6.1.20030421
+ CddposTakeCheckpoint@Base 6.1.20030421
+ ChangeMMDBAPIbExtent@Base 6.1.20030421
+ ChemGraphAlignmentAsnRead@Base 6.1.20030421
+ ChemGraphAlignmentAsnWrite@Base 6.1.20030421
+ ChemGraphAlignmentFree@Base 6.1.20030421
+ ChemGraphAlignmentNew@Base 6.1.20030421
+ ChemGraphInteractionAsnRead@Base 6.1.20110713
+ ChemGraphInteractionAsnWrite@Base 6.1.20110713
+ ChemGraphInteractionFree@Base 6.1.20110713
+ ChemGraphInteractionNew@Base 6.1.20110713
+ ChemGraphPntrsAsnRead@Base 6.1.20030421
+ ChemGraphPntrsAsnWrite@Base 6.1.20030421
+ ChemGraphPntrsFree@Base 6.1.20030421
+ ChiralCenterAsnRead@Base 6.1.20030421
+ ChiralCenterAsnWrite@Base 6.1.20030421
+ ChiralCenterFree@Base 6.1.20030421
+ ChiralCenterNew@Base 6.1.20030421
+ ClearPFBSelectList@Base 6.1.20030421
+ ClearStructures@Base 6.1.20030421
+ CloseMMDBAPI@Base 6.1.20030421
+ Cn3dBackboneLabelStyleAsnRead@Base 6.1.20030421
+ Cn3dBackboneLabelStyleAsnWrite@Base 6.1.20030421
+ Cn3dBackboneLabelStyleFree@Base 6.1.20030421
+ Cn3dBackboneLabelStyleNew@Base 6.1.20030421
+ Cn3dBackboneStyleAsnRead@Base 6.1.20030421
+ Cn3dBackboneStyleAsnWrite@Base 6.1.20030421
+ Cn3dBackboneStyleFree@Base 6.1.20030421
+ Cn3dBackboneStyleNew@Base 6.1.20030421
+ Cn3dColorAsnRead@Base 6.1.20030421
+ Cn3dColorAsnWrite@Base 6.1.20030421
+ Cn3dColorFree@Base 6.1.20030421
+ Cn3dColorNew@Base 6.1.20030421
+ Cn3dGLMatrixAsnRead@Base 6.1.20030421
+ Cn3dGLMatrixAsnWrite@Base 6.1.20030421
+ Cn3dGLMatrixFree@Base 6.1.20030421
+ Cn3dGLMatrixNew@Base 6.1.20030421
+ Cn3dGeneralStyleAsnRead@Base 6.1.20030421
+ Cn3dGeneralStyleAsnWrite@Base 6.1.20030421
+ Cn3dGeneralStyleFree@Base 6.1.20030421
+ Cn3dGeneralStyleNew@Base 6.1.20030421
+ Cn3dMoleculeLocationAsnRead@Base 6.1.20030421
+ Cn3dMoleculeLocationAsnWrite@Base 6.1.20030421
+ Cn3dMoleculeLocationFree@Base 6.1.20030421
+ Cn3dMoleculeLocationNew@Base 6.1.20030421
+ Cn3dObjectLocationAsnRead@Base 6.1.20030421
+ Cn3dObjectLocationAsnWrite@Base 6.1.20030421
+ Cn3dObjectLocationFree@Base 6.1.20030421
+ Cn3dObjectLocationNew@Base 6.1.20030421
+ Cn3dResidueRangeAsnRead@Base 6.1.20030421
+ Cn3dResidueRangeAsnWrite@Base 6.1.20030421
+ Cn3dResidueRangeFree@Base 6.1.20030421
+ Cn3dResidueRangeNew@Base 6.1.20030421
+ Cn3dStyleDictionaryAsnRead@Base 6.1.20030421
+ Cn3dStyleDictionaryAsnWrite@Base 6.1.20030421
+ Cn3dStyleDictionaryFree@Base 6.1.20030421
+ Cn3dStyleDictionaryNew@Base 6.1.20030421
+ Cn3dStyleSettingsAsnRead@Base 6.1.20030421
+ Cn3dStyleSettingsAsnWrite@Base 6.1.20030421
+ Cn3dStyleSettingsFree@Base 6.1.20030421
+ Cn3dStyleSettingsNew@Base 6.1.20030421
+ Cn3dStyleSettingsSetAsnRead@Base 6.1.20030421
+ Cn3dStyleSettingsSetAsnWrite@Base 6.1.20030421
+ Cn3dStyleSettingsSetFree@Base 6.1.20030421
+ Cn3dStyleTableItemAsnRead@Base 6.1.20030421
+ Cn3dStyleTableItemAsnWrite@Base 6.1.20030421
+ Cn3dStyleTableItemFree@Base 6.1.20030421
+ Cn3dStyleTableItemNew@Base 6.1.20030421
+ Cn3dUserAnnotationAsnRead@Base 6.1.20030421
+ Cn3dUserAnnotationAsnWrite@Base 6.1.20030421
+ Cn3dUserAnnotationFree@Base 6.1.20030421
+ Cn3dUserAnnotationNew@Base 6.1.20030421
+ Cn3dUserAnnotationsAsnRead@Base 6.1.20030421
+ Cn3dUserAnnotationsAsnWrite@Base 6.1.20030421
+ Cn3dUserAnnotationsFree@Base 6.1.20030421
+ Cn3dUserAnnotationsNew@Base 6.1.20030421
+ Cn3dVectorAsnRead@Base 6.1.20030421
+ Cn3dVectorAsnWrite@Base 6.1.20030421
+ Cn3dVectorFree@Base 6.1.20030421
+ Cn3dVectorNew@Base 6.1.20030421
+ Cn3dViewSettingsAsnRead@Base 6.1.20030421
+ Cn3dViewSettingsAsnWrite@Base 6.1.20030421
+ Cn3dViewSettingsFree@Base 6.1.20030421
+ Cn3dViewSettingsNew@Base 6.1.20030421
+ ColorNumKinAC@Base 6.1.20030421
+ ColorNumKinBB@Base 6.1.20030421
+ ColorNumKinSC@Base 6.1.20030421
+ ColorPropAsnRead@Base 6.1.20030421
+ ColorPropAsnWrite@Base 6.1.20030421
+ ColorPropFree@Base 6.1.20030421
+ ColorPropNew@Base 6.1.20030421
+ CompareScores@Base 6.1.20030421
+ ConeAsnRead@Base 6.1.20030421
+ ConeAsnWrite@Base 6.1.20030421
+ ConeFree@Base 6.1.20030421
+ ConeNew@Base 6.1.20030421
+ ConformationEnsembleAsnRead@Base 6.1.20030421
+ ConformationEnsembleAsnWrite@Base 6.1.20030421
+ ConformationEnsembleFree@Base 6.1.20030421
+ ConformationEnsembleNew@Base 6.1.20030421
+ CoordinatesAsnRead@Base 6.1.20030421
+ CoordinatesAsnWrite@Base 6.1.20030421
+ CoordinatesFree@Base 6.1.20030421
+ CopyResult@Base 6.1.20030421
+ CountModelstrucs@Base 6.1.20030421
+ CylinderAsnRead@Base 6.1.20030421
+ CylinderAsnWrite@Base 6.1.20030421
+ CylinderFree@Base 6.1.20030421
+ CylinderNew@Base 6.1.20030421
+ DNFromPFB@Base 6.1.20030421
+ DVNodeListAppend@Base 6.1.20030421
+ DVNodeListLen@Base 6.1.20030421
+ DValNodeAdd@Base 6.1.20030421
+ DValNodeAddBoolean@Base 6.1.20030421
+ DValNodeAddFloat@Base 6.1.20030421
+ DValNodeAddFunction@Base 6.1.20030421
+ DValNodeAddInt@Base 6.1.20030421
+ DValNodeAddPointer@Base 6.1.20030421
+ DValNodeAddStr@Base 6.1.20030421
+ DValNodeCopyStr@Base 6.1.20030421
+ DValNodeExtract@Base 6.1.20030421
+ DValNodeExtractList@Base 6.1.20030421
+ DValNodeFindNext@Base 6.1.20030421
+ DValNodeFree@Base 6.1.20030421
+ DValNodeFreeData@Base 6.1.20030421
+ DValNodeHeadLink@Base 6.1.20030421
+ DValNodeInsert@Base 6.1.20030421
+ DValNodeLink@Base 6.1.20030421
+ DValNodeListCat@Base 6.1.20030421
+ DValNodeListCut@Base 6.1.20030421
+ DValNodeListDelNode@Base 6.1.20030421
+ DValNodeListInsert@Base 6.1.20030421
+ DValNodeNew@Base 6.1.20030421
+ DValNodeRead@Base 6.1.20030421
+ DValNodeUnlink@Base 6.1.20030421
+ DValNodeWrite@Base 6.1.20030421
+ DensityCoordinatesAsnRead@Base 6.1.20030421
+ DensityCoordinatesAsnWrite@Base 6.1.20030421
+ DensityCoordinatesFree@Base 6.1.20030421
+ DensityCoordinatesNew@Base 6.1.20030421
+ DoApplyTransform@Base 6.1.20030421
+ DoReverseTransform@Base 6.1.20030421
+ DoesFeatureTypeHaveFuncs@Base 6.1.20030421
+ DomainParentAsnRead@Base 6.1.20031028
+ DomainParentAsnWrite@Base 6.1.20031028
+ DomainParentFree@Base 6.1.20031028
+ DomainParentNew@Base 6.1.20031028
+ ElementKinColors@Base 6.1.20030421
+ ElementName@Base 6.1.20030421
+ ElementSize@Base 6.1.20030421
+ EntrezGeneralAsnRead@Base 6.1.20030421
+ EntrezGeneralAsnWrite@Base 6.1.20030421
+ EntrezGeneralFree@Base 6.1.20030421
+ EntrezGeneralNew@Base 6.1.20030421
+ FHConvtFree@Base 6.1.20030421
+ FHConvtMatrix@Base 6.1.20030421
+ FHMatrix@Base 6.1.20030421
+ FHMatrixFree@Base 6.1.20030421
+ FHVector@Base 6.1.20030421
+ FHVectorFree@Base 6.1.20030421
+ FL3Matrix@Base 6.1.20030421
+ FL3MatrixFree@Base 6.1.20030421
+ FLConvtFree@Base 6.1.20030421
+ FLConvtMatrix@Base 6.1.20030421
+ FLMatrix@Base 6.1.20030421
+ FLMatrixFree@Base 6.1.20030421
+ FLSubmatrix@Base 6.1.20030421
+ FLSubmatrixFree@Base 6.1.20030421
+ FLVector@Base 6.1.20030421
+ FLVectorFree@Base 6.1.20030421
+ FeatureEvidenceAsnRead@Base 6.1.20030421
+ FeatureEvidenceAsnWrite@Base 6.1.20030421
+ FeatureEvidenceFree@Base 6.1.20030421
+ FetchBS@Base 6.1.20030421
+ FetchBiostrucPDB@Base 6.1.20030421
+ FillSurface@Base 6.1.20030421
+ FindLoadedBiostruc@Base 6.1.20030421
+ FindMolByChar@Base 6.1.20030421
+ FreeALD@Base 6.1.20030421
+ FreeAModelstruc@Base 6.1.20030421
+ FreeAtomicModelAsnLists@Base 6.1.20030421
+ FreeCorDef@Base 6.1.20030421
+ FreeDNMG@Base 6.1.20030421
+ FreeDNMM@Base 6.1.20030421
+ FreeDNMS@Base 6.1.20030421
+ FreeDNTRN@Base 6.1.20030421
+ FreeFldMtf@Base 6.1.20030421
+ FreeGibScd@Base 6.1.20030421
+ FreeKeptFeature@Base 6.1.20030421
+ FreeListDNMG@Base 6.1.20030421
+ FreeListDNML@Base 6.1.20030421
+ FreeListDNMM@Base 6.1.20030421
+ FreeListDNMS@Base 6.1.20030421
+ FreeListDNSF@Base 6.1.20030421
+ FreeListDNSFS@Base 6.1.20030421
+ FreeListVNAL@Base 6.1.20030421
+ FreeListVNMA@Base 6.1.20030421
+ FreeListVNMB@Base 6.1.20030421
+ FreeListVNMD@Base 6.1.20030421
+ FreeListVNMO@Base 6.1.20030421
+ FreeListVNSFF@Base 6.1.20030421
+ FreeMAD@Base 6.1.20030421
+ FreeMBD@Base 6.1.20030421
+ FreeMDD@Base 6.1.20030421
+ FreeMGD@Base 6.1.20030421
+ FreeMLD@Base 6.1.20030421
+ FreeMMD@Base 6.1.20030421
+ FreeMOD@Base 6.1.20030421
+ FreeMSD@Base 6.1.20030421
+ FreeQrySeq@Base 6.1.20030421
+ FreeRcxPtl@Base 6.1.20030421
+ FreeRedundantAsn@Base 6.1.20030421
+ FreeSFD@Base 6.1.20030421
+ FreeSFF@Base 6.1.20030421
+ FreeSFS@Base 6.1.20030421
+ FreeSeqMtf@Base 6.1.20030421
+ FreeSingleModel@Base 6.1.20030421
+ FreeSurfaceModelAsnList@Base 6.1.20030421
+ FreeThdTbl@Base 6.1.20030421
+ FreeVNDataFn@Base 6.1.20030421
+ GLMatrixAsnRead@Base 6.1.20030421
+ GLMatrixAsnWrite@Base 6.1.20030421
+ GLMatrixFree@Base 6.1.20030421
+ GLMatrixNew@Base 6.1.20030421
+ GetActiveModel@Base 6.1.20030421
+ GetAlignmentSize@Base 6.1.20030421
+ GetAtomLocs@Base 6.1.20030421
+ GetFirstGraph@Base 6.1.20030421
+ GetFirstModelstruc@Base 6.1.20030421
+ GetKinMolName@Base 6.1.20030421
+ GetLastGraph@Base 6.1.20030421
+ GetLocation@Base 6.1.20030421
+ GetMGFromMM@Base 6.1.20030421
+ GetMMDBAPIbExtent@Base 6.1.20030421
+ GetMMFromMSDBySeqId@Base 6.1.20030421
+ GetMainAtom@Base 6.1.20030421
+ GetMasterModelstruc@Base 6.1.20030421
+ GetNextGraph@Base 6.1.20030421
+ GetNextModelstruc@Base 6.1.20030421
+ GetNumberOfDomains@Base 6.1.20030421
+ GetNumberOfSubsets@Base 6.1.20030421
+ GetPDNMSMain@Base 6.1.20030421
+ GetPRGDDictionary@Base 6.1.20030421
+ GetParentGraph@Base 6.1.20030421
+ GetParentMol@Base 6.1.20030421
+ GetPrevGraph@Base 6.1.20030421
+ GetPreviousModelstruc@Base 6.1.20030421
+ GetSelectedModelstruc@Base 6.1.20030421
+ GetSlaveModelstruc@Base 6.1.20030421
+ GetStrucStrings@Base 6.1.20030421
+ GetSubsetName@Base 6.1.20030421
+ GetSubsetNum@Base 6.1.20030421
+ GlobalIdAsnRead@Base 6.1.20030421
+ GlobalIdAsnWrite@Base 6.1.20030421
+ GlobalIdFree@Base 6.1.20030421
+ GlobalIdNew@Base 6.1.20030421
+ GraphFromMMDBIndex@Base 6.1.20030421
+ I2ConvtFree@Base 6.1.20030421
+ I2ConvtMatrix@Base 6.1.20030421
+ I2Matrix@Base 6.1.20030421
+ I2MatrixFree@Base 6.1.20030421
+ I2Vector@Base 6.1.20030421
+ I2VectorFree@Base 6.1.20030421
+ I4ConvtFree@Base 6.1.20030421
+ I4ConvtMatrix@Base 6.1.20030421
+ I4Matrix@Base 6.1.20030421
+ I4MatrixFree@Base 6.1.20030421
+ I4Vector@Base 6.1.20030421
+ I4VectorFree@Base 6.1.20030421
+ IndexFromNode@Base 6.1.20030421
+ InstBSAnnotSet@Base 6.1.20030421
+ InstallAlignedSlave@Base 6.1.20030421
+ InstallStrucFeature@Base 6.1.20030421
+ InterResidueBondAsnRead@Base 6.1.20030421
+ InterResidueBondAsnWrite@Base 6.1.20030421
+ InterResidueBondFree@Base 6.1.20030421
+ InterResidueBondNew@Base 6.1.20030421
+ IntraResidueBondAsnRead@Base 6.1.20030421
+ IntraResidueBondAsnWrite@Base 6.1.20030421
+ IntraResidueBondFree@Base 6.1.20030421
+ IntraResidueBondNew@Base 6.1.20030421
+ InvertCddExpAlign@Base 6.1.20030421
+ IsMMDBAPIOpen@Base 6.1.20030421
+ IsotropicTemperatureFactorsAsnRead@Base 6.1.20030421
+ IsotropicTemperatureFactorsAsnWrite@Base 6.1.20030421
+ IsotropicTemperatureFactorsFree@Base 6.1.20030421
+ IsotropicTemperatureFactorsNew@Base 6.1.20030421
+ KinAAColor@Base 6.1.20030421
+ KinAtoms@Base 6.1.20030421
+ KinColorFromSS@Base 6.1.20030421
+ KinNAColor@Base 6.1.20030421
+ KineColors@Base 6.1.20030421
+ LinkAlpha@Base 6.1.20030421
+ LoadDict@Base 6.1.20030421
+ LoadSubsetTable@Base 6.1.20030421
+ MMDBBiostrucGet@Base 6.1.20030421
+ MMDBEvalPDB@Base 6.1.20030421
+ MMDBFini@Base 6.1.20030421
+ MMDBInit@Base 6.1.20030421
+ MMDB_configuration@Base 6.1.20030421
+ MakeAModelstruc@Base 6.1.20030421
+ MakeChemGraphNodeList@Base 6.1.20030421
+ MakeHashChange@Base 6.1.20030421
+ MakePDBSeqId2@Base 6.1.20030421
+ MakeRegionNodeList@Base 6.1.20030421
+ MatrixAsnRead@Base 6.1.20030421
+ MatrixAsnWrite@Base 6.1.20030421
+ MatrixFree@Base 6.1.20030421
+ MatrixNew@Base 6.1.20030421
+ ModelCoordinateSetAsnRead@Base 6.1.20030421
+ ModelCoordinateSetAsnWrite@Base 6.1.20030421
+ ModelCoordinateSetFree@Base 6.1.20030421
+ ModelCoordinateSetNew@Base 6.1.20030421
+ ModelDescrAsnRead@Base 6.1.20030421
+ ModelDescrAsnWrite@Base 6.1.20030421
+ ModelDescrFree@Base 6.1.20030421
+ ModelSpaceAsnRead@Base 6.1.20030421
+ ModelSpaceAsnWrite@Base 6.1.20030421
+ ModelSpaceFree@Base 6.1.20030421
+ ModelSpaceNew@Base 6.1.20030421
+ ModelSpacePointAsnRead@Base 6.1.20030421
+ ModelSpacePointAsnWrite@Base 6.1.20030421
+ ModelSpacePointFree@Base 6.1.20030421
+ ModelSpacePointNew@Base 6.1.20030421
+ ModelSpacePointsAsnRead@Base 6.1.20030421
+ ModelSpacePointsAsnWrite@Base 6.1.20030421
+ ModelSpacePointsFree@Base 6.1.20030421
+ ModelSpacePointsNew@Base 6.1.20030421
+ MolFromMMDBIndex@Base 6.1.20030421
+ MolFromPDBChain@Base 6.1.20030421
+ MoleculeGraphAsnRead@Base 6.1.20030421
+ MoleculeGraphAsnWrite@Base 6.1.20030421
+ MoleculeGraphFree@Base 6.1.20030421
+ MoleculeGraphNew@Base 6.1.20030421
+ MoleculePntrsAsnRead@Base 6.1.20030421
+ MoleculePntrsAsnWrite@Base 6.1.20030421
+ MoleculePntrsFree@Base 6.1.20030421
+ MoleculePntrsNew@Base 6.1.20030421
+ MoveAsnRead@Base 6.1.20030421
+ MoveAsnWrite@Base 6.1.20030421
+ MoveFree@Base 6.1.20030421
+ NCBI4naLC@Base 6.1.20030421
+ NCBI4naUC@Base 6.1.20030421
+ NCBIstdaaLC@Base 6.1.20030421
+ NCBIstdaaUC@Base 6.1.20030421
+ NameFromSS@Base 6.1.20030421
+ NcbiMimeAsn1AsnRead@Base 6.1.20030421
+ NcbiMimeAsn1AsnWrite@Base 6.1.20030421
+ NcbiMimeAsn1Free@Base 6.1.20030421
+ NewALD@Base 6.1.20030421
+ NewCorDef@Base 6.1.20030421
+ NewDNMG@Base 6.1.20030421
+ NewDNMM@Base 6.1.20030421
+ NewDNMS@Base 6.1.20030421
+ NewDNSFS@Base 6.1.20030421
+ NewDNTRN@Base 6.1.20030421
+ NewFldMtf@Base 6.1.20030421
+ NewGibScd@Base 6.1.20030421
+ NewMAD@Base 6.1.20030421
+ NewMBD@Base 6.1.20030421
+ NewMDD@Base 6.1.20030421
+ NewMGD@Base 6.1.20030421
+ NewMLD@Base 6.1.20030421
+ NewMMD@Base 6.1.20030421
+ NewMMDBAPI@Base 6.1.20030421
+ NewMOD@Base 6.1.20030421
+ NewMSD@Base 6.1.20030421
+ NewQrySeq@Base 6.1.20030421
+ NewRcxPtl@Base 6.1.20030421
+ NewSFD@Base 6.1.20030421
+ NewSFF@Base 6.1.20030421
+ NewSFS@Base 6.1.20030421
+ NewSeqMtf@Base 6.1.20030421
+ NewThdTbl@Base 6.1.20030421
+ NewVNAL@Base 6.1.20030421
+ NewVNMA@Base 6.1.20030421
+ NewVNMB@Base 6.1.20030421
+ NewVNMD@Base 6.1.20030421
+ NewVNMO@Base 6.1.20030421
+ NewVNSFF@Base 6.1.20030421
+ NodeAnnotationAsnRead@Base 6.1.20031028
+ NodeAnnotationAsnWrite@Base 6.1.20031028
+ NodeAnnotationFree@Base 6.1.20031028
+ NodeAnnotationNew@Base 6.1.20031028
+ OpenMMDBAPI@Base 6.1.20030421
+ OrderThdTbl@Base 6.1.20030421
+ OtherFeatureAsnRead@Base 6.1.20030421
+ OtherFeatureAsnWrite@Base 6.1.20030421
+ OtherFeatureFree@Base 6.1.20030421
+ OtherFeatureNew@Base 6.1.20030421
+ PDBConnect@Base 6.1.20030421
+ PFBFromDN@Base 6.1.20030421
+ PFBFromVN@Base 6.1.20030421
+ PTRVector@Base 6.1.20030421
+ PTRVectorFree@Base 6.1.20030421
+ ParentGraphIUPAC1@Base 6.1.20030421
+ ParentGraphNum@Base 6.1.20030421
+ ParentGraphPDBName@Base 6.1.20030421
+ ParentGraphPDBNo@Base 6.1.20030421
+ ParentMolName@Base 6.1.20030421
+ ParentMolNum@Base 6.1.20030421
+ ParentStrucName@Base 6.1.20030421
+ PrintCorDef@Base 6.1.20030421
+ PrintFldMtf@Base 6.1.20030421
+ PrintQrySeq@Base 6.1.20030421
+ PrintSeqMtf@Base 6.1.20030421
+ PrintThdTbl@Base 6.1.20030421
+ PruneBiostruc@Base 6.1.20030421
+ Rand01@Base 6.1.20030421
+ RealValueAsnRead@Base 6.1.20030421
+ RealValueAsnWrite@Base 6.1.20030421
+ RealValueFree@Base 6.1.20030421
+ RealValueNew@Base 6.1.20030421
+ RebuildChemGraphAsn@Base 6.1.20030421
+ ReferenceFrameAsnRead@Base 6.1.20030421
+ ReferenceFrameAsnWrite@Base 6.1.20030421
+ ReferenceFrameFree@Base 6.1.20030421
+ ReferenceFrameNew@Base 6.1.20030421
+ RefreshModelAsnMem@Base 6.1.20030421
+ RefreshSurface@Base 6.1.20030421
+ RegionBoundaryAsnRead@Base 6.1.20030421
+ RegionBoundaryAsnWrite@Base 6.1.20030421
+ RegionBoundaryFree@Base 6.1.20030421
+ RegionCoordinatesAsnRead@Base 6.1.20030421
+ RegionCoordinatesAsnWrite@Base 6.1.20030421
+ RegionCoordinatesFree@Base 6.1.20030421
+ RegionCoordinatesNew@Base 6.1.20030421
+ RegionPntrsAsnRead@Base 6.1.20030421
+ RegionPntrsAsnWrite@Base 6.1.20030421
+ RegionPntrsFree@Base 6.1.20030421
+ RegionPntrsNew@Base 6.1.20030421
+ RegionSimilarityAsnRead@Base 6.1.20030421
+ RegionSimilarityAsnWrite@Base 6.1.20030421
+ RegionSimilarityFree@Base 6.1.20030421
+ RegionSimilarityNew@Base 6.1.20030421
+ RejectIdAsnRead@Base 6.1.20030421
+ RejectIdAsnWrite@Base 6.1.20030421
+ RejectIdFree@Base 6.1.20030421
+ RejectIdNew@Base 6.1.20030421
+ ResidueAsnRead@Base 6.1.20030421
+ ResidueAsnWrite@Base 6.1.20030421
+ ResidueExplicitPntrsAsnRead@Base 6.1.20030421
+ ResidueExplicitPntrsAsnWrite@Base 6.1.20030421
+ ResidueExplicitPntrsFree@Base 6.1.20030421
+ ResidueExplicitPntrsNew@Base 6.1.20030421
+ ResidueFree@Base 6.1.20030421
+ ResidueGraphAsnRead@Base 6.1.20030421
+ ResidueGraphAsnWrite@Base 6.1.20030421
+ ResidueGraphFree@Base 6.1.20030421
+ ResidueGraphNew@Base 6.1.20030421
+ ResidueGraphPntrAsnRead@Base 6.1.20030421
+ ResidueGraphPntrAsnWrite@Base 6.1.20030421
+ ResidueGraphPntrFree@Base 6.1.20030421
+ ResidueIntervalPntrAsnRead@Base 6.1.20030421
+ ResidueIntervalPntrAsnWrite@Base 6.1.20030421
+ ResidueIntervalPntrFree@Base 6.1.20030421
+ ResidueIntervalPntrNew@Base 6.1.20030421
+ ResidueNew@Base 6.1.20030421
+ ResiduePntrsAsnRead@Base 6.1.20030421
+ ResiduePntrsAsnWrite@Base 6.1.20030421
+ ResiduePntrsFree@Base 6.1.20030421
+ ResolveAlignChain@Base 6.1.20030421
+ RotMatrixAsnRead@Base 6.1.20030421
+ RotMatrixAsnWrite@Base 6.1.20030421
+ RotMatrixFree@Base 6.1.20030421
+ RotMatrixNew@Base 6.1.20030421
+ ScaleThdTbl@Base 6.1.20030421
+ SeqAlignConservation@Base 6.1.20031028
+ SeqAlignHasConsensus@Base 6.1.20030421
+ SeqAlignInform@Base 6.1.20030421
+ SeqAlignReadFromFile@Base 6.1.20031028
+ SeqAlignSetDup@Base 6.1.20030421
+ SeqAlignToCddExpAlign@Base 6.1.20030421
+ SeqAnnotReadFromFile@Base 6.1.20030421
+ SeqHasTax@Base 6.1.20031028
+ SeqStringFromMol@Base 6.1.20030421
+ SeqTreeNodeAsnRead@Base 6.1.20031028
+ SeqTreeNodeAsnWrite@Base 6.1.20031028
+ SeqTreeNodeFree@Base 6.1.20031028
+ SeqTreeNodeNew@Base 6.1.20031028
+ SequenceTreeAsnRead@Base 6.1.20031028
+ SequenceTreeAsnWrite@Base 6.1.20031028
+ SequenceTreeFree@Base 6.1.20031028
+ SequenceTreeNew@Base 6.1.20031028
+ SetActiveModel@Base 6.1.20030421
+ SetBackBone@Base 6.1.20030421
+ SetBondOrder@Base 6.1.20030421
+ SetHolderModelstruc@Base 6.1.20030421
+ SetIons@Base 6.1.20030421
+ SetMasterModelstruc@Base 6.1.20030421
+ SetNeighborOff@Base 6.1.20030421
+ SetNeighborOn@Base 6.1.20030421
+ SetNodeFeatureData@Base 6.1.20030421
+ SetSelectedModelstruc@Base 6.1.20030421
+ SetSlaveModelstruc@Base 6.1.20030421
+ SetVirtualBB@Base 6.1.20030421
+ SipIsConsensus@Base 6.1.20030421
+ SortOn@Base 6.1.20030421
+ SphereAsnRead@Base 6.1.20030421
+ SphereAsnWrite@Base 6.1.20030421
+ SphereFree@Base 6.1.20030421
+ SphereNew@Base 6.1.20030421
+ StrucAsynchronousQuery@Base 6.1.20030421
+ StrucCheckQueue@Base 6.1.20030421
+ StrucOpenConnection@Base 6.1.20030421
+ StrucReadReply@Base 6.1.20030421
+ StrucSynchronousQuery@Base 6.1.20030421
+ StrucWaitForReply@Base 6.1.20030421
+ SurfaceCoordinatesAsnRead@Base 6.1.20030421
+ SurfaceCoordinatesAsnWrite@Base 6.1.20030421
+ SurfaceCoordinatesFree@Base 6.1.20030421
+ SurfaceCoordinatesNew@Base 6.1.20030421
+ SwapModelstruc@Base 6.1.20030421
+ TMeshAsnRead@Base 6.1.20030421
+ TMeshAsnWrite@Base 6.1.20030421
+ TMeshFree@Base 6.1.20030421
+ TMeshNew@Base 6.1.20030421
+ TempsKine@Base 6.1.20030421
+ ThermKine@Base 6.1.20030421
+ ThrdRound@Base 6.1.20030421
+ ToMSDParent@Base 6.1.20030421
+ TransMatrixAsnRead@Base 6.1.20030421
+ TransMatrixAsnWrite@Base 6.1.20030421
+ TransMatrixFree@Base 6.1.20030421
+ TransMatrixNew@Base 6.1.20030421
+ TransformAsnRead@Base 6.1.20030421
+ TransformAsnWrite@Base 6.1.20030421
+ TransformFree@Base 6.1.20030421
+ TransformNew@Base 6.1.20030421
+ TransformToDNTRN@Base 6.1.20030421
+ TraverseAll@Base 6.1.20030421
+ TraverseAtoms@Base 6.1.20030421
+ TraverseBonds@Base 6.1.20030421
+ TraverseGraphs@Base 6.1.20030421
+ TraverseIBonds@Base 6.1.20030421
+ TraverseIntraBonds@Base 6.1.20030421
+ TraverseModels@Base 6.1.20030421
+ TraverseMolecules@Base 6.1.20030421
+ TraverseOneModel@Base 6.1.20030421
+ TraverseSolids@Base 6.1.20030421
+ TriangleAsnRead@Base 6.1.20030421
+ TriangleAsnWrite@Base 6.1.20030421
+ TriangleFree@Base 6.1.20030421
+ TriangleNew@Base 6.1.20030421
+ TrianglesAsnRead@Base 6.1.20030421
+ TrianglesAsnWrite@Base 6.1.20030421
+ TrianglesFree@Base 6.1.20030421
+ TrianglesNew@Base 6.1.20030421
+ UCVector@Base 6.1.20030421
+ UCVectorFree@Base 6.1.20030421
+ UI4Vector@Base 6.1.20030421
+ UI4VectorFree@Base 6.1.20030421
+ UndoPFBSelectList@Base 6.1.20030421
+ UpdateAlignAsnRead@Base 6.1.20030421
+ UpdateAlignAsnWrite@Base 6.1.20030421
+ UpdateAlignFree@Base 6.1.20030421
+ UpdateAlignNew@Base 6.1.20030421
+ UpdateCommentAsnRead@Base 6.1.20030421
+ UpdateCommentAsnWrite@Base 6.1.20030421
+ UpdateCommentFree@Base 6.1.20030421
+ ValNodeListCat@Base 6.1.20030421
+ VastTableSort@Base 6.1.20030421
+ WriteASNChemGraphOnly@Base 6.1.20030421
+ WriteAsnAllModel@Base 6.1.20030421
+ WriteAsnLocalDict@Base 6.1.20030421
+ WriteAsnModelList@Base 6.1.20030421
+ WriteAsnOneModel@Base 6.1.20030421
+ WriteAtomOrHet@Base 6.1.20030421
+ WriteFASTAMolecule@Base 6.1.20030421
+ WriteFASTASeqHet@Base 6.1.20030421
+ WriteKinAAResType@Base 6.1.20030421
+ WriteKinAllModel@Base 6.1.20030421
+ WriteKinAlt@Base 6.1.20030421
+ WriteKinAnimate@Base 6.1.20030421
+ WriteKinAtom@Base 6.1.20030421
+ WriteKinBB@Base 6.1.20030421
+ WriteKinHeader@Base 6.1.20030421
+ WriteKinHet@Base 6.1.20030421
+ WriteKinIon@Base 6.1.20030421
+ WriteKinModel@Base 6.1.20030421
+ WriteKinModelByType@Base 6.1.20030421
+ WriteKinModelList@Base 6.1.20030421
+ WriteKinNAResType@Base 6.1.20030421
+ WriteKinOneModel@Base 6.1.20030421
+ WriteKinRes@Base 6.1.20030421
+ WriteKinSeq@Base 6.1.20030421
+ WriteKinVirt@Base 6.1.20030421
+ WriteOutBiostruc@Base 6.1.20030421
+ WritePDBAllModel@Base 6.1.20030421
+ WritePDBConnect@Base 6.1.20030421
+ WritePDBHeader@Base 6.1.20030421
+ WritePDBModel@Base 6.1.20030421
+ WritePDBModelList@Base 6.1.20030421
+ WritePDBMotifs@Base 6.1.20030421
+ WritePDBOneModel@Base 6.1.20030421
+ WritePDBRemarks@Base 6.1.20030421
+ WritePDBSeqRes@Base 6.1.20030421
+ WriteStrucHTMLSeq@Base 6.1.20030421
+ WriteStructSummary@Base 6.1.20030421
+ algs@Base 6.1.20030421
+ atd@Base 6.1.20030421
+ bwfi@Base 6.1.20030421
+ cpal@Base 6.1.20030421
+ cpll@Base 6.1.20030421
+ cprl@Base 6.1.20030421
+ cxei@Base 6.1.20030421
+ dgri@Base 6.1.20030421
+ fnMMDBCn3Dmode@Base 6.1.20030421
+ fnPBSFtoPSA@Base 6.1.20030421
+ g0@Base 6.1.20030421
+ g@Base 6.1.20030421
+ isBiopoly@Base 6.1.20030421
+ isHet@Base 6.1.20030421
+ objcddAsnLoad@Base 6.1.20030421
+ objcn3dAsnLoad@Base 6.1.20030421
+ objmimeAsnLoad@Base 6.1.20030421
+ objmmdb1AsnLoad@Base 6.1.20030421
+ objmmdb2AsnLoad@Base 6.1.20030421
+ objmmdb3AsnLoad@Base 6.1.20030421
+ rsmp@Base 6.1.20030421
+ sal0@Base 6.1.20030421
+ salr@Base 6.1.20030421
+ salu@Base 6.1.20030421
+ sgoi@Base 6.1.20030421
+ slo0@Base 6.1.20030421
+ slor@Base 6.1.20030421
+ slou@Base 6.1.20030421
+ spci@Base 6.1.20030421
+ spea@Base 6.1.20030421
+ spel@Base 6.1.20030421
+ spni@Base 6.1.20030421
+ ttb0@Base 6.1.20030421
+ ttbi@Base 6.1.20030421
+ zsc@Base 6.1.20030421
+libncbiobj.so.6 libncbi6 #MINVER#
+ A2GBSeqLocReplaceID@Base 6.1.20040204
+ AAForCodon@Base 6.1.20030421
+ ACCN_1_5_FORMAT@Base 6.1.20030421
+ ACCN_PIR_FORMAT@Base 6.1.20030421
+ ACEFileFree@Base 6.1.20081116
+ ACEFileNew@Base 6.1.20081116
+ AECRActionAsnRead@Base 6.1.20080302
+ AECRActionAsnWrite@Base 6.1.20080302
+ AECRActionFree@Base 6.1.20080302
+ AECRActionNew@Base 6.1.20080302
+ AECRParseActionAsnRead@Base 6.1.20080302
+ AECRParseActionAsnWrite@Base 6.1.20080302
+ AECRParseActionFree@Base 6.1.20080302
+ AECRParseActionNew@Base 6.1.20080302
+ AECRSampleFree@Base 6.1.20081116
+ AECRSampleListFree@Base 6.1.20081116
+ ALI_ConvertToNCBIData@Base 6.1.20030421
+ AMAlignDatFree@Base 6.1.20030421
+ AMAlignDatNew@Base 6.1.20030421
+ AMAlignIndex2Free2@Base 6.1.20030421
+ AMAlignIndexFree@Base 6.1.20030421
+ AMAlignIndexFreeEitherIndex@Base 6.1.20030421
+ AMAlignIndexNew@Base 6.1.20030421
+ AMFreeAllIndexes@Base 6.1.20030421
+ AMFreqFree@Base 6.1.20030421
+ AbbreviationList@Base 6.1.20080302
+ AbstractReadFunction@Base 6.1.20040505
+ AbstractReportError@Base 6.1.20040505
+ AccessAsnLoad@Base 6.1.20030421
+ AccnIsSWISSPROT@Base 6.1.20030421
+ AccnIsUniProt@Base 6.1.20041020
+ AccnListAsynchronousQuery@Base 6.1.20031028
+ AccnListCheckQueue@Base 6.1.20031028
+ AccnListOpenConnection@Base 6.1.20031028
+ AccnListPreLoadSeqIdGiCache@Base 6.1.20050429
+ AccnListReadReply@Base 6.1.20031028
+ AccnListSynchronousQuery@Base 6.1.20031028
+ AccnListWaitForReply@Base 6.1.20031028
+ AccnRevHistAsynchronousQuery@Base 6.1.20030421
+ AccnRevHistCheckQueue@Base 6.1.20030421
+ AccnRevHistOpenConnection@Base 6.1.20030421
+ AccnRevHistReadReply@Base 6.1.20030421
+ AccnRevHistSynchronousQuery@Base 6.1.20030421
+ AccnRevHistWaitForReply@Base 6.1.20030421
+ ActionChoiceAsnRead@Base 6.1.20080302
+ ActionChoiceAsnWrite@Base 6.1.20080302
+ ActionChoiceFree@Base 6.1.20080302
+ AddAAsToByteStore@Base 6.1.20030421
+ AddAccessionBlock@Base 6.1.20040204
+ AddAccessionToRefGeneTrackUserObject@Base 6.1.20030421
+ AddAccessionToTpaAssemblyUserObject@Base 6.1.20030421
+ AddAffiliationToPub@Base 6.1.20030421
+ AddAlignInfoToSeqAnnot@Base 6.1.20030421
+ AddAlignInfoToSeqAnnotEx@Base 6.1.20030421
+ AddAllCDSGeneProtFeaturesToChoiceList@Base 6.1.20080302
+ AddAllCDSGeneProtFieldsToChoiceList@Base 6.1.20080302
+ AddAllDbxrefsToBioseq@Base 6.1.20080302
+ AddAllDescriptorsToChoiceList@Base 6.1.20090301
+ AddAllFeatureFieldsToChoiceList@Base 6.1.20080302
+ AddAllFeaturesToChoiceList@Base 6.1.20080302
+ AddAllRNASubtypesToChoiceList@Base 6.1.20080302
+ AddAminoAcidsToBioseq@Base 6.1.20030421
+ AddAminoAcidsToLiteral@Base 6.1.20030421
+ AddAntiCodonTotRNA@Base 6.1.20030421
+ AddAuthorToPub@Base 6.1.20030421
+ AddAutoDefUserObjectCallback@Base 6.1.20160908
+ AddAutoDefUserObjectToSeqEntry@Base 6.1.20160908
+ AddAutodefProductFlag@Base 6.1.20160908
+ AddBasecountBlock@Base 6.1.20040204
+ AddBasesToBioseq@Base 6.1.20030421
+ AddBasesToByteStore@Base 6.1.20030421
+ AddBasesToLiteral@Base 6.1.20030421
+ AddBioProjectIDsToDBLinkUserObject@Base 6.1.20120620
+ AddBioSampleIDsToDBLinkUserObject@Base 6.1.20090301
+ AddBioSourceToGBQual@Base 6.1.20030421
+ AddBiomolToEntry@Base 6.1.20030421
+ AddBooleanAutodefField@Base 6.1.20160908
+ AddCAGEBlock@Base 6.1.20100808
+ AddCDSGapComment@Base 6.1.20080302
+ AddCitSubToUpdatedSequence@Base 6.1.20120620
+ AddCodeBreakToCdRegion@Base 6.1.20030421
+ AddCommentBlock@Base 6.1.20040204
+ AddCommentStringWithTildes@Base 6.1.20040204
+ AddCommentToEntry@Base 6.1.20030421
+ AddCommentToSub@Base 6.1.20030421
+ AddCommentWithURLlinks@Base 6.1.20040204
+ AddCompleteToEntry@Base 6.1.20030421
+ AddCompleteness@Base 6.1.20030421
+ AddContainedCodingRegionDiscrepancies@Base 6.1.20070822
+ AddContigBlock@Base 6.1.20040204
+ AddCreateDateToEntry@Base 6.1.20030421
+ AddCuratorToRefGeneTrackUserObject@Base 6.1.20030421
+ AddCuratorURLToRefGeneTrackUserObject@Base 6.1.20081116
+ AddDatabaseNameToStructuredComment@Base 6.1.20100808
+ AddDateBlock@Base 6.1.20040204
+ AddDblinkBlock@Base 6.1.20090719
+ AddDbsourceBlock@Base 6.1.20040204
+ AddDeflineBlock@Base 6.1.20040204
+ AddDeflineFeatureRequestListToAutoDefUserObject@Base 6.1.20160908
+ AddDeltaSeqOnlyToSubmission@Base 6.1.20030421
+ AddDeltaSeqToNucProtEntry@Base 6.1.20030421
+ AddDescriptorListActionAsnRead@Base 6.1.20120620
+ AddDescriptorListActionAsnWrite@Base 6.1.20120620
+ AddDescriptorListActionFree@Base 6.1.20120620
+ AddDescriptorListActionNew@Base 6.1.20120620
+ AddDiscrepanciesForMissingOrNonUniqueGeneLocusTags@Base 6.1.20070822
+ AddDiscrepanciesForMissingOrNonUniqueGeneLocusTagsEx@Base 6.1.20081116
+ AddDiscrepanciesForNonGeneLocusTags@Base 6.1.20070822
+ AddECNumberNoteDiscrepancies@Base 6.1.20070822
+ AddEmptyBlocks@Base 6.1.20030421
+ AddEmptySegments@Base 6.1.20030421
+ AddExceptionsToShortIntrons@Base 6.1.20100808
+ AddExtraAccessions@Base 6.1.20030421
+ AddFakeGapToDeltaSeq@Base 6.1.20030421
+ AddFeatFunc@Base 6.1.20030421
+ AddFeatHeaderBlock@Base 6.1.20040204
+ AddFeatStatsBlock@Base 6.1.20061015
+ AddFeatureBlock@Base 6.1.20040204
+ AddFeatureListType@Base 6.1.20160908
+ AddFeatureToGbseq@Base 6.1.20040204
+ AddFieldStringToDbLinkUserObject@Base 6.1.20120620
+ AddFieldToUserObject@Base 6.1.20160908
+ AddFileActionAsnRead@Base 6.1.20120620
+ AddFileActionAsnWrite@Base 6.1.20120620
+ AddFileActionFree@Base 6.1.20120620
+ AddFileActionNew@Base 6.1.20120620
+ AddGBQual@Base 6.1.20030421
+ AddGBQualEx@Base 6.1.20030421
+ AddGIBBmethodToEntry@Base 6.1.20030421
+ AddGapToDeltaSeq@Base 6.1.20030421
+ AddGapToSegmentedEntry@Base 6.1.20030421
+ AddGenBankBlockToEntry@Base 6.1.20030421
+ AddGenBankSetToSubmission@Base 6.1.20030421
+ AddGeneratedToRefGeneTrackUserObject@Base 6.1.20080302
+ AddGenomeBlock@Base 6.1.20040204
+ AddGenomeToEntry@Base 6.1.20030421
+ AddHIVRule@Base 6.1.20160908
+ AddIDsToGenomeProjectsDBUserObject@Base 6.1.20060301
+ AddImportFeaturesToChoiceList@Base 6.1.20080302
+ AddIntListFieldToDBLinkUserObject@Base 6.1.20160908
+ AddIntToSeqFeat@Base 6.1.20030421
+ AddIntToSeqLoc@Base 6.1.20050429
+ AddIntegerToNcbiCleanupUserObject@Base 6.1.20090719
+ AddIntervalToFeature@Base 6.1.20030421
+ AddIntervalToLocation@Base 6.1.20030421
+ AddIntervalsToGbfeat@Base 6.1.20061015
+ AddItemStructuredCommentUserObject@Base 6.1.20060507
+ AddJoinedFeatureDiscrepancies@Base 6.1.20070822
+ AddJsInterval@Base 6.1.20120620
+ AddKeywordsBlock@Base 6.1.20040204
+ AddLink@Base 6.1.20030421
+ AddLinkLater@Base 6.1.20030421
+ AddListOutputTags@Base 6.1.20120620
+ AddListToOutputConfig@Base 6.1.20160908
+ AddLiteralToDeltaSeq@Base 6.1.20030421
+ AddLocusBlock@Base 6.1.20040204
+ AddMiscFeatParseRule@Base 6.1.20160908
+ AddMissingAndSuperfluousGeneDiscrepancies@Base 6.1.20070822
+ AddModListToAutoDefUserObject@Base 6.1.20160908
+ AddModifierLabel@Base 6.1.20080302
+ AddModifierToEntry@Base 6.1.20030421
+ AddModifsToGBQual@Base 6.1.20030421
+ AddMrnaOrESTtoModelEvidence@Base 6.1.20030421
+ AddMutSetToSubmission@Base 6.1.20030421
+ AddNcbiAutofixUserObject@Base 6.1.20110713
+ AddNewUniqueAnnotations@Base 6.1.20100808
+ AddNewUniqueDescriptors@Base 6.1.20100808
+ AddNonExtendableException@Base 6.1.20090719
+ AddNucProtToSubmission@Base 6.1.20030421
+ AddOffsetToAlignNode@Base 6.1.20030421
+ AddOrgModToEntry@Base 6.1.20030421
+ AddOrgRefModToGBQual@Base 6.1.20030421
+ AddOrganismDescriptionModifiersToAutoDefUserObject@Base 6.1.20160908
+ AddOrganismToEntry@Base 6.1.20030421
+ AddOrganismToEntryEx@Base 6.1.20030421
+ AddOrganismToEntryNew@Base 6.1.20030421
+ AddOriginBlock@Base 6.1.20040204
+ AddOverlappingCodingRegionDiscrepancies@Base 6.1.20070822
+ AddOverlappingGeneDiscrepancies@Base 6.1.20070822
+ AddOverlappingrRNADiscrepancies@Base 6.1.20110713
+ AddPID@Base 6.1.20030421
+ AddPhrapGraph@Base 6.1.20030421
+ AddPhrapGraphToSeqLit@Base 6.1.20030421
+ AddPhySetToSubmission@Base 6.1.20030421
+ AddPntToSeqFeat@Base 6.1.20030421
+ AddPntToSeqLoc@Base 6.1.20070822
+ AddPointToFeature@Base 6.1.20030421
+ AddPopSetToSubmission@Base 6.1.20030421
+ AddPopsetDeflineWithClause@Base 6.1.20100808
+ AddPopsetTitles@Base 6.1.20100808
+ AddPrimaryBlock@Base 6.1.20040204
+ AddProbeDBIDsToDBLinkUserObject@Base 6.1.20090719
+ AddProteinQuals@Base 6.1.20030421
+ AddProteinSequenceCopy@Base 6.1.20080302
+ AddPubToEntry@Base 6.1.20030421
+ AddPubsFromTitle@Base 6.1.20070822
+ AddQualToImpFeature@Base 6.1.20030421
+ AddQualifierToFeature@Base 6.1.20030421
+ AddRNACDSOverlapDiscrepancies@Base 6.1.20070822
+ AddReadQualScores@Base 6.1.20081116
+ AddRefStatsBlock@Base 6.1.20061015
+ AddReferenceBlock@Base 6.1.20040204
+ AddReferenceToSegmentedEntry@Base 6.1.20030421
+ AddSecondaryAccnToEntry@Base 6.1.20030421
+ AddSegmentBlock@Base 6.1.20040204
+ AddSegmentedSeqToNucProtEntry@Base 6.1.20030421
+ AddSegmentedSeqToSubmission@Base 6.1.20030421
+ AddSeqEntryToGlobalDiscrepReport@Base 6.1.20081116
+ AddSeqEntryToSeqEntry@Base 6.1.20030421
+ AddSeqFeatInterval@Base 6.1.20030421
+ AddSeqFeatPoint@Base 6.1.20030421
+ AddSeqId@Base 6.1.20030421
+ AddSeqLocPoint@Base 6.1.20050429
+ AddSeqOnlyToSubmission@Base 6.1.20030421
+ AddSeqReadArchIDsToDBLinkUserObject@Base 6.1.20120620
+ AddSeqReadArchiveIDsToDBLinkUserObject@Base 6.1.20100808
+ AddSeqToNucProtEntry@Base 6.1.20030421
+ AddSeqToSegmentedEntry@Base 6.1.20030421
+ AddSequenceBlock@Base 6.1.20040204
+ AddSiteNoteQual@Base 6.1.20030421
+ AddSlashBlock@Base 6.1.20040204
+ AddSourceFeatBlock@Base 6.1.20040204
+ AddSourceOrganismBlock@Base 6.1.20160908
+ AddSourceToRefGeneTrackUserObject@Base 6.1.20031028
+ AddStatusToRefGeneTrackUserObject@Base 6.1.20030421
+ AddStringListFieldToDBLinkUserObject@Base 6.1.20160908
+ AddStringToNcbiCleanupUserObject@Base 6.1.20090719
+ AddStringToUnverifiedUserObject@Base 6.1.20120620
+ AddStringWithTildes@Base 6.1.20040204
+ AddStructuredCommentKeywords@Base 6.1.20100808
+ AddSubSourceToEntry@Base 6.1.20030421
+ AddSuppressedFeatures@Base 6.1.20160908
+ AddTLSBlock@Base 6.1.20160908
+ AddTSABlock@Base 6.1.20120620
+ AddTechToEntry@Base 6.1.20030421
+ AddTextToTabTableColumn@Base 6.1.20100808
+ AddTitleToEntry@Base 6.1.20030421
+ AddToGeneOntologyUserObject@Base 6.1.20030421
+ AddToOutputConfig@Base 6.1.20160908
+ AddToolToSub@Base 6.1.20030421
+ AddTraceAssemblyIDsToDBLinkUserObject@Base 6.1.20090301
+ AddTypeToSub@Base 6.1.20030421
+ AddUniqueUpdateSequenceIDs@Base 6.1.20120620
+ AddUnverifiedUserObject@Base 6.1.20110713
+ AddUnverifiedUserObjectToBioseq@Base 6.1.20110713
+ AddUnverifiedUserObjectToBioseqParent@Base 6.1.20120620
+ AddValNodeString@Base 6.1.20040204
+ AddVersionBlock@Base 6.1.20040204
+ AddWGSBlock@Base 6.1.20040204
+ Add_trid@Base 6.1.20030421
+ AddmRNAForCDS@Base 6.1.20090719
+ AdjustCDSLocationsForUnknownGapsCallback@Base 6.1.20080302
+ AdjustFeatForGapFree@Base 6.1.20080302
+ AdjustFeatureForGapChange@Base 6.1.20060301
+ AdjustFeatureForGapsCallback@Base 6.1.20080302
+ AdjustFeaturesForGapsActionAsnRead@Base 6.1.20160908
+ AdjustFeaturesForGapsActionAsnWrite@Base 6.1.20160908
+ AdjustFeaturesForGapsActionFree@Base 6.1.20160908
+ AdjustFeaturesForGapsActionNew@Base 6.1.20160908
+ AdjustFeaturesForInsertion@Base 6.1.20050429
+ AdjustFrame@Base 6.1.20080302
+ AdjustInfluenzaSourceTable@Base 6.1.20120620
+ AdjustOffSetsInSeqAlign@Base 6.1.20030421
+ AdjustSeqEntryForConsensusSplice@Base 6.1.20100808
+ AdjustSeqEntryForConsensusSpliceEx@Base 6.1.20100808
+ AdjustmRNAProductToMatchProteinProduct@Base 6.1.20080302
+ AdvancedSeqEntryCleanup@Base 6.1.20160908
+ AdvcLockFarComponents@Base 6.1.20070822
+ AffilAsnRead@Base 6.1.20030421
+ AffilAsnWrite@Base 6.1.20030421
+ AffilFree@Base 6.1.20030421
+ AffilMatch@Base 6.1.20050605
+ AffilNew@Base 6.1.20030421
+ AffiliationShortWordList@Base 6.1.20090719
+ AfterAlsoSelect@Base 6.1.20030421
+ AjpToByteStore@Base 6.1.20030421
+ AjpToStrArray@Base 6.1.20030421
+ Ali_AddError@Base 6.1.20030421
+ Ali_ChangeRowToOther@Base 6.1.20030421
+ Ali_Free@Base 6.1.20030421
+ Ali_GetConfig@Base 6.1.20030421
+ Ali_Read@Base 6.1.20030421
+ Ali_ReadLines@Base 6.1.20030421
+ Ali_SeqLineGetType@Base 6.1.20030421
+ Ali_SetConfig@Base 6.1.20030421
+ AlignBoxAsnRead@Base 6.1.20030421
+ AlignBoxAsnWrite@Base 6.1.20030421
+ AlignBoxFree@Base 6.1.20030421
+ AlignBoxNew@Base 6.1.20030421
+ AlignColumnsAsnRead@Base 6.1.20030421
+ AlignColumnsAsnWrite@Base 6.1.20030421
+ AlignColumnsFree@Base 6.1.20030421
+ AlignColumnsNew@Base 6.1.20030421
+ AlignCoordToSeqCoord2@Base 6.1.20030421
+ AlignCoordToSeqCoord@Base 6.1.20030421
+ AlignDefAsnRead@Base 6.1.20030421
+ AlignDefAsnWrite@Base 6.1.20030421
+ AlignDefFree@Base 6.1.20030421
+ AlignDefNew@Base 6.1.20030421
+ AlignForSequenceUpdate@Base 6.1.20120620
+ AlignIdAsnRead@Base 6.1.20030421
+ AlignIdAsnWrite@Base 6.1.20030421
+ AlignIdFree@Base 6.1.20030421
+ AlignLocAsnRead@Base 6.1.20030421
+ AlignLocAsnWrite@Base 6.1.20030421
+ AlignLocFree@Base 6.1.20030421
+ AlignLocNew@Base 6.1.20030421
+ AlignLocSetAsnRead@Base 6.1.20030421
+ AlignLocSetAsnWrite@Base 6.1.20030421
+ AlignLocSetFree@Base 6.1.20030421
+ AlignMgr2GetFirstNForStdSeg@Base 6.1.20030421
+ AlignNodeFind@Base 6.1.20030421
+ AlignNodeIndex@Base 6.1.20030421
+ AlignRowsAsnRead@Base 6.1.20030421
+ AlignRowsAsnWrite@Base 6.1.20030421
+ AlignRowsFree@Base 6.1.20030421
+ AlignRowsNew@Base 6.1.20030421
+ AlignabilityByLoc@Base 6.1.20030421
+ AlignmentFileFree@Base 6.1.20040204
+ AlignmentFileFromContig@Base 6.1.20081116
+ AlignmentFileNew@Base 6.1.20040204
+ AlignmentIntervalToString@Base 6.1.20081116
+ AlignmentPercentIdentity@Base 6.1.20070822
+ AlignmentStringToSequenceString@Base 6.1.20050429
+ AllAsnLoad@Base 6.1.20030421
+ AllObjLoad@Base 6.1.20030421
+ AllowFieldMulti@Base 6.1.20081116
+ AllowSourceQualMulti@Base 6.1.20081116
+ AlnMgr2AnchorSeqAlign@Base 6.1.20030421
+ AlnMgr2ComputeFreqMatrix@Base 6.1.20030421
+ AlnMgr2ComputeScoreForSeqAlign@Base 6.1.20030421
+ AlnMgr2DumpIndexedAlnToFile@Base 6.1.20030421
+ AlnMgr2DupAlnAndIndexes@Base 6.1.20030421
+ AlnMgr2ExtendToCoords@Base 6.1.20030421
+ AlnMgr2ExtractPairwiseSeqAlign@Base 6.1.20030421
+ AlnMgr2FillInUnaligned@Base 6.1.20030421
+ AlnMgr2FindAnchor@Base 6.1.20030421
+ AlnMgr2FreeInterruptInfo@Base 6.1.20030421
+ AlnMgr2FuseSet@Base 6.1.20030421
+ AlnMgr2GetAlnLength@Base 6.1.20030421
+ AlnMgr2GetAlnLengthStdSeg@Base 6.1.20030421
+ AlnMgr2GetFirstNForSip@Base 6.1.20030421
+ AlnMgr2GetFirstNForSipList@Base 6.1.20031028
+ AlnMgr2GetInterruptInfo@Base 6.1.20030421
+ AlnMgr2GetMaxTailLength@Base 6.1.20030421
+ AlnMgr2GetNextAlnBit@Base 6.1.20030421
+ AlnMgr2GetNextLengthBit@Base 6.1.20030421
+ AlnMgr2GetNthBlockRange@Base 6.1.20030421
+ AlnMgr2GetNthRowSpanInSA@Base 6.1.20030421
+ AlnMgr2GetNthRowTail@Base 6.1.20030421
+ AlnMgr2GetNthSegmentRange@Base 6.1.20030421
+ AlnMgr2GetNthSeqIdPtr@Base 6.1.20030421
+ AlnMgr2GetNthSeqIdPtrStdSeg@Base 6.1.20030421
+ AlnMgr2GetNthSeqRangeInSA@Base 6.1.20030421
+ AlnMgr2GetNthSeqRangeInSAStdSeg@Base 6.1.20030421
+ AlnMgr2GetNthStdSeg@Base 6.1.20031028
+ AlnMgr2GetNthStrand@Base 6.1.20030421
+ AlnMgr2GetNthUnalignedForNthRow@Base 6.1.20030421
+ AlnMgr2GetNumAlnBlocks@Base 6.1.20030421
+ AlnMgr2GetNumRows@Base 6.1.20030421
+ AlnMgr2GetNumSegs@Base 6.1.20030421
+ AlnMgr2GetNumSegsInRange@Base 6.1.20030421
+ AlnMgr2GetNumStdSegs@Base 6.1.20031028
+ AlnMgr2GetParent@Base 6.1.20030421
+ AlnMgr2GetSeqRangeForSipInSAStdSeg@Base 6.1.20031028
+ AlnMgr2GetSeqRangeForSipInStdSeg@Base 6.1.20031028
+ AlnMgr2GetSubAlign@Base 6.1.20030421
+ AlnMgr2IndexAsRows@Base 6.1.20030421
+ AlnMgr2IndexIndexedChain@Base 6.1.20030421
+ AlnMgr2IndexLite@Base 6.1.20030421
+ AlnMgr2IndexSeqAlign@Base 6.1.20030421
+ AlnMgr2IndexSeqAlignEx@Base 6.1.20030421
+ AlnMgr2IndexSingleChildSeqAlign@Base 6.1.20030421
+ AlnMgr2IsItProtein@Base 6.1.20030421
+ AlnMgr2IsSAPDiscAli@Base 6.1.20030421
+ AlnMgr2MapBioseqToSeqAlign@Base 6.1.20030421
+ AlnMgr2MapBioseqToSeqAlignStdSeg@Base 6.1.20030421
+ AlnMgr2MapRowToRow@Base 6.1.20030421
+ AlnMgr2MapSeqAlignToBioseq@Base 6.1.20030421
+ AlnMgr2MapSeqAlignToBioseqStdSeg@Base 6.1.20030421
+ AlnMgr2MergeTwoAlignments@Base 6.1.20030421
+ AlnMgr2PadConservatively@Base 6.1.20030421
+ AlnMgr2PrintSeqAlign@Base 6.1.20030421
+ AlnMgr2ReIndexSeqAlign@Base 6.1.20030421
+ AlnMgr2RemoveInconsistentAlnsFromSet@Base 6.1.20030421
+ AlnMgr2SortAlnSetByNthRowPos@Base 6.1.20030421
+ AlnMgr2TruncateSeqAlign@Base 6.1.20030421
+ AlnMgrAddBlock@Base 6.1.20030421
+ AlnMgrAnythingToSeg@Base 6.1.20030421
+ AlnMgrCheckAlignForParent@Base 6.1.20030421
+ AlnMgrCheckOrdered@Base 6.1.20030421
+ AlnMgrCheckOverlapping@Base 6.1.20030421
+ AlnMgrCheckRealMaster@Base 6.1.20030421
+ AlnMgrCompareAMS@Base 6.1.20030421
+ AlnMgrCompareIncreasingBySeqIdPtr@Base 6.1.20030421
+ AlnMgrCompareMasterAMS@Base 6.1.20030421
+ AlnMgrCompareTips@Base 6.1.20030421
+ AlnMgrCopyAndIndexSingleAlignment@Base 6.1.20030421
+ AlnMgrCopyIndexedParentIntoSap@Base 6.1.20030421
+ AlnMgrCopyIndexedParentSeqAlign@Base 6.1.20030421
+ AlnMgrCopyIndexesForChildSeqAlign@Base 6.1.20030421
+ AlnMgrCopyRowSource@Base 6.1.20030421
+ AlnMgrCopySASeqDat@Base 6.1.20030421
+ AlnMgrCopyamadp@Base 6.1.20030421
+ AlnMgrDeleteChildByPointer@Base 6.1.20030421
+ AlnMgrDeleteHidden@Base 6.1.20030421
+ AlnMgrDeleteHiddenEx@Base 6.1.20030421
+ AlnMgrDeleteNthRow@Base 6.1.20030421
+ AlnMgrDupTopNByScore@Base 6.1.20030421
+ AlnMgrFillInStarts@Base 6.1.20030421
+ AlnMgrFindFirst@Base 6.1.20030421
+ AlnMgrFindMaster@Base 6.1.20030421
+ AlnMgrForceMasterSlave@Base 6.1.20030421
+ AlnMgrGetAllNForSip@Base 6.1.20030421
+ AlnMgrGetAlnLength@Base 6.1.20030421
+ AlnMgrGetMasterGapStartForSeg@Base 6.1.20030421
+ AlnMgrGetMaxRowsForParentPartial@Base 6.1.20030421
+ AlnMgrGetMaxSegments@Base 6.1.20030421
+ AlnMgrGetMaxTailLength@Base 6.1.20030421
+ AlnMgrGetMaxUnalignedLength@Base 6.1.20030421
+ AlnMgrGetNForSap@Base 6.1.20030421
+ AlnMgrGetNForSip@Base 6.1.20030421
+ AlnMgrGetNextAlnBit@Base 6.1.20030421
+ AlnMgrGetNextLengthBit@Base 6.1.20030421
+ AlnMgrGetNextNthSeqRange@Base 6.1.20030421
+ AlnMgrGetNthAlignedSegInNthRow@Base 6.1.20030421
+ AlnMgrGetNthBlockRange@Base 6.1.20030421
+ AlnMgrGetNthRowTail@Base 6.1.20030421
+ AlnMgrGetNthSegmentRange@Base 6.1.20030421
+ AlnMgrGetNthSeqIdPtr@Base 6.1.20030421
+ AlnMgrGetNthSeqRangeInSA@Base 6.1.20030421
+ AlnMgrGetNthStrand@Base 6.1.20030421
+ AlnMgrGetNthUnalignedForNthRow@Base 6.1.20030421
+ AlnMgrGetNumAlnBlocks@Base 6.1.20030421
+ AlnMgrGetNumRows@Base 6.1.20030421
+ AlnMgrGetNumSegments@Base 6.1.20030421
+ AlnMgrGetNumSeqs@Base 6.1.20030421
+ AlnMgrGetParent@Base 6.1.20030421
+ AlnMgrGetRowsForMasterSlave@Base 6.1.20030421
+ AlnMgrGetRowsForPartial@Base 6.1.20030421
+ AlnMgrGetSapForSip@Base 6.1.20030421
+ AlnMgrGetStartFromMaster@Base 6.1.20030421
+ AlnMgrGetStrand@Base 6.1.20030421
+ AlnMgrGetSubAlign@Base 6.1.20030421
+ AlnMgrGetSubAlignSpecial@Base 6.1.20030421
+ AlnMgrGetUniqueSeqs@Base 6.1.20030421
+ AlnMgrIndexIndexedChain@Base 6.1.20030421
+ AlnMgrIndexLinkedSegs@Base 6.1.20030421
+ AlnMgrIndexLite@Base 6.1.20030421
+ AlnMgrIndexParentSA@Base 6.1.20030421
+ AlnMgrIndexSeqAlign@Base 6.1.20030421
+ AlnMgrIndexSingleChildSeqAlign@Base 6.1.20030421
+ AlnMgrIndexSingleSeqAlign@Base 6.1.20030421
+ AlnMgrIsEditable@Base 6.1.20030421
+ AlnMgrIsIBMable@Base 6.1.20030421
+ AlnMgrIsSAPDiscAli@Base 6.1.20030421
+ AlnMgrIsSAPNULL@Base 6.1.20030421
+ AlnMgrMakeAlignCoords@Base 6.1.20030421
+ AlnMgrMakeFakeMultiple@Base 6.1.20030421
+ AlnMgrMakeMasterPlus@Base 6.1.20030421
+ AlnMgrMakeMultByIntersectOnMaster@Base 6.1.20030421
+ AlnMgrMakeMultSegments@Base 6.1.20030421
+ AlnMgrMakeMultipleByScore@Base 6.1.20030421
+ AlnMgrMakeMultipleByScoreEx@Base 6.1.20030421
+ AlnMgrMakeMultipleByScoreExEx@Base 6.1.20030421
+ AlnMgrMakeRowsForOrdered@Base 6.1.20030421
+ AlnMgrMakeSegmentedMasterSlave@Base 6.1.20030421
+ AlnMgrMapBioseqToBioseq@Base 6.1.20030421
+ AlnMgrMapBioseqToSeqAlign@Base 6.1.20030421
+ AlnMgrMapBioseqToSeqAlignEx@Base 6.1.20030421
+ AlnMgrMapRowCoords@Base 6.1.20030421
+ AlnMgrMapToBsqCoords@Base 6.1.20030421
+ AlnMgrMerge3OverlappingSeqAligns@Base 6.1.20030421
+ AlnMgrMergeIntoMSMultByMaster@Base 6.1.20030421
+ AlnMgrMergeSegments@Base 6.1.20030421
+ AlnMgrNeatlyIndex@Base 6.1.20030421
+ AlnMgrPropagateSeqIdsByRow@Base 6.1.20030421
+ AlnMgrPropagateSeqIdsBySapList@Base 6.1.20030421
+ AlnMgrPropagateUpSeqIdPtrs@Base 6.1.20030421
+ AlnMgrReIndexSeqAlign@Base 6.1.20030421
+ AlnMgrRearrangeUnpacked@Base 6.1.20030421
+ AlnMgrReconcileGaps@Base 6.1.20030421
+ AlnMgrRemoveInconsistentFromPairwiseSet@Base 6.1.20030421
+ AlnMgrRemoveInconsistentFromPairwiseSetEx@Base 6.1.20030421
+ AlnMgrReplaceBlock@Base 6.1.20030421
+ AlnMgrSeqAlignToDDP@Base 6.1.20030421
+ AlnMgrSetMaster@Base 6.1.20030421
+ AlnMgrSortAlnSetByNthRowPos@Base 6.1.20030421
+ AlnMgrSortSeqAligns@Base 6.1.20030421
+ AlnMgrSortbyID@Base 6.1.20030421
+ AlnMgrTossNeatRows@Base 6.1.20030421
+ AlnMgrTruncateSAP@Base 6.1.20030421
+ AlnMgrUnpackSeqAlign@Base 6.1.20030421
+ AlnMsgFree2@Base 6.1.20030421
+ AlnMsgFree@Base 6.1.20030421
+ AlnMsgNew2@Base 6.1.20030421
+ AlnMsgNew@Base 6.1.20030421
+ AlnMsgReNew2@Base 6.1.20030421
+ AlnMsgReNew@Base 6.1.20030421
+ AltIndexedFastaLibFetchDisable@Base 6.1.20031028
+ AltIndexedFastaLibFetchEnable@Base 6.1.20031028
+ AltitudeIsValid@Base 6.1.20160908
+ AnnotDescAsnRead@Base 6.1.20030421
+ AnnotDescAsnWrite@Base 6.1.20030421
+ AnnotDescFree@Base 6.1.20030421
+ AnnotDescLabel@Base 6.1.20050429
+ AnnotDescrAsnRead@Base 6.1.20030421
+ AnnotDescrAsnWrite@Base 6.1.20030421
+ AnnotDescrFree@Base 6.1.20030421
+ AnnotIdAsnRead@Base 6.1.20030421
+ AnnotIdAsnWrite@Base 6.1.20030421
+ AnnotIdFree@Base 6.1.20030421
+ AnnotIdSetAsnRead@Base 6.1.20030421
+ AnnotIdSetAsnWrite@Base 6.1.20030421
+ AnnotIdSetFree@Base 6.1.20030421
+ AnyDiscrepanciesChosen@Base 6.1.20100808
+ ApplyActionAsnRead@Base 6.1.20080302
+ ApplyActionAsnWrite@Base 6.1.20080302
+ ApplyActionFree@Base 6.1.20080302
+ ApplyActionNew@Base 6.1.20080302
+ ApplyBarcodeDbxrefsToBioseq@Base 6.1.20070822
+ ApplyBarcodeKeywordToBioseq@Base 6.1.20090719
+ ApplyBarcodeKeywords@Base 6.1.20070822
+ ApplyBarcodeTech@Base 6.1.20090719
+ ApplyCDSOptionsToFeature@Base 6.1.20081116
+ ApplyFBOLDbxrefsToBioseq@Base 6.1.20120620
+ ApplyFeatureActionAsnRead@Base 6.1.20080302
+ ApplyFeatureActionAsnWrite@Base 6.1.20080302
+ ApplyFeatureActionFree@Base 6.1.20080302
+ ApplyFeatureActionNew@Base 6.1.20080302
+ ApplyMacroToSeqEntry@Base 6.1.20080302
+ ApplyMacroToSeqEntryEx@Base 6.1.20100808
+ ApplyMacroToSeqEntryExEx@Base 6.1.20120620
+ ApplyMolinfoBlockToSeqEntry@Base 6.1.20081116
+ ApplyOneFeatureToBioseq@Base 6.1.20100808
+ ApplyOneSpecificHostFix@Base 6.1.20070822
+ ApplyProductUpdateTable@Base 6.1.20110713
+ ApplySuspectProductNameFixToFeature@Base 6.1.20110713
+ ApplySuspectProductNameFixToString@Base 6.1.20110713
+ ApplySuspectRuleFixesToSeqEntry@Base 6.1.20110713
+ ApplyTableActionAsnRead@Base 6.1.20120620
+ ApplyTableActionAsnWrite@Base 6.1.20120620
+ ApplyTableActionFree@Base 6.1.20120620
+ ApplyTableActionNew@Base 6.1.20120620
+ ApplyTableExtraDataAsnRead@Base 6.1.20120620
+ ApplyTableExtraDataAsnWrite@Base 6.1.20120620
+ ApplyTableExtraDataFree@Base 6.1.20120620
+ ApplyTableToFeatures@Base 6.1.20080302
+ ApplyTableValuesToObjectTable@Base 6.1.20080302
+ ApplyTextTransformsToString@Base 6.1.20110713
+ AreAECRActionFieldsEqual@Base 6.1.20081116
+ AreAnyElementsOfSetInAnyAlignment@Base 6.1.20160908
+ AreFeatureClausesUnique@Base 6.1.20080302
+ AreSequenceResiduesIdentical@Base 6.1.20120620
+ ArticleIdAsnRead@Base 6.1.20030421
+ ArticleIdAsnWrite@Base 6.1.20030421
+ ArticleIdFree@Base 6.1.20030421
+ ArticleIdNew@Base 6.1.20030421
+ Asn1BondTypeFromMacroBondType@Base 6.1.20081116
+ Asn1SiteTypeFromMacroSiteType@Base 6.1.20081116
+ Asn2ffJobCreate@Base 6.1.20030421
+ Asn2gbAddBlock@Base 6.1.20040204
+ Asn2gnbkCompressSpaces@Base 6.1.20040204
+ AsnIndexedLibFetchDisable@Base 6.1.20041020
+ AsnIndexedLibFetchEnable@Base 6.1.20041020
+ AssemblyDateFromCollectionDate@Base 6.1.20160908
+ AssignAtomLocId@Base 6.1.20030421
+ AssignBackBone@Base 6.1.20030421
+ AssignFeatureIDs@Base 6.1.20060507
+ AssignFeatureIDsWithOffset@Base 6.1.20120620
+ AssignGeneXrefToFeat@Base 6.1.20160908
+ AssignIDsInEntity@Base 6.1.20030421
+ AssignIDsInEntityEx@Base 6.1.20050429
+ AssignIons@Base 6.1.20030421
+ AssignVirtual@Base 6.1.20030421
+ AttachDataForProc@Base 6.1.20030421
+ AuthListAsnRead@Base 6.1.20030421
+ AuthListAsnWrite@Base 6.1.20030421
+ AuthListFree@Base 6.1.20030421
+ AuthListMatch@Base 6.1.20030421
+ AuthListNew@Base 6.1.20030421
+ AuthorAsnRead@Base 6.1.20030421
+ AuthorAsnWrite@Base 6.1.20030421
+ AuthorFixActionAsnRead@Base 6.1.20110713
+ AuthorFixActionAsnWrite@Base 6.1.20110713
+ AuthorFixActionFree@Base 6.1.20110713
+ AuthorFixActionNew@Base 6.1.20110713
+ AuthorFree@Base 6.1.20030421
+ AuthorMatch@Base 6.1.20050605
+ AuthorNew@Base 6.1.20030421
+ AutoConvertCDSToMiscFeat@Base 6.1.20090719
+ AutoDefForSeqEntry@Base 6.1.20080302
+ AutoDefForSeqEntryEx@Base 6.1.20160908
+ AutoFixSpecialCharactersInEntity@Base 6.1.20110713
+ AutoReplaceSpecialCharactersInTabTable@Base 6.1.20110713
+ AutoReplaceSpecialCharactersInText@Base 6.1.20110713
+ AutoReplaceSpecialCharactersWithMessage@Base 6.1.20110713
+ AutoapplyStructuredCommentPrefix@Base 6.1.20120620
+ AutodefActionAsnRead@Base 6.1.20090301
+ AutodefActionAsnWrite@Base 6.1.20090301
+ AutodefActionFree@Base 6.1.20090301
+ AutodefActionNew@Base 6.1.20090301
+ AutofixActionAsnRead@Base 6.1.20120620
+ AutofixActionAsnWrite@Base 6.1.20120620
+ AutofixActionFree@Base 6.1.20120620
+ AutofixActionNew@Base 6.1.20120620
+ AutofixDiscrepancies@Base 6.1.20090719
+ Avl_Clear@Base 6.1.20030421
+ Avl_Delete@Base 6.1.20030421
+ Avl_Initialize@Base 6.1.20030421
+ Avl_Insert@Base 6.1.20030421
+ Avl_Search@Base 6.1.20030421
+ Avl_SetUnique@Base 6.1.20030421
+ Avl_TotalNodes@Base 6.1.20030421
+ Avl_Traverse@Base 6.1.20030421
+ BLASTGetBOByRID@Base 6.1.20030421
+ BLASTGetBOByRIDEx@Base 6.1.20040204
+ BLASTGetQueryBioseqByRID@Base 6.1.20030421
+ BLASTGetQueryBioseqByRIDEx@Base 6.1.20030421
+ BLASTGetQuerySummary@Base 6.1.20030421
+ BLASTGetSeqAnnotByRID@Base 6.1.20030421
+ BLASTGetSeqAnnotByRIDEx@Base 6.1.20030421
+ BSCompressDNA@Base 6.1.20030421
+ BSCompressDNANew@Base 6.1.20030421
+ BSCompressDNAOld@Base 6.1.20030421
+ BSConvertSeq@Base 6.1.20030421
+ BSPack@Base 6.1.20030421
+ BSRebuildDNA@Base 6.1.20030421
+ BSRebuildDNA_4na@Base 6.1.20030421
+ BarcodeTestBarcodeIdString@Base 6.1.20070822
+ BarcodeTestConfigFree@Base 6.1.20070822
+ BarcodeTestConfigNew@Base 6.1.20070822
+ BarcodeTestGenbankIdString@Base 6.1.20070822
+ BarcodeTestResultsCopy@Base 6.1.20070822
+ BarcodeTestResultsExtractPass@Base 6.1.20110713
+ BarcodeTestResultsFree@Base 6.1.20070822
+ BarcodeTestResultsListFree@Base 6.1.20070822
+ BarcodeTestResultsNew@Base 6.1.20070822
+ BarcodeValidateOneSeqEntry@Base 6.1.20081116
+ BaseSegFree@Base 6.1.20090301
+ BaseSegNew@Base 6.1.20090301
+ BasicSeqAnnotCleanup@Base 6.1.20100808
+ BasicSeqEntryCleanup@Base 6.1.20030421
+ BatchExtraFree@Base 6.1.20090301
+ BatchExtraNew@Base 6.1.20090301
+ BestSeqAlignStats@Base 6.1.20030421
+ BiblioAsnLoad@Base 6.1.20030421
+ BinomialOrgNameAsnRead@Base 6.1.20030421
+ BinomialOrgNameAsnWrite@Base 6.1.20030421
+ BinomialOrgNameFree@Base 6.1.20030421
+ BinomialOrgNameNew@Base 6.1.20030421
+ BioSourceAsnRead@Base 6.1.20030421
+ BioSourceAsnWrite@Base 6.1.20030421
+ BioSourceFree@Base 6.1.20030421
+ BioSourceFromSourceQualVals@Base 6.1.20090301
+ BioSourceHasOldOrgModQualifiers@Base 6.1.20070822
+ BioSourceHasOldSubSourceQualifiers@Base 6.1.20070822
+ BioSourceMatch@Base 6.1.20050605
+ BioSourceNew@Base 6.1.20030421
+ BiomolFromMoleculeType@Base 6.1.20080302
+ BiomolNameFromBiomol@Base 6.1.20080302
+ BioseqAsnRead@Base 6.1.20030421
+ BioseqAsnWrite@Base 6.1.20030421
+ BioseqAsnWriteAsTSeq@Base 6.1.20031028
+ BioseqComplement@Base 6.1.20030421
+ BioseqContextFree@Base 6.1.20030421
+ BioseqContextGetSeqDescr@Base 6.1.20030421
+ BioseqContextGetSeqFeat@Base 6.1.20030421
+ BioseqContextGetTitle@Base 6.1.20030421
+ BioseqContextNew@Base 6.1.20030421
+ BioseqConvert@Base 6.1.20030421
+ BioseqCopy@Base 6.1.20030421
+ BioseqCopyEx@Base 6.1.20030421
+ BioseqDelete@Base 6.1.20030421
+ BioseqDeleteEx@Base 6.1.20100808
+ BioseqFastaMemStream@Base 6.1.20041020
+ BioseqFastaStream@Base 6.1.20040204
+ BioseqFastaStreamEx@Base 6.1.20070822
+ BioseqFetch@Base 6.1.20030421
+ BioseqFetchDisable@Base 6.1.20030421
+ BioseqFetchInit@Base 6.1.20030421
+ BioseqFind@Base 6.1.20030421
+ BioseqFindCore@Base 6.1.20030421
+ BioseqFindEntity@Base 6.1.20030421
+ BioseqFindFromSeqLoc@Base 6.1.20030421
+ BioseqFindInSeqEntry@Base 6.1.20030421
+ BioseqFindSpecial@Base 6.1.20070822
+ BioseqFree@Base 6.1.20030421
+ BioseqFreeComponents@Base 6.1.20030421
+ BioseqFromAlignmentID@Base 6.1.20160908
+ BioseqGetCode@Base 6.1.20030421
+ BioseqGetGBDivCode@Base 6.1.20030421
+ BioseqGetGaps@Base 6.1.20030421
+ BioseqGetLen@Base 6.1.20030421
+ BioseqGetNumbering@Base 6.1.20030421
+ BioseqGetSegLens@Base 6.1.20030421
+ BioseqGetSeqDescr@Base 6.1.20030421
+ BioseqGetTitle@Base 6.1.20030421
+ BioseqHasBarcodeKeyword@Base 6.1.20100808
+ BioseqHasFeature@Base 6.1.20030421
+ BioseqHasKeyword@Base 6.1.20110713
+ BioseqHasLandMark@Base 6.1.20030421
+ BioseqHasMapLegend@Base 6.1.20030421
+ BioseqHash@Base 6.1.20030421
+ BioseqInsert@Base 6.1.20030421
+ BioseqInstAsnRead@Base 6.1.20030421
+ BioseqInstAsnWrite@Base 6.1.20030421
+ BioseqLabel@Base 6.1.20030421
+ BioseqList@Base 6.1.20030421
+ BioseqLoad@Base 6.1.20030421
+ BioseqLock@Base 6.1.20030421
+ BioseqLockById@Base 6.1.20030421
+ BioseqMatch@Base 6.1.20030421
+ BioseqNew@Base 6.1.20030421
+ BioseqOrderInSeqIdList@Base 6.1.20030421
+ BioseqOverwrite@Base 6.1.20030421
+ BioseqPack@Base 6.1.20030421
+ BioseqRawConvert@Base 6.1.20030421
+ BioseqRawPack@Base 6.1.20030421
+ BioseqRawToFasta@Base 6.1.20030421
+ BioseqRawToFastaExtra@Base 6.1.20030421
+ BioseqRawToFastaExtraEx@Base 6.1.20030421
+ BioseqRawToFastaX@Base 6.1.20030421
+ BioseqReload@Base 6.1.20030421
+ BioseqReplaceID@Base 6.1.20030421
+ BioseqRevComp@Base 6.1.20030421
+ BioseqReverse@Base 6.1.20030421
+ BioseqSetAsnRead@Base 6.1.20030421
+ BioseqSetAsnWrite@Base 6.1.20030421
+ BioseqSetFree@Base 6.1.20030421
+ BioseqSetFreeComponents@Base 6.1.20030421
+ BioseqSetLabel@Base 6.1.20030421
+ BioseqSetNew@Base 6.1.20030421
+ BioseqToDeltaByGapFeat@Base 6.1.20160908
+ BioseqToDeltaMergeGapFeat@Base 6.1.20160908
+ BioseqToFasta@Base 6.1.20030421
+ BioseqToFastaDump@Base 6.1.20030421
+ BioseqToFastaX@Base 6.1.20030421
+ BioseqToGeneticCode@Base 6.1.20060301
+ BioseqToGnbk@Base 6.1.20030421
+ BioseqToTSeq@Base 6.1.20030421
+ BioseqTrimN@Base 6.1.20030421
+ BioseqUnlock@Base 6.1.20030421
+ BioseqUnlockById@Base 6.1.20030421
+ Bioseq_repr@Base 6.1.20030421
+ Bioseq_set_class@Base 6.1.20030421
+ Biostruc2Modelstruc@Base 6.1.20030421
+ BiostrucAnnotSetAsnRead@Base 6.1.20030421
+ BiostrucAnnotSetAsnWrite@Base 6.1.20030421
+ BiostrucAnnotSetFree@Base 6.1.20030421
+ BiostrucAnnotSetNew@Base 6.1.20030421
+ BiostrucAsnGet@Base 6.1.20030421
+ BiostrucAsnRead@Base 6.1.20030421
+ BiostrucAsnWrite@Base 6.1.20030421
+ BiostrucAvail@Base 6.1.20030421
+ BiostrucFeatureNew@Base 6.1.20030421
+ BiostrucFeatureSetNew@Base 6.1.20030421
+ BiostrucFree@Base 6.1.20030421
+ BiostrucIdAsnRead@Base 6.1.20030421
+ BiostrucIdAsnWrite@Base 6.1.20030421
+ BiostrucIdFree@Base 6.1.20030421
+ BiostrucResidueGraphSetFree@Base 6.1.20030421
+ BlastDefLineAsnRead@Base 6.1.20030421
+ BlastDefLineAsnWrite@Base 6.1.20030421
+ BlastDefLineFree@Base 6.1.20030421
+ BlastDefLineNew@Base 6.1.20030421
+ BlastDefLineSetAsnRead@Base 6.1.20030421
+ BlastDefLineSetAsnWrite@Base 6.1.20030421
+ BlastDefLineSetFree@Base 6.1.20030421
+ BlockPropertyAsnRead@Base 6.1.20070822
+ BlockPropertyAsnWrite@Base 6.1.20070822
+ BlockPropertyFree@Base 6.1.20070822
+ BlockPropertyNew@Base 6.1.20070822
+ Blockify@Base 6.1.20030421
+ Bond@Base 6.1.20030421
+ BuffFree@Base 6.1.20030421
+ BufferFree@Base 6.1.20030421
+ BuildDefLineFeatClauseList@Base 6.1.20080302
+ BuildDefLinesFromFeatClauseListsForOneBsp@Base 6.1.20110713
+ BuildDefinitionLinesFromFeatureClauseLists@Base 6.1.20080302
+ BuildFieldPairFromFromField@Base 6.1.20081116
+ BuildGeneList@Base 6.1.20030421
+ BuildNonFeatureListClause@Base 6.1.20100808
+ BuildOneDefinitionLine@Base 6.1.20100808
+ BuildProtLoc@Base 6.1.20081116
+ BuildStringsField@Base 6.1.20160908
+ CCStrToInt@Base 6.1.20030421
+ CCStrToLong@Base 6.1.20030421
+ CDD_RID_glb@Base 6.1.20030421
+ CDSGeneProtConstraintFieldAsnRead@Base 6.1.20080302
+ CDSGeneProtConstraintFieldAsnWrite@Base 6.1.20080302
+ CDSGeneProtConstraintFieldFree@Base 6.1.20080302
+ CDSGeneProtFeatureNameFromFeatureType@Base 6.1.20080302
+ CDSGeneProtFieldPairAsnRead@Base 6.1.20080302
+ CDSGeneProtFieldPairAsnWrite@Base 6.1.20080302
+ CDSGeneProtFieldPairFree@Base 6.1.20080302
+ CDSGeneProtFieldPairNew@Base 6.1.20080302
+ CDSGeneProtNameFromField@Base 6.1.20080302
+ CDSGeneProtPseudoConstraintAsnRead@Base 6.1.20080302
+ CDSGeneProtPseudoConstraintAsnWrite@Base 6.1.20080302
+ CDSGeneProtPseudoConstraintFree@Base 6.1.20080302
+ CDSGeneProtPseudoConstraintNew@Base 6.1.20080302
+ CDSGeneProtQualConstraintAsnRead@Base 6.1.20080302
+ CDSGeneProtQualConstraintAsnWrite@Base 6.1.20080302
+ CDSGeneProtQualConstraintFree@Base 6.1.20080302
+ CDSGeneProtQualConstraintNew@Base 6.1.20080302
+ CDSPartialsFromTranslation@Base 6.1.20160908
+ C_atoms@Base 6.1.20030421
+ CacheAccnList@Base 6.1.20031028
+ Cat2Strings@Base 6.1.20030421
+ CautiousSeqEntryCleanup@Base 6.1.20030421
+ CdRegionAsnRead@Base 6.1.20030421
+ CdRegionAsnWrite@Base 6.1.20030421
+ CdRegionFastaStream@Base 6.1.20090301
+ CdRegionFastaStreamEx@Base 6.1.20120620
+ CdRegionFree@Base 6.1.20030421
+ CdRegionNew@Base 6.1.20030421
+ CdTransCheck@Base 6.1.20030421
+ CddAsynchronousQuery@Base 6.1.20031028
+ CddCheckQueue@Base 6.1.20031028
+ CddCorrectIDs@Base 6.1.20031028
+ CddOpenConnection@Base 6.1.20031028
+ CddReadReply@Base 6.1.20031028
+ CddSynchronousQuery@Base 6.1.20031028
+ CddWaitForReply@Base 6.1.20031028
+ ChangeCitArtMLAuthorsToSTD@Base 6.1.20070822
+ ChangeCitQual@Base 6.1.20030421
+ ChangeMlaBackMLAuthorsToSTD@Base 6.1.20070822
+ ChangeSeqIdToWorstID@Base 6.1.20050429
+ ChangeSeqLocToWorstID@Base 6.1.20050429
+ ChangeStringWithTildes@Base 6.1.20030421
+ CheckAndGetNAFeatLoc@Base 6.1.20030421
+ CheckBioSourceQuals@Base 6.1.20081116
+ CheckBioSourceQualsAsnDisc@Base 6.1.20081116
+ CheckBioseqEndsForNAndGap@Base 6.1.20160908
+ CheckBufferState@Base 6.1.20030421
+ CheckDnaResidue@Base 6.1.20030421
+ CheckEndPunctuation@Base 6.1.20030421
+ CheckForDuplicateColumns@Base 6.1.20120620
+ CheckForEqualSign@Base 6.1.20030421
+ CheckForQual@Base 6.1.20030421
+ CheckGenProdSetsInSeqEntry@Base 6.1.20080302
+ CheckNAFeat@Base 6.1.20030421
+ CheckObjTableForExistingText@Base 6.1.20080302
+ CheckObjTableForRowsThatApplyToTheSameDestination@Base 6.1.20080302
+ CheckPointInBioseq@Base 6.1.20030421
+ CheckPubs@Base 6.1.20030421
+ CheckSeqLocForPartial@Base 6.1.20030421
+ CheckSeqLocForPartialEx@Base 6.1.20110713
+ CheckSeqPort@Base 6.1.20030421
+ CheckTableForExistingText@Base 6.1.20080302
+ CheckTaxNamesAgainstTaxDatabase@Base 6.1.20070822
+ CheckXrefFeat@Base 6.1.20030421
+ CheckXrefLine@Base 6.1.20030421
+ ChooseAllDiscrepancies@Base 6.1.20100808
+ ChooseFixableDiscrepancies@Base 6.1.20090719
+ CitArtAsnRead@Base 6.1.20030421
+ CitArtAsnWrite@Base 6.1.20030421
+ CitArtBuild@Base 6.1.20030421
+ CitArtFree@Base 6.1.20030421
+ CitArtMatch@Base 6.1.20030421
+ CitArtNew@Base 6.1.20030421
+ CitBookAsnRead@Base 6.1.20030421
+ CitBookAsnWrite@Base 6.1.20030421
+ CitBookFree@Base 6.1.20030421
+ CitBookMatch@Base 6.1.20030421
+ CitBookNew@Base 6.1.20030421
+ CitGenAsnRead@Base 6.1.20030421
+ CitGenAsnWrite@Base 6.1.20030421
+ CitGenFree@Base 6.1.20030421
+ CitGenMatch@Base 6.1.20030421
+ CitGenNew@Base 6.1.20030421
+ CitJourAsnRead@Base 6.1.20030421
+ CitJourAsnWrite@Base 6.1.20030421
+ CitJourFree@Base 6.1.20030421
+ CitJourMatch@Base 6.1.20030421
+ CitJourNew@Base 6.1.20030421
+ CitLetAsnRead@Base 6.1.20030421
+ CitLetAsnWrite@Base 6.1.20030421
+ CitPatAsnRead@Base 6.1.20030421
+ CitPatAsnWrite@Base 6.1.20030421
+ CitPatFree@Base 6.1.20030421
+ CitPatNew@Base 6.1.20030421
+ CitProcAsnRead@Base 6.1.20030421
+ CitProcAsnWrite@Base 6.1.20030421
+ CitRetractAsnRead@Base 6.1.20030421
+ CitRetractAsnWrite@Base 6.1.20030421
+ CitRetractFree@Base 6.1.20030421
+ CitRetractNew@Base 6.1.20030421
+ CitSubAsnRead@Base 6.1.20030421
+ CitSubAsnWrite@Base 6.1.20030421
+ CitSubBuild@Base 6.1.20030421
+ CitSubForSubmission@Base 6.1.20030421
+ CitSubFree@Base 6.1.20030421
+ CitSubMatch@Base 6.1.20030421
+ CitSubNew@Base 6.1.20030421
+ CitSubUpdateBuild@Base 6.1.20030421
+ CkBracketType@Base 6.1.20030421
+ CkLabelType@Base 6.1.20030421
+ CkNumberType@Base 6.1.20030421
+ CkQualEcnum@Base 6.1.20030421
+ CkQualMatchToken@Base 6.1.20030421
+ CkQualNote@Base 6.1.20030421
+ CkQualPosSeqaa@Base 6.1.20030421
+ CkQualPosaa@Base 6.1.20030421
+ CkQualSeqaa@Base 6.1.20030421
+ CkQualSite@Base 6.1.20030421
+ CkQualText@Base 6.1.20030421
+ CkQualTokenType@Base 6.1.20030421
+ CleanOrgModList@Base 6.1.20080302
+ CleanQualValue@Base 6.1.20040204
+ CleanStrandsSeqAlign@Base 6.1.20030421
+ CleanStructuredComment@Base 6.1.20110713
+ CleanSubSourceList@Base 6.1.20080302
+ CleanSubSourcePrimers@Base 6.1.20081116
+ CleanUpAmbiguousYAC@Base 6.1.20030421
+ CleanUpProteinTitles@Base 6.1.20120620
+ CleanUpPubdescAuthors@Base 6.1.20100808
+ CleanUpPubdescBody@Base 6.1.20100808
+ CleanUpSegGap@Base 6.1.20081116
+ CleanUpSeqFeat@Base 6.1.20050429
+ CleanUpSeqLoc@Base 6.1.20100808
+ CleanUpTaxName@Base 6.1.20080302
+ CleanupBlocks@Base 6.1.20030421
+ CleanupDuplicateGBQuals@Base 6.1.20160908
+ CleanupMacroAfterRepeatedUse@Base 6.1.20120620
+ CleanupOneSeqFeat@Base 6.1.20100808
+ CleanupStringsForOneDescriptor@Base 6.1.20100808
+ CleanupSubSourceOrgModOtherDesc@Base 6.1.20110713
+ CleanupSubSourceOrgModOtherFeat@Base 6.1.20110713
+ ClearBioseqFindCache@Base 6.1.20070822
+ ClearFeatIDXrefs@Base 6.1.20050828
+ ClearFeatIDs@Base 6.1.20050828
+ ClearFeatureIDs@Base 6.1.20060507
+ ClearGenBankKeywords@Base 6.1.20030421
+ ClearProteinTitlesInNucProts@Base 6.1.20030421
+ ClearStructures@Base 6.1.20030421
+ ClickableGlobalItemCategorize@Base 6.1.20160908
+ ClickableItemFree@Base 6.1.20080302
+ ClickableItemObjectListCopy@Base 6.1.20100808
+ ClickableItemObjectListFree@Base 6.1.20100808
+ CloneRefAsnRead@Base 6.1.20090719
+ CloneRefAsnWrite@Base 6.1.20090719
+ CloneRefFree@Base 6.1.20090719
+ CloneRefNew@Base 6.1.20090719
+ CloneSeqAsnRead@Base 6.1.20090719
+ CloneSeqAsnWrite@Base 6.1.20090719
+ CloneSeqFree@Base 6.1.20090719
+ CloneSeqNew@Base 6.1.20090719
+ CloneSeqSetAsnRead@Base 6.1.20090719
+ CloneSeqSetAsnWrite@Base 6.1.20090719
+ CloneSeqSetFree@Base 6.1.20090719
+ CloseMMDBAPI@Base 6.1.20030421
+ Cn3DWin_Entrez@Base 6.1.20030421
+ Cn3D_Redraw@Base 6.1.20030421
+ Cn3D_ResetActiveStrucProc@Base 6.1.20030421
+ Cn3D_SetQueryCallback@Base 6.1.20030421
+ CodeBreakAsnRead@Base 6.1.20030421
+ CodeBreakAsnWrite@Base 6.1.20030421
+ CodeBreakFree@Base 6.1.20030421
+ CodeBreakNew@Base 6.1.20030421
+ CodingRegionHasTranslExcept@Base 6.1.20081116
+ CodingRegionPartialsFromTranslation@Base 6.1.20160908
+ CodonForIndex@Base 6.1.20030421
+ CodonToGcIndex@Base 6.1.20030421
+ CollAlignFromSeqAnnot@Base 6.1.20030421
+ CollateDiscrepancyReports@Base 6.1.20080302
+ CollectDiscrepancies@Base 6.1.20070822
+ CollectFeatureForAlign@Base 6.1.20030421
+ CollectFeatureForAlignNode@Base 6.1.20030421
+ CollectFeatureForEditor@Base 6.1.20030421
+ CollectItemForAlignment@Base 6.1.20030421
+ CollectItemForSeqLoc@Base 6.1.20030421
+ CollectItemForSeqLocEx@Base 6.1.20030421
+ CollectSegMapSTSAlign@Base 6.1.20030421
+ CollectSeqLocFromAlignNode@Base 6.1.20030421
+ CollectionDateIsInTheFuture@Base 6.1.20100808
+ CollectionDateIsValid@Base 6.1.20100808
+ CollectionDatesInOrder@Base 6.1.20160908
+ CombineTabTableColumns@Base 6.1.20100808
+ CombineUserObjects@Base 6.1.20030421
+ CommentHasSuspiciousHtml@Base 6.1.20100808
+ CommentRuleAsnRead@Base 6.1.20090719
+ CommentRuleAsnWrite@Base 6.1.20090719
+ CommentRuleFree@Base 6.1.20090719
+ CommentRuleNew@Base 6.1.20090719
+ CommentSetAsnRead@Base 6.1.20090719
+ CommentSetAsnWrite@Base 6.1.20090719
+ CommentSetFree@Base 6.1.20090719
+ CommonBytesTableAsnRead@Base 6.1.20080302
+ CommonBytesTableAsnWrite@Base 6.1.20080302
+ CommonBytesTableFree@Base 6.1.20080302
+ CommonBytesTableNew@Base 6.1.20080302
+ CommonStringTableAsnRead@Base 6.1.20080302
+ CommonStringTableAsnWrite@Base 6.1.20080302
+ CommonStringTableFree@Base 6.1.20080302
+ CommonStringTableNew@Base 6.1.20080302
+ CompSeqAlignFree@Base 6.1.20030421
+ CompSeqAlignPrint@Base 6.1.20030421
+ CompSeqAnnotFree@Base 6.1.20030421
+ CompareFieldTypes@Base 6.1.20081116
+ CompareFieldTypesEx@Base 6.1.20160908
+ CompareGeneName@Base 6.1.20030421
+ CompareSequences@Base 6.1.20120620
+ CompareSfpForHeap@Base 6.1.20030421
+ CompareStringWithGsp@Base 6.1.20030421
+ CompareUserFields@Base 6.1.20160908
+ ComplementSeqData@Base 6.1.20080302
+ CompletenessFromCompletednessType@Base 6.1.20080302
+ CompletenessNameFromCompleteness@Base 6.1.20080302
+ ComposeCodonsRecognizedString@Base 6.1.20030421
+ ComposeGBQuals@Base 6.1.20030421
+ ComposeNoteFromNoteStruct@Base 6.1.20030421
+ ConfigureForBigSequence@Base 6.1.20081116
+ ConfigureForGenomes@Base 6.1.20081116
+ ConfigureForReportType@Base 6.1.20110713
+ ConsensusReadAlnFree@Base 6.1.20090301
+ ConsensusReadAlnNew@Base 6.1.20090301
+ ConsequenceAsnRead@Base 6.1.20100808
+ ConsequenceAsnWrite@Base 6.1.20100808
+ ConsequenceFree@Base 6.1.20100808
+ Consequence_elementAsnRead@Base 6.1.20100808
+ Consequence_elementAsnWrite@Base 6.1.20100808
+ Consequence_elementFree@Base 6.1.20100808
+ Consequence_frameshiftAsnRead@Base 6.1.20100808
+ Consequence_frameshiftAsnWrite@Base 6.1.20100808
+ Consequence_frameshiftFree@Base 6.1.20100808
+ Consequence_frameshiftNew@Base 6.1.20100808
+ Consequence_loss_of_heterozygosityAsnRead@Base 6.1.20100808
+ Consequence_loss_of_heterozygosityAsnWrite@Base 6.1.20100808
+ Consequence_loss_of_heterozygosityFree@Base 6.1.20100808
+ Consequence_loss_of_heterozygosityNew@Base 6.1.20100808
+ ConsolidateBioSourceNotes@Base 6.1.20160908
+ ConsolidateOneLikeOrganismModifier@Base 6.1.20160908
+ ConsolidateOneLikeSubSourceModifier@Base 6.1.20160908
+ ConstraintChoiceAsnRead@Base 6.1.20080302
+ ConstraintChoiceAsnWrite@Base 6.1.20080302
+ ConstraintChoiceFree@Base 6.1.20080302
+ ConstraintChoiceSetAsnRead@Base 6.1.20080302
+ ConstraintChoiceSetAsnWrite@Base 6.1.20080302
+ ConstraintChoiceSetFree@Base 6.1.20080302
+ ContactInfoAsnRead@Base 6.1.20030421
+ ContactInfoAsnWrite@Base 6.1.20030421
+ ContactInfoFree@Base 6.1.20030421
+ ContactInfoLabel@Base 6.1.20030421
+ ContactInfoMatch@Base 6.1.20050605
+ ContactInfoNew@Base 6.1.20030421
+ ContainsNorMoreSetsOfBracketsOrParentheses@Base 6.1.20110713
+ ContainsThreeOrMoreNumbersTogether@Base 6.1.20110713
+ ContigFree@Base 6.1.20081116
+ ContigNew@Base 6.1.20081116
+ ContigReadFree@Base 6.1.20081116
+ ContigReadNew@Base 6.1.20081116
+ ContigRevComp@Base 6.1.20030421
+ ContractClickableItemList@Base 6.1.20081116
+ Convert4NaRandom@Base 6.1.20030421
+ ConvertActionAsnRead@Base 6.1.20080302
+ ConvertActionAsnWrite@Base 6.1.20080302
+ ConvertActionFree@Base 6.1.20080302
+ ConvertActionNew@Base 6.1.20080302
+ ConvertBioSrcToRepeatRegion@Base 6.1.20081116
+ ConvertCDSToMatPeptideForOverlappingCDS@Base 6.1.20090719
+ ConvertCDSToRNA@Base 6.1.20081116
+ ConvertCommentsWithSpacesToStructuredCommentsForSeqEntry@Base 6.1.20100808
+ ConvertEmbedQual@Base 6.1.20030421
+ ConvertFailedCodingRegionsAndRNAsToMiscFeatures@Base 6.1.20160908
+ ConvertFeatureActionAsnRead@Base 6.1.20081116
+ ConvertFeatureActionAsnWrite@Base 6.1.20081116
+ ConvertFeatureActionFree@Base 6.1.20081116
+ ConvertFeatureActionNew@Base 6.1.20081116
+ ConvertFeatureDstOptionsAsnRead@Base 6.1.20081116
+ ConvertFeatureDstOptionsAsnWrite@Base 6.1.20081116
+ ConvertFeatureDstOptionsFree@Base 6.1.20081116
+ ConvertFeatureSrcOptionsAsnRead@Base 6.1.20081116
+ ConvertFeatureSrcOptionsAsnWrite@Base 6.1.20081116
+ ConvertFeatureSrcOptionsFree@Base 6.1.20081116
+ ConvertFromCDSOptionsAsnRead@Base 6.1.20081116
+ ConvertFromCDSOptionsAsnWrite@Base 6.1.20081116
+ ConvertFromCDSOptionsFree@Base 6.1.20081116
+ ConvertFromCDSOptionsNew@Base 6.1.20081116
+ ConvertGeneToImpFeatFunc@Base 6.1.20160908
+ ConvertGeneToRNA@Base 6.1.20081116
+ ConvertGlobalDiscrepancyListToText@Base 6.1.20080302
+ ConvertGlobalDiscrepancyToText@Base 6.1.20080302
+ ConvertImpToImpFunc@Base 6.1.20081116
+ ConvertImpToProtFunc@Base 6.1.20081116
+ ConvertListToMiscFeat@Base 6.1.20160908
+ ConvertLocalIdsToBarcodeIds@Base 6.1.20090719
+ ConvertLocalIdsToTSAIds@Base 6.1.20081116
+ ConvertMiscFeatToCodingRegion@Base 6.1.20090809
+ ConvertMiscFeatToGene@Base 6.1.20110713
+ ConvertNonPseudoCDSToMiscFeat@Base 6.1.20081116
+ ConvertNsToGaps@Base 6.1.20030421
+ ConvertOnePseudoCDSToMiscFeat@Base 6.1.20070822
+ ConvertOnePseudoCDSToMiscFeatEx@Base 6.1.20081116
+ ConvertProtToImpFunc@Base 6.1.20081116
+ ConvertProtToProtFunc@Base 6.1.20081116
+ ConvertPseudoCDSToMiscFeatsForEntityID@Base 6.1.20041020
+ ConvertPubSrcComDescsToFeats@Base 6.1.20030421
+ ConvertRNAToImpFeat@Base 6.1.20120620
+ ConvertRegionToImpFunc@Base 6.1.20081116
+ ConvertRegionToProtFunc@Base 6.1.20081116
+ ConvertRegionToRNAFunc@Base 6.1.20081116
+ ConvertSegSetsToDeltaSequences@Base 6.1.20041020
+ ConvertSourceFeatDescProc@Base 6.1.20080302
+ ConvertToAAImpFeat@Base 6.1.20030421
+ ConvertToNAImpFeat@Base 6.1.20030421
+ ConvertToTermListForm@Base 6.1.20120620
+ ConvertmRNAToCodingRegion@Base 6.1.20160908
+ ConverttRNAToGene@Base 6.1.20160908
+ CopyActionAsnRead@Base 6.1.20080302
+ CopyActionAsnWrite@Base 6.1.20080302
+ CopyActionFree@Base 6.1.20080302
+ CopyActionNew@Base 6.1.20080302
+ CopyDataForProc@Base 6.1.20030421
+ CopyFeatureFromAlign@Base 6.1.20030421
+ CopyTabTable@Base 6.1.20110713
+ CoreBlockAsnRead@Base 6.1.20070822
+ CoreBlockAsnWrite@Base 6.1.20070822
+ CoreBlockFree@Base 6.1.20070822
+ CoreBlockNew@Base 6.1.20070822
+ CoreDefAsnRead@Base 6.1.20070822
+ CoreDefAsnWrite@Base 6.1.20070822
+ CoreDefFree@Base 6.1.20070822
+ CoreDefNew@Base 6.1.20070822
+ CorrectGenCodes@Base 6.1.20160908
+ CorrectGeneFeatLocation@Base 6.1.20030421
+ CountGapsInDeltaSeq@Base 6.1.20030421
+ CountModifiers@Base 6.1.20080302
+ CountNsInSequence@Base 6.1.20081116
+ CountPolymorphismsInBioseq@Base 6.1.20081116
+ CountProteins@Base 6.1.20070822
+ CountSuspectRuleSet@Base 6.1.20110713
+ CountTabTableBlanks@Base 6.1.20080302
+ CountryBoxesOverlap@Base 6.1.20100808
+ CountryClosestToLatLon@Base 6.1.20110713
+ CountryContainsLatLon@Base 6.1.20110713
+ CountryDataScaleIs@Base 6.1.20110713
+ CountryExtremesOverlap@Base 6.1.20110713
+ CountryIsInLatLonList@Base 6.1.20110713
+ CountryIsNearLatLon@Base 6.1.20110713
+ CountryIsValid@Base 6.1.20080302
+ CpNoteToCharPtrStack@Base 6.1.20030421
+ CreateAnnotDescCommentPolicyUserObject@Base 6.1.20060301
+ CreateAsnIndex@Base 6.1.20041020
+ CreateContigCloneUserObject@Base 6.1.20030421
+ CreateDBLinkUserObject@Base 6.1.20090301
+ CreateDefLine@Base 6.1.20030421
+ CreateDefLineEx@Base 6.1.20030421
+ CreateDefLineExEx@Base 6.1.20041020
+ CreateFastaIndex@Base 6.1.20030421
+ CreateFeatureFetchPolicyUserObject@Base 6.1.20060301
+ CreateGeneOntologyUserObject@Base 6.1.20030421
+ CreateGenomeProjectsDBUserObject@Base 6.1.20060301
+ CreateJoinRequest@Base 6.1.20100808
+ CreateMaskByteStore@Base 6.1.20041020
+ CreateMasterAsnIndex@Base 6.1.20070822
+ CreateMatPeptideFromCDS@Base 6.1.20090719
+ CreateModelEvidenceUserObject@Base 6.1.20030421
+ CreateMrnaProteinLinkUserObject@Base 6.1.20030421
+ CreateMultiTaxon3Request@Base 6.1.20041020
+ CreateNcbiCleanupUserObject@Base 6.1.20090719
+ CreateNewCdRgn@Base 6.1.20030421
+ CreateNewDescriptor@Base 6.1.20030421
+ CreateNewDescriptorOnBioseq@Base 6.1.20030421
+ CreateNewFeature@Base 6.1.20030421
+ CreateNewFeatureOnBioseq@Base 6.1.20030421
+ CreateNewGeneRef@Base 6.1.20030421
+ CreateNewProtRef@Base 6.1.20030421
+ CreatePropaStruc@Base 6.1.20030421
+ CreateRefGeneTrackUserObject@Base 6.1.20030421
+ CreateSeqIdFromText@Base 6.1.20080302
+ CreateStructuredCommentTableFromSeqEntry@Base 6.1.20100808
+ CreateStructuredCommentUserObject@Base 6.1.20060507
+ CreateStructuredCommentsForAllFromTable@Base 6.1.20110713
+ CreateStructuredCommentsFromFile@Base 6.1.20081116
+ CreateStructuredCommentsFromRow@Base 6.1.20100808
+ CreateSubmissionUserObject@Base 6.1.20030421
+ CreateTPAAssemblyAccessionField@Base 6.1.20100808
+ CreateTPAAssemblyFromField@Base 6.1.20100808
+ CreateTPAAssemblyToField@Base 6.1.20100808
+ CreateTSAIDsFromDeflineInSep@Base 6.1.20120620
+ CreateTSAIdsActionAsnRead@Base 6.1.20120620
+ CreateTSAIdsActionAsnWrite@Base 6.1.20120620
+ CreateTSAIdsActionFree@Base 6.1.20120620
+ CreateTSAIdsActionNew@Base 6.1.20120620
+ CreateTSAIdsSrcAsnRead@Base 6.1.20120620
+ CreateTSAIdsSrcAsnWrite@Base 6.1.20120620
+ CreateTSAIdsSrcFree@Base 6.1.20120620
+ CreateTaxon3Request@Base 6.1.20041020
+ CreateTpaAssemblyUserObject@Base 6.1.20030421
+ CreateUnverifiedUserObject@Base 6.1.20110713
+ CreateUpdateCitSubFromBestTemplate@Base 6.1.20120620
+ CreateWholeInterval@Base 6.1.20030421
+ DBLinkFieldPairAsnRead@Base 6.1.20110713
+ DBLinkFieldPairAsnWrite@Base 6.1.20110713
+ DBLinkFieldPairFree@Base 6.1.20110713
+ DBLinkFieldPairNew@Base 6.1.20110713
+ DDE_Add@Base 6.1.20030421
+ DDE_AddAGap@Base 6.1.20030421
+ DDE_AddGapAndSplitNode@Base 6.1.20030421
+ DDE_AddGapToEndOfAllRows@Base 6.1.20030421
+ DDE_AddGapToStartOfAllRows@Base 6.1.20030421
+ DDE_AddIndicesToArray@Base 6.1.20030421
+ DDE_AddMsaTxtNode@Base 6.1.20030421
+ DDE_AddRulerDescrNode@Base 6.1.20030421
+ DDE_AreArraysSame@Base 6.1.20030421
+ DDE_AreIdenticalRulerDescrs@Base 6.1.20030421
+ DDE_AreIdenticalRulers@Base 6.1.20030421
+ DDE_AreSimilarRulerDescrs@Base 6.1.20030421
+ DDE_AreSimilarRulers@Base 6.1.20030421
+ DDE_AtEndOfStack@Base 6.1.20030421
+ DDE_AtStartOfStack@Base 6.1.20030421
+ DDE_CenterJustify@Base 6.1.20030421
+ DDE_CleanEnds@Base 6.1.20030421
+ DDE_Copy@Base 6.1.20030421
+ DDE_CreateArraysForDenseSeg@Base 6.1.20030421
+ DDE_CreateBlock@Base 6.1.20030421
+ DDE_CreateDisplay@Base 6.1.20030421
+ DDE_CreateDisplayForBlock@Base 6.1.20030421
+ DDE_CreateDisplayForUnAligned@Base 6.1.20030421
+ DDE_DecDisplayCoords@Base 6.1.20030421
+ DDE_DeleteBlock@Base 6.1.20030421
+ DDE_FirstColumnIsAligned@Base 6.1.20030421
+ DDE_Free@Base 6.1.20030421
+ DDE_FreeStack@Base 6.1.20030421
+ DDE_GetAlignIndices@Base 6.1.20030421
+ DDE_GetAlignStart2@Base 6.1.20030421
+ DDE_GetAlignStart@Base 6.1.20030421
+ DDE_GetAlignStop2@Base 6.1.20030421
+ DDE_GetAlignStop@Base 6.1.20030421
+ DDE_GetBlockWidth@Base 6.1.20030421
+ DDE_GetColStatusForRow@Base 6.1.20030421
+ DDE_GetDisplayRow@Base 6.1.20030421
+ DDE_GetFirstAlignIndex@Base 6.1.20030421
+ DDE_GetFirstDisplayCoord@Base 6.1.20030421
+ DDE_GetGapIndex@Base 6.1.20030421
+ DDE_GetGapStatusOfRows@Base 6.1.20030421
+ DDE_GetIndexOfMaster@Base 6.1.20030421
+ DDE_GetInsertRow@Base 6.1.20030421
+ DDE_GetLastVNP@Base 6.1.20030421
+ DDE_GetLen@Base 6.1.20030421
+ DDE_GetMsaTxtNode2@Base 6.1.20030421
+ DDE_GetMsaTxtNode@Base 6.1.20030421
+ DDE_GetMsaTxtNodeGivenBioseqCoord@Base 6.1.20030421
+ DDE_GetNumBlocks2@Base 6.1.20030421
+ DDE_GetNumBlocks@Base 6.1.20030421
+ DDE_GetNumLeadingUnAlignedGaps@Base 6.1.20030421
+ DDE_GetNumResidues@Base 6.1.20030421
+ DDE_GetNumSegmentsInBlock@Base 6.1.20030421
+ DDE_GetNumTrailingUnAlignedGaps@Base 6.1.20030421
+ DDE_GetNumVisibleRows@Base 6.1.20030421
+ DDE_GetOriginal@Base 6.1.20030421
+ DDE_GetParaGPtr2@Base 6.1.20030421
+ DDE_GetParaGPtr@Base 6.1.20030421
+ DDE_GetPrevVNP@Base 6.1.20030421
+ DDE_GetRowOrder@Base 6.1.20030421
+ DDE_GetStart@Base 6.1.20030421
+ DDE_GetTxtListPtr2@Base 6.1.20030421
+ DDE_GetTxtListPtr@Base 6.1.20030421
+ DDE_HideAllRows@Base 6.1.20030421
+ DDE_HideNewRow@Base 6.1.20030421
+ DDE_HideRow@Base 6.1.20030421
+ DDE_IncDisplayCoords@Base 6.1.20030421
+ DDE_InsertGap@Base 6.1.20030421
+ DDE_IsBefore@Base 6.1.20030421
+ DDE_IsColValid@Base 6.1.20030421
+ DDE_IsEndOfAlignment@Base 6.1.20030421
+ DDE_IsLeftAlignedGap@Base 6.1.20030421
+ DDE_IsLeftAlignedGapInRows@Base 6.1.20030421
+ DDE_IsLeftAlignedGapList@Base 6.1.20030421
+ DDE_IsRightAlignedGap@Base 6.1.20030421
+ DDE_IsRightAlignedGapInRows@Base 6.1.20030421
+ DDE_IsRightAlignedGapList@Base 6.1.20030421
+ DDE_IsStartOfAlignment@Base 6.1.20030421
+ DDE_IsTerminalRightAlignedGap@Base 6.1.20030421
+ DDE_LastColumnIsAligned@Base 6.1.20030421
+ DDE_LeftAddNode@Base 6.1.20030421
+ DDE_LeftJustify@Base 6.1.20030421
+ DDE_LeftMerge@Base 6.1.20030421
+ DDE_LeftMergeAndAddNodeList@Base 6.1.20030421
+ DDE_MergeNodes@Base 6.1.20030421
+ DDE_MergeNodesLists@Base 6.1.20030421
+ DDE_MoveRow@Base 6.1.20030421
+ DDE_New@Base 6.1.20030421
+ DDE_NewStack@Base 6.1.20030421
+ DDE_Next@Base 6.1.20030421
+ DDE_ParaGFree@Base 6.1.20030421
+ DDE_ParaGNew@Base 6.1.20030421
+ DDE_PopListFree@Base 6.1.20030421
+ DDE_PopListNew@Base 6.1.20030421
+ DDE_Prev@Base 6.1.20030421
+ DDE_ReMakeRuler@Base 6.1.20030421
+ DDE_ReMakeRulerForRow@Base 6.1.20030421
+ DDE_RemoveAGap@Base 6.1.20030421
+ DDE_RemoveAlignedGapsFromEndOfRow@Base 6.1.20030421
+ DDE_RemoveAlignedGapsFromEnds@Base 6.1.20030421
+ DDE_RemoveGap@Base 6.1.20030421
+ DDE_RemoveGapFromEndOfAllRows@Base 6.1.20030421
+ DDE_RemoveGapFromStartOfAllRows@Base 6.1.20030421
+ DDE_RestoreRowOrder@Base 6.1.20030421
+ DDE_RightAddNode@Base 6.1.20030421
+ DDE_RightJustify@Base 6.1.20030421
+ DDE_RightMerge@Base 6.1.20030421
+ DDE_RightMergeAndAddNodeList@Base 6.1.20030421
+ DDE_SetTextStyle@Base 6.1.20030421
+ DDE_SetTxtListPtr@Base 6.1.20030421
+ DDE_ShiftBlock@Base 6.1.20030421
+ DDE_ShiftLeftBoundary@Base 6.1.20030421
+ DDE_ShiftLeftBoundaryLeft1@Base 6.1.20030421
+ DDE_ShiftLeftBoundaryRight1@Base 6.1.20030421
+ DDE_ShiftLeftList@Base 6.1.20030421
+ DDE_ShiftRightBoundary@Base 6.1.20030421
+ DDE_ShiftRightBoundaryLeft1@Base 6.1.20030421
+ DDE_ShiftRightBoundaryRight1@Base 6.1.20030421
+ DDE_ShiftRightList@Base 6.1.20030421
+ DDE_ShiftRow@Base 6.1.20030421
+ DDE_ShiftRowLeft1@Base 6.1.20030421
+ DDE_ShiftRowRight1@Base 6.1.20030421
+ DDE_ShowAllRows@Base 6.1.20030421
+ DDE_ShowNewRow@Base 6.1.20030421
+ DDE_ShowRow@Base 6.1.20030421
+ DDE_SplitNode@Base 6.1.20030421
+ DDE_Verify@Base 6.1.20030421
+ DDV_AddColorFunc@Base 6.1.20030421
+ DDV_AddColorGlobal@Base 6.1.20030421
+ DDV_AddMediaInfo@Base 6.1.20030421
+ DDV_AffichageParaG@Base 6.1.20030421
+ DDV_BspInfoDelete@Base 6.1.20030421
+ DDV_BspInfoDeleteList@Base 6.1.20030421
+ DDV_BspInfoNew@Base 6.1.20030421
+ DDV_BuildBspEntitiesTbl@Base 6.1.20030421
+ DDV_BuildDisp_BlockEditor@Base 6.1.20030421
+ DDV_BuildTailDescriptor@Base 6.1.20030421
+ DDV_Clear2Default@Base 6.1.20030421
+ DDV_ClearColor@Base 6.1.20030421
+ DDV_ColorExecute@Base 6.1.20030421
+ DDV_ColorIndex@Base 6.1.20030421
+ DDV_CopyColorCell@Base 6.1.20030421
+ DDV_CreateColorCell@Base 6.1.20030421
+ DDV_CreateColorEntry@Base 6.1.20030421
+ DDV_CreateColorGlobal@Base 6.1.20030421
+ DDV_CreateDefaultColor@Base 6.1.20030421
+ DDV_CreateDisplay@Base 6.1.20030421
+ DDV_CreateDisplayFromIndex2@Base 6.1.20030421
+ DDV_CreateDisplayFromIndex@Base 6.1.20030421
+ DDV_CreateDisplayFromIndex_EX2@Base 6.1.20030421
+ DDV_CreateDisplayFromIndex_EX@Base 6.1.20030421
+ DDV_CreateDisplay_DiscAlign2@Base 6.1.20030421
+ DDV_CreateDisplay_DiscAlign@Base 6.1.20030421
+ DDV_DefaultColor@Base 6.1.20030421
+ DDV_DefaultMediaInfo@Base 6.1.20030421
+ DDV_DefaultMediaInfoByLen@Base 6.1.20030421
+ DDV_DefaultRange@Base 6.1.20030421
+ DDV_DefaultSSColor@Base 6.1.20030421
+ DDV_DeleteColor@Base 6.1.20030421
+ DDV_DeleteColorEntry@Base 6.1.20030421
+ DDV_DeleteColorFunc@Base 6.1.20030421
+ DDV_DeleteColorGlobal@Base 6.1.20030421
+ DDV_DeleteColorQueue@Base 6.1.20030421
+ DDV_DeleteDisplayList@Base 6.1.20030421
+ DDV_DeleteMediaInfo@Base 6.1.20030421
+ DDV_DeleteParaGList@Base 6.1.20030421
+ DDV_DeleteTxtList@Base 6.1.20030421
+ DDV_DispFeaturesForPGP@Base 6.1.20030421
+ DDV_DisplayBlastPairList@Base 6.1.20030421
+ DDV_DisplayDefaultAlign@Base 6.1.20030421
+ DDV_DumpSAPInAFile@Base 6.1.20030421
+ DDV_DumpSAPInFastaFile@Base 6.1.20030421
+ DDV_FreePalette@Base 6.1.20030421
+ DDV_GetArticleInfo@Base 6.1.20030421
+ DDV_GetBLASTCompLine_1@Base 6.1.20030421
+ DDV_GetBLASTCompLine_2@Base 6.1.20030421
+ DDV_GetBLASTCompLine_3@Base 6.1.20030421
+ DDV_GetBspCoordGivenDispCoord2@Base 6.1.20030421
+ DDV_GetBspCoordGivenDispCoord@Base 6.1.20030421
+ DDV_GetBspCoordGivenPgpList@Base 6.1.20030421
+ DDV_GetCellByPosition@Base 6.1.20030421
+ DDV_GetColor@Base 6.1.20030421
+ DDV_GetColorGlobal@Base 6.1.20030421
+ DDV_GetColorGlobalEx@Base 6.1.20030421
+ DDV_GetColorRGB@Base 6.1.20030421
+ DDV_GetDispCoordGivenBspCoord@Base 6.1.20030421
+ DDV_GetEntryBioSource@Base 6.1.20030421
+ DDV_GetFeatColor@Base 6.1.20030421
+ DDV_GetFirstDispCoordGivenBspCoordRange@Base 6.1.20030421
+ DDV_GetFullFASTAforIdxAli@Base 6.1.20030421
+ DDV_GetFullGapFASTAforIdxAli@Base 6.1.20030421
+ DDV_GetLastDispCoordGivenBspCoordRange@Base 6.1.20030421
+ DDV_GetMediaInfo@Base 6.1.20030421
+ DDV_GetSeqAlign@Base 6.1.20030421
+ DDV_GetSequenceFromParaG@Base 6.1.20030421
+ DDV_IdList@Base 6.1.20030421
+ DDV_InitCn3DSAPdispStyles@Base 6.1.20030421
+ DDV_InitColour_When_Start@Base 6.1.20030421
+ DDV_InitDDESAPdispStyles@Base 6.1.20030421
+ DDV_InitDefSAPdispStyles@Base 6.1.20030421
+ DDV_IsVisible@Base 6.1.20030421
+ DDV_LayoutGap@Base 6.1.20030421
+ DDV_LayoutISOColors@Base 6.1.20030421
+ DDV_LayoutMaskRegions@Base 6.1.20030421
+ DDV_LayoutUAregion@Base 6.1.20030421
+ DDV_LoadSSColor@Base 6.1.20030421
+ DDV_LocateParaG@Base 6.1.20030421
+ DDV_NewColorQueue@Base 6.1.20030421
+ DDV_NewMediaInfo@Base 6.1.20030421
+ DDV_OpenBspFullSeqPort@Base 6.1.20030421
+ DDV_PopDisplay2@Base 6.1.20030421
+ DDV_PopDisplay@Base 6.1.20030421
+ DDV_PrintPopSetSummary@Base 6.1.20030421
+ DDV_PrintStudyName@Base 6.1.20030421
+ DDV_ReadSeqBin@Base 6.1.20030421
+ DDV_ReadSeqGivenSpp@Base 6.1.20030421
+ DDV_RemoveMediaInfo@Base 6.1.20030421
+ DDV_RequestColor@Base 6.1.20030421
+ DDV_RequestColorbyName@Base 6.1.20030421
+ DDV_ResetParaGSeqAlignCoord@Base 6.1.20030421
+ DDV_RulerDescrFree@Base 6.1.20030421
+ DDV_RulerDescrNew@Base 6.1.20030421
+ DDV_STD_AAColor@Base 6.1.20030421
+ DDV_STD_NAColor@Base 6.1.20030421
+ DDV_SearchAli@Base 6.1.20030421
+ DDV_SearchColor@Base 6.1.20030421
+ DDV_SearchColorCellbyName@Base 6.1.20030421
+ DDV_SearchColorbyName@Base 6.1.20030421
+ DDV_SetCellByPosition@Base 6.1.20030421
+ DDV_SetColor@Base 6.1.20030421
+ DDV_SetColorCell@Base 6.1.20030421
+ DDV_SetColorChoice@Base 6.1.20030421
+ DDV_SetColorInCell@Base 6.1.20030421
+ DDV_SetColorInMediaInfo@Base 6.1.20030421
+ DDV_SetColorbyColor@Base 6.1.20030421
+ DDV_SetPaletteColor@Base 6.1.20030421
+ DDV_SetVisible@Base 6.1.20030421
+ DDV_ShowSeqAlign@Base 6.1.20030421
+ DNAScoringMatrix@Base 6.1.20030421
+ DateAdvance@Base 6.1.20030421
+ DateAsnRead@Base 6.1.20030421
+ DateAsnWrite@Base 6.1.20030421
+ DateCheck@Base 6.1.20030421
+ DateClean@Base 6.1.20030421
+ DateCurr@Base 6.1.20030421
+ DateDup@Base 6.1.20030421
+ DateFree@Base 6.1.20030421
+ DateMatch@Base 6.1.20030421
+ DateNew@Base 6.1.20030421
+ DateParse@Base 6.1.20100808
+ DatePrint@Base 6.1.20030421
+ DateRead@Base 6.1.20030421
+ DateTimeCurr@Base 6.1.20030421
+ DateToFF@Base 6.1.20040204
+ DateToGB@Base 6.1.20030421
+ DateWrite@Base 6.1.20030421
+ DbHasGi@Base 6.1.20030421
+ DbtagAsnRead@Base 6.1.20030421
+ DbtagAsnWrite@Base 6.1.20030421
+ DbtagCompare@Base 6.1.20081116
+ DbtagDup@Base 6.1.20030421
+ DbtagFree@Base 6.1.20030421
+ DbtagLabel@Base 6.1.20030421
+ DbtagMatch@Base 6.1.20030421
+ DbtagMatchEx@Base 6.1.20081116
+ DbtagNew@Base 6.1.20030421
+ DbxrefIsValid@Base 6.1.20090301
+ DbxrefsMatch@Base 6.1.20081116
+ DeBlockify@Base 6.1.20030421
+ DefLineFeatClauseListFree@Base 6.1.20080302
+ DefLineModifiers@Base 6.1.20080302
+ DefaultFormatBlock@Base 6.1.20040204
+ DefaultSubErrorFunc@Base 6.1.20030421
+ DefineSubmittorKey@Base 6.1.20030421
+ DelFeat@Base 6.1.20030421
+ DelNthFeat@Base 6.1.20030421
+ DelTailBlank@Base 6.1.20030421
+ DeleteBadECNumbers@Base 6.1.20120620
+ DeleteBadECNumbersEx@Base 6.1.20120620
+ DeleteBogoProduct@Base 6.1.20030421
+ DeleteGBQualFromList@Base 6.1.20030421
+ DeleteMarkedObjects@Base 6.1.20030421
+ DeleteMultipleTitles@Base 6.1.20030421
+ DeleteNthAlign@Base 6.1.20030421
+ DeleteRegion@Base 6.1.20030421
+ DeleteRemainingViews@Base 6.1.20061015
+ DeleteSites@Base 6.1.20030421
+ DeltaItemAsnRead@Base 6.1.20100808
+ DeltaItemAsnWrite@Base 6.1.20100808
+ DeltaItemFree@Base 6.1.20100808
+ DeltaItemNew@Base 6.1.20100808
+ DeltaLitOnly@Base 6.1.20050828
+ DeltaSeqAsnRead@Base 6.1.20030421
+ DeltaSeqAsnWrite@Base 6.1.20030421
+ DeltaSeqFree@Base 6.1.20030421
+ DeltaSeqSetAsnRead@Base 6.1.20030421
+ DeltaSeqSetAsnWrite@Base 6.1.20030421
+ DeltaSeqSetFree@Base 6.1.20030421
+ DeltaSeqsToSeqLocs@Base 6.1.20030421
+ DenseDiagAsnRead@Base 6.1.20030421
+ DenseDiagAsnWrite@Base 6.1.20030421
+ DenseDiagCreate@Base 6.1.20030421
+ DenseDiagDup@Base 6.1.20030421
+ DenseDiagFree@Base 6.1.20030421
+ DenseDiagGapList@Base 6.1.20030421
+ DenseDiagInsert@Base 6.1.20030421
+ DenseDiagLink@Base 6.1.20030421
+ DenseDiagLinkSort@Base 6.1.20030421
+ DenseDiagNew@Base 6.1.20030421
+ DenseDiagPrecede@Base 6.1.20030421
+ DenseDiagStats@Base 6.1.20030421
+ DenseDiagToDenseSeg@Base 6.1.20030421
+ DenseDiagToDenseSegFunc@Base 6.1.20030421
+ DenseDiagToGlobalDenseSeg@Base 6.1.20030421
+ DenseSegAsnRead@Base 6.1.20030421
+ DenseSegAsnWrite@Base 6.1.20030421
+ DenseSegFree@Base 6.1.20030421
+ DenseSegGapList@Base 6.1.20030421
+ DenseSegNew@Base 6.1.20030421
+ DenseSegStats@Base 6.1.20030421
+ DenseSegToDenseDiag@Base 6.1.20030421
+ DependentFieldRuleAsnRead@Base 6.1.20100808
+ DependentFieldRuleAsnWrite@Base 6.1.20100808
+ DependentFieldRuleFree@Base 6.1.20100808
+ DependentFieldRuleNew@Base 6.1.20100808
+ DependentFieldSetAsnRead@Base 6.1.20100808
+ DependentFieldSetAsnWrite@Base 6.1.20100808
+ DependentFieldSetFree@Base 6.1.20100808
+ DescStreamFree@Base 6.1.20100808
+ DescStreamListFree@Base 6.1.20100808
+ DescStreamNew@Base 6.1.20100808
+ DescribeBioSourceDifferences@Base 6.1.20120620
+ DescribeStructuredCommentDifferences@Base 6.1.20160908
+ DetachDataForProc@Base 6.1.20030421
+ DisableTRNATests@Base 6.1.20070822
+ DiscReportOutputConfigFree@Base 6.1.20081116
+ DiscReportOutputConfigNew@Base 6.1.20081116
+ DiscrepancyConfigCopy@Base 6.1.20081116
+ DiscrepancyConfigFree@Base 6.1.20070822
+ DiscrepancyConfigNew@Base 6.1.20070822
+ DiscrepancyTestHasAutofix@Base 6.1.20120620
+ DispGroupFindNext@Base 6.1.20030421
+ DispGroupNum@Base 6.1.20030421
+ DoApplyActionToObjectList@Base 6.1.20080302
+ DoApplyActionToObjectListEx@Base 6.1.20090301
+ DoConvertActionToObjectList@Base 6.1.20080302
+ DoConvertActionToObjectListEx@Base 6.1.20090301
+ DoCopyActionToObjectList@Base 6.1.20080302
+ DoCopyActionToObjectListEx@Base 6.1.20090301
+ DoEditActionToObjectList@Base 6.1.20080302
+ DoEditActionToObjectListEx@Base 6.1.20090301
+ DoEinfoQuery@Base 6.1.20120620
+ DoElinkQuery@Base 6.1.20120620
+ DoEsearchQuery@Base 6.1.20120620
+ DoEsummaryQuery@Base 6.1.20120620
+ DoFeaturesMatch@Base 6.1.20081116
+ DoImmediateFormat@Base 6.1.20040616
+ DoImmediateRemoteFeatureFormat@Base 6.1.20041020
+ DoOneBioseq@Base 6.1.20040204
+ DoOneSection@Base 6.1.20040204
+ DoParseActionToObjectList@Base 6.1.20080302
+ DoParseActionToObjectListEx@Base 6.1.20090301
+ DoQuickLinkFormat@Base 6.1.20051206
+ DoRemoveActionToObjectList@Base 6.1.20080302
+ DoRemoveOutsideToObjectList@Base 6.1.20120620
+ DoSequenceLengthsMatch@Base 6.1.20120620
+ DoSpecialLineBreak@Base 6.1.20030421
+ DoSwapActionToObjectList@Base 6.1.20080302
+ DoSwapActionToObjectListEx@Base 6.1.20090301
+ DoTbl2AsnAutoDef@Base 6.1.20160908
+ DocRefAsnRead@Base 6.1.20030421
+ DocRefAsnWrite@Base 6.1.20030421
+ DocRefFree@Base 6.1.20030421
+ DocRefNew@Base 6.1.20030421
+ Does3primerAbutGap@Base 6.1.20160908
+ Does5primerAbutGap@Base 6.1.20160908
+ DoesBiosourceMatchConstraint@Base 6.1.20080302
+ DoesCDSEndWithStopCodon@Base 6.1.20160908
+ DoesDeltaSeqHaveGapTypeOrLinkage@Base 6.1.20070822
+ DoesObjectMatchConstraintChoiceSet@Base 6.1.20081116
+ DoesSeqIDListMeetStringConstraint@Base 6.1.20100808
+ DoesSeqLitHaveGapTypeOrLinkage@Base 6.1.20070822
+ DoesSequenceMatchSequenceConstraint@Base 6.1.20110713
+ DoesSingleStringMatchConstraint@Base 6.1.20080302
+ DoesStringContainPhrase@Base 6.1.20120620
+ DoesStringMatchConstraint@Base 6.1.20080302
+ DoesStringMatchSuspectRule@Base 6.1.20110713
+ DoesTextContainOnlyTheseWords@Base 6.1.20110713
+ E2ReplyAsnRead@Base 6.1.20030421
+ E2ReplyAsnWrite@Base 6.1.20030421
+ E2ReplyFree@Base 6.1.20030421
+ E2RequestAsnRead@Base 6.1.20030421
+ E2RequestAsnWrite@Base 6.1.20030421
+ E2RequestFree@Base 6.1.20030421
+ ECNumberFSAFreeAll@Base 6.1.20061015
+ ECnumberNotInList@Base 6.1.20120620
+ ECnumberWasDeleted@Base 6.1.20120620
+ ECnumberWasReplaced@Base 6.1.20120620
+ EGDbtagAsnRead@Base 6.1.20050429
+ EGDbtagAsnWrite@Base 6.1.20050429
+ EGDbtagFree@Base 6.1.20050429
+ EGDbtagNew@Base 6.1.20050429
+ ELatLonClassify@Base 6.1.20110713
+ EMBLBlockAsnRead@Base 6.1.20030421
+ EMBLBlockAsnWrite@Base 6.1.20030421
+ EMBLBlockFree@Base 6.1.20030421
+ EMBLBlockNew@Base 6.1.20030421
+ EMBL_PrintPubs@Base 6.1.20030421
+ EditActionAsnRead@Base 6.1.20080302
+ EditActionAsnWrite@Base 6.1.20080302
+ EditActionFree@Base 6.1.20080302
+ EditActionNew@Base 6.1.20080302
+ EditFeatureLocationActionAsnRead@Base 6.1.20080302
+ EditFeatureLocationActionAsnWrite@Base 6.1.20080302
+ EditFeatureLocationActionFree@Base 6.1.20080302
+ EditFeatureLocationActionNew@Base 6.1.20080302
+ EditLocationStrandAsnRead@Base 6.1.20080302
+ EditLocationStrandAsnWrite@Base 6.1.20080302
+ EditLocationStrandFree@Base 6.1.20080302
+ EditLocationStrandNew@Base 6.1.20080302
+ EditTSAIds@Base 6.1.20120620
+ EnlargeCharPtrStack@Base 6.1.20030421
+ EnlargeSortList@Base 6.1.20030421
+ EntityIDToGeneticCode@Base 6.1.20030421
+ Entrez2BooleanElementAsnRead@Base 6.1.20030421
+ Entrez2BooleanElementAsnWrite@Base 6.1.20030421
+ Entrez2BooleanElementFree@Base 6.1.20030421
+ Entrez2BooleanExpAsnRead@Base 6.1.20030421
+ Entrez2BooleanExpAsnWrite@Base 6.1.20030421
+ Entrez2BooleanExpFree@Base 6.1.20030421
+ Entrez2BooleanExpNew@Base 6.1.20030421
+ Entrez2BooleanReplyAsnRead@Base 6.1.20030421
+ Entrez2BooleanReplyAsnWrite@Base 6.1.20030421
+ Entrez2BooleanReplyFree@Base 6.1.20030421
+ Entrez2BooleanReplyNew@Base 6.1.20030421
+ Entrez2BooleanTermAsnRead@Base 6.1.20030421
+ Entrez2BooleanTermAsnWrite@Base 6.1.20030421
+ Entrez2BooleanTermFree@Base 6.1.20030421
+ Entrez2BooleanTermNew@Base 6.1.20030421
+ Entrez2DbInfoAsnRead@Base 6.1.20030421
+ Entrez2DbInfoAsnWrite@Base 6.1.20030421
+ Entrez2DbInfoFree@Base 6.1.20030421
+ Entrez2DbInfoNew@Base 6.1.20030421
+ Entrez2DocsumAsnRead@Base 6.1.20030421
+ Entrez2DocsumAsnWrite@Base 6.1.20030421
+ Entrez2DocsumDataAsnRead@Base 6.1.20030421
+ Entrez2DocsumDataAsnWrite@Base 6.1.20030421
+ Entrez2DocsumDataFree@Base 6.1.20030421
+ Entrez2DocsumDataNew@Base 6.1.20030421
+ Entrez2DocsumFieldInfoAsnRead@Base 6.1.20030421
+ Entrez2DocsumFieldInfoAsnWrite@Base 6.1.20030421
+ Entrez2DocsumFieldInfoFree@Base 6.1.20030421
+ Entrez2DocsumFieldInfoNew@Base 6.1.20030421
+ Entrez2DocsumFree@Base 6.1.20030421
+ Entrez2DocsumListAsnRead@Base 6.1.20030421
+ Entrez2DocsumListAsnWrite@Base 6.1.20030421
+ Entrez2DocsumListFree@Base 6.1.20030421
+ Entrez2DocsumListNew@Base 6.1.20030421
+ Entrez2DocsumNew@Base 6.1.20030421
+ Entrez2DtFilterAsnRead@Base 6.1.20030421
+ Entrez2DtFilterAsnWrite@Base 6.1.20030421
+ Entrez2DtFilterFree@Base 6.1.20030421
+ Entrez2DtFilterNew@Base 6.1.20030421
+ Entrez2EvalBooleanAsnRead@Base 6.1.20030421
+ Entrez2EvalBooleanAsnWrite@Base 6.1.20030421
+ Entrez2EvalBooleanFree@Base 6.1.20030421
+ Entrez2EvalBooleanNew@Base 6.1.20030421
+ Entrez2FieldInfoAsnRead@Base 6.1.20030421
+ Entrez2FieldInfoAsnWrite@Base 6.1.20030421
+ Entrez2FieldInfoFree@Base 6.1.20030421
+ Entrez2FieldInfoNew@Base 6.1.20030421
+ Entrez2GetLinksAsnRead@Base 6.1.20030421
+ Entrez2GetLinksAsnWrite@Base 6.1.20030421
+ Entrez2GetLinksFree@Base 6.1.20030421
+ Entrez2GetLinksNew@Base 6.1.20030421
+ Entrez2HierNodeAsnRead@Base 6.1.20030421
+ Entrez2HierNodeAsnWrite@Base 6.1.20030421
+ Entrez2HierNodeFree@Base 6.1.20030421
+ Entrez2HierNodeNew@Base 6.1.20030421
+ Entrez2HierQueryAsnRead@Base 6.1.20030421
+ Entrez2HierQueryAsnWrite@Base 6.1.20030421
+ Entrez2HierQueryFree@Base 6.1.20030421
+ Entrez2HierQueryNew@Base 6.1.20030421
+ Entrez2IdAsnRead@Base 6.1.20030421
+ Entrez2IdAsnWrite@Base 6.1.20030421
+ Entrez2IdFree@Base 6.1.20030421
+ Entrez2IdListAsnRead@Base 6.1.20030421
+ Entrez2IdListAsnWrite@Base 6.1.20030421
+ Entrez2IdListFree@Base 6.1.20030421
+ Entrez2IdListNew@Base 6.1.20030421
+ Entrez2IdNew@Base 6.1.20030421
+ Entrez2InfoAsnRead@Base 6.1.20030421
+ Entrez2InfoAsnWrite@Base 6.1.20030421
+ Entrez2InfoFree@Base 6.1.20030421
+ Entrez2InfoNew@Base 6.1.20030421
+ Entrez2LimitsAsnRead@Base 6.1.20030421
+ Entrez2LimitsAsnWrite@Base 6.1.20030421
+ Entrez2LimitsFree@Base 6.1.20030421
+ Entrez2LimitsNew@Base 6.1.20030421
+ Entrez2LinkCountAsnRead@Base 6.1.20030421
+ Entrez2LinkCountAsnWrite@Base 6.1.20030421
+ Entrez2LinkCountFree@Base 6.1.20030421
+ Entrez2LinkCountListAsnRead@Base 6.1.20030421
+ Entrez2LinkCountListAsnWrite@Base 6.1.20030421
+ Entrez2LinkCountListFree@Base 6.1.20030421
+ Entrez2LinkCountListNew@Base 6.1.20030421
+ Entrez2LinkCountNew@Base 6.1.20030421
+ Entrez2LinkInfoAsnRead@Base 6.1.20030421
+ Entrez2LinkInfoAsnWrite@Base 6.1.20030421
+ Entrez2LinkInfoFree@Base 6.1.20030421
+ Entrez2LinkInfoNew@Base 6.1.20030421
+ Entrez2LinkSetAsnRead@Base 6.1.20030421
+ Entrez2LinkSetAsnWrite@Base 6.1.20030421
+ Entrez2LinkSetFree@Base 6.1.20030421
+ Entrez2LinkSetNew@Base 6.1.20030421
+ Entrez2ReplyAsnRead@Base 6.1.20030421
+ Entrez2ReplyAsnWrite@Base 6.1.20030421
+ Entrez2ReplyFree@Base 6.1.20030421
+ Entrez2ReplyNew@Base 6.1.20030421
+ Entrez2RequestAsnRead@Base 6.1.20030421
+ Entrez2RequestAsnWrite@Base 6.1.20030421
+ Entrez2RequestFree@Base 6.1.20030421
+ Entrez2RequestNew@Base 6.1.20030421
+ Entrez2StreamTerms@Base 6.1.20160908
+ Entrez2TermAsnRead@Base 6.1.20030421
+ Entrez2TermAsnWrite@Base 6.1.20030421
+ Entrez2TermFree@Base 6.1.20030421
+ Entrez2TermListAsnRead@Base 6.1.20030421
+ Entrez2TermListAsnWrite@Base 6.1.20030421
+ Entrez2TermListFree@Base 6.1.20030421
+ Entrez2TermListNew@Base 6.1.20030421
+ Entrez2TermNew@Base 6.1.20030421
+ Entrez2TermPosAsnRead@Base 6.1.20030421
+ Entrez2TermPosAsnWrite@Base 6.1.20030421
+ Entrez2TermPosFree@Base 6.1.20030421
+ Entrez2TermPosNew@Base 6.1.20030421
+ Entrez2TermQueryAsnRead@Base 6.1.20030421
+ Entrez2TermQueryAsnWrite@Base 6.1.20030421
+ Entrez2TermQueryFree@Base 6.1.20030421
+ Entrez2TermQueryNew@Base 6.1.20030421
+ EntrezASN1Detected@Base 6.1.20030421
+ EntrezAddToBooleanRequest@Base 6.1.20030421
+ EntrezAsynchronousQuery@Base 6.1.20030421
+ EntrezCheckQueue@Base 6.1.20030421
+ EntrezCreateBooleanRequest@Base 6.1.20030421
+ EntrezCreateDocSumRequest@Base 6.1.20030421
+ EntrezCreateEntrezIdList@Base 6.1.20030421
+ EntrezCreateEntrezLimits@Base 6.1.20030421
+ EntrezCreateGetInfoRequest@Base 6.1.20030421
+ EntrezCreateGetLinkCountsRequest@Base 6.1.20030421
+ EntrezCreateGetLinkedRequest@Base 6.1.20030421
+ EntrezCreateGetLinksRequest@Base 6.1.20030421
+ EntrezCreateGetTermHierarchyRequest@Base 6.1.20030421
+ EntrezCreateGetTermListRequest@Base 6.1.20030421
+ EntrezCreateGetTermPositionRequest@Base 6.1.20030421
+ EntrezExtractBooleanReply@Base 6.1.20030421
+ EntrezExtractDocsumReply@Base 6.1.20030421
+ EntrezExtractErrorReply@Base 6.1.20031028
+ EntrezExtractHierNodeReply@Base 6.1.20030421
+ EntrezExtractInfoReply@Base 6.1.20030421
+ EntrezExtractLinkCountReply@Base 6.1.20030421
+ EntrezExtractLinkedReply@Base 6.1.20030421
+ EntrezExtractLinksReply@Base 6.1.20030421
+ EntrezExtractTermListReply@Base 6.1.20030421
+ EntrezExtractTermPosReply@Base 6.1.20030421
+ EntrezGetUIDforSeqIdString@Base 6.1.20030421
+ EntrezOpenConnection@Base 6.1.20030421
+ EntrezReadReply@Base 6.1.20030421
+ EntrezSetProgramName@Base 6.1.20030421
+ EntrezSetService@Base 6.1.20030421
+ EntrezSetUseHistoryFlag@Base 6.1.20030421
+ EntrezSynchronousQuery@Base 6.1.20030421
+ EntrezWaitForReply@Base 6.1.20030421
+ Entrez_Query_Term@Base 6.1.20030421
+ EntrezgeneAsnRead@Base 6.1.20050429
+ EntrezgeneAsnWrite@Base 6.1.20050429
+ EntrezgeneFree@Base 6.1.20050429
+ EntrezgeneNew@Base 6.1.20050429
+ EntrezgeneSetAsnRead@Base 6.1.20050429
+ EntrezgeneSetAsnWrite@Base 6.1.20050429
+ EntrezgeneSetFree@Base 6.1.20050429
+ EntryStripSerialNumber@Base 6.1.20030421
+ EquivalentOrgMod@Base 6.1.20070822
+ EquivalentOrgModEx@Base 6.1.20070822
+ EquivalentSubSource@Base 6.1.20070822
+ EquivalentSubSourceEx@Base 6.1.20070822
+ ErrorInfoFree@Base 6.1.20040204
+ ErrorInfoNew@Base 6.1.20040204
+ EvidenceBasisAsnRead@Base 6.1.20110713
+ EvidenceBasisAsnWrite@Base 6.1.20110713
+ EvidenceBasisFree@Base 6.1.20110713
+ EvidenceBasisNew@Base 6.1.20110713
+ ExpandClickableItemList@Base 6.1.20081116
+ ExpandDiscrepancyReportTestsFromString@Base 6.1.20080302
+ ExperimentSupportAsnRead@Base 6.1.20110713
+ ExperimentSupportAsnWrite@Base 6.1.20110713
+ ExperimentSupportFree@Base 6.1.20110713
+ ExperimentSupportNew@Base 6.1.20110713
+ ExportFieldTable@Base 6.1.20081116
+ ExportProductUpdateTable@Base 6.1.20110713
+ ExportProductUpdateTableWithPrecomputedSuggestions@Base 6.1.20110713
+ ExtLocAsnRead@Base 6.1.20100808
+ ExtLocAsnWrite@Base 6.1.20100808
+ ExtLocFree@Base 6.1.20100808
+ ExtLocNew@Base 6.1.20100808
+ Extend3PartialSeqIntToEndOrGap@Base 6.1.20090809
+ Extend5PartialSeqIntToEndOrGap@Base 6.1.20090809
+ ExtendPartialsToEndOrGap@Base 6.1.20090301
+ ExtendSeqLocToEnd@Base 6.1.20080302
+ ExtendSeqLocToEndOrGap@Base 6.1.20090809
+ ExtendSingleGeneOnMRNA@Base 6.1.20061015
+ ExtendToFeatureAsnRead@Base 6.1.20120620
+ ExtendToFeatureAsnWrite@Base 6.1.20120620
+ ExtendToFeatureFree@Base 6.1.20120620
+ ExtendToFeatureNew@Base 6.1.20120620
+ ExtraCDSCreationActions@Base 6.1.20090809
+ ExtractAccession@Base 6.1.20030421
+ ExtractBioSourceAndPubs@Base 6.1.20030421
+ ExtractNthValNode@Base 6.1.20120620
+ FDGetDeflineAsnFromBioseq@Base 6.1.20030421
+ FDGetTaxNamesFromBioseq@Base 6.1.20030421
+ FFAddNChar@Base 6.1.20040204
+ FFAddNewLine@Base 6.1.20040204
+ FFAddOneChar@Base 6.1.20040204
+ FFAddOneString@Base 6.1.20040204
+ FFAddPeriod@Base 6.1.20040204
+ FFAddString_NoRedund@Base 6.1.20040204
+ FFAddString_NoRedundEx@Base 6.1.20160908
+ FFAddTextToString@Base 6.1.20040204
+ FFAdvanceChar@Base 6.1.20070822
+ FFBSPrint@Base 6.1.20030421
+ FFCalculateLineBreak@Base 6.1.20040204
+ FFCatenateSubString@Base 6.1.20040204
+ FFCharAt@Base 6.1.20040204
+ FFEmpty@Base 6.1.20040204
+ FFEndPrint@Base 6.1.20040204
+ FFEndPrintEx@Base 6.1.20110713
+ FFExpandTildes@Base 6.1.20040204
+ FFExtractNextCloseLink@Base 6.1.20051206
+ FFExtractNextOpenLink@Base 6.1.20051206
+ FFFindChar@Base 6.1.20040204
+ FFFindSingleChar@Base 6.1.20051206
+ FFFlatLoc@Base 6.1.20040204
+ FFGetString@Base 6.1.20040204
+ FFIsStartOfHTMLAmpersandEscape@Base 6.1.20110713
+ FFIsStartOfLink@Base 6.1.20040204
+ FFLength@Base 6.1.20040204
+ FFLineBreakSplitsHtmlLink@Base 6.1.20051206
+ FFLineWrap@Base 6.1.20040204
+ FFNextChar@Base 6.1.20070822
+ FFOldExpand@Base 6.1.20040204
+ FFPrint@Base 6.1.20030421
+ FFProcessTildes@Base 6.1.20040204
+ FFRecycleString@Base 6.1.20040204
+ FFRemainingLength@Base 6.1.20051206
+ FFReplaceTildesWithSpaces@Base 6.1.20040204
+ FFSavePosition@Base 6.1.20040204
+ FFSemicolonSeparateTildes@Base 6.1.20081116
+ FFSkipHTMLAmpersandEscape@Base 6.1.20110713
+ FFSkipLink@Base 6.1.20040204
+ FFStartPrint@Base 6.1.20040204
+ FFStartsWith@Base 6.1.20110713
+ FFStringSearch@Base 6.1.20040204
+ FFToCharPtr@Base 6.1.20040204
+ FFToCharPtrEx@Base 6.1.20110713
+ FFTrim@Base 6.1.20040204
+ FF_Add_NCBI_Base_URL@Base 6.1.20090301
+ FF_asn2gb_www_featkey@Base 6.1.20120620
+ FF_asn2gb_www_featkey_Ex@Base 6.1.20160908
+ FF_www_db_xref@Base 6.1.20040204
+ FF_www_featloc@Base 6.1.20040204
+ FF_www_specimen_voucher@Base 6.1.20090301
+ FastaDefLine@Base 6.1.20030421
+ FastaDumpFileFunc@Base 6.1.20030421
+ FastaFileFunc@Base 6.1.20030421
+ FastaGetOriginalId@Base 6.1.20160908
+ FastaId@Base 6.1.20030421
+ FastaIdEx@Base 6.1.20160908
+ FastaLibBioseqFetchDisable@Base 6.1.20030421
+ FastaLibBioseqFetchEnable@Base 6.1.20030421
+ FastaReadSequence@Base 6.1.20030421
+ FastaReadSequenceMem@Base 6.1.20030421
+ FastaSeqLine@Base 6.1.20030421
+ FastaSeqLineEx@Base 6.1.20030421
+ FastaSeqPort@Base 6.1.20030421
+ FastaSeqPortEx@Base 6.1.20030421
+ FastaToSeqBuff@Base 6.1.20030421
+ FastaToSeqBuffEx@Base 6.1.20030421
+ FastaToSeqBuffForDb@Base 6.1.20030421
+ FastaToSeqEntry@Base 6.1.20030421
+ FastaToSeqEntryEx@Base 6.1.20030421
+ FastaToSeqEntryForDb@Base 6.1.20030421
+ FastaToSeqEntryInternal@Base 6.1.20030421
+ FastaToSeqEntryInternalEx@Base 6.1.20030421
+ FeatDefAsnLoad@Base 6.1.20030421
+ FeatDefAsnRead@Base 6.1.20030421
+ FeatDefAsnWrite@Base 6.1.20030421
+ FeatDefFindNext@Base 6.1.20030421
+ FeatDefFree@Base 6.1.20030421
+ FeatDefLabel@Base 6.1.20030421
+ FeatDefNew@Base 6.1.20030421
+ FeatDefNum@Base 6.1.20030421
+ FeatDefSetAsnRead@Base 6.1.20030421
+ FeatDefSetAsnWrite@Base 6.1.20030421
+ FeatDefSetFree@Base 6.1.20030421
+ FeatDefSetLoad@Base 6.1.20030421
+ FeatDefTypeLabel@Base 6.1.20030421
+ FeatDispGroupAsnRead@Base 6.1.20030421
+ FeatDispGroupAsnWrite@Base 6.1.20030421
+ FeatDispGroupFree@Base 6.1.20030421
+ FeatDispGroupNew@Base 6.1.20030421
+ FeatDispGroupSetAsnRead@Base 6.1.20030421
+ FeatDispGroupSetAsnWrite@Base 6.1.20030421
+ FeatDispGroupSetFree@Base 6.1.20030421
+ FeatListToProp@Base 6.1.20030421
+ FeatQualChoiceAsnRead@Base 6.1.20080302
+ FeatQualChoiceAsnWrite@Base 6.1.20080302
+ FeatQualChoiceFree@Base 6.1.20080302
+ FeatQualLegalSetAsnRead@Base 6.1.20080302
+ FeatQualLegalSetAsnWrite@Base 6.1.20080302
+ FeatQualLegalSetFree@Base 6.1.20080302
+ FeatQualLegalValAsnRead@Base 6.1.20080302
+ FeatQualLegalValAsnWrite@Base 6.1.20080302
+ FeatQualLegalValChoiceAsnRead@Base 6.1.20080302
+ FeatQualLegalValChoiceAsnWrite@Base 6.1.20080302
+ FeatQualLegalValChoiceFree@Base 6.1.20080302
+ FeatQualLegalValFree@Base 6.1.20080302
+ FeatQualLegalValNew@Base 6.1.20080302
+ FeatureBuild@Base 6.1.20030421
+ FeatureFieldAsnRead@Base 6.1.20080302
+ FeatureFieldAsnWrite@Base 6.1.20080302
+ FeatureFieldCopy@Base 6.1.20090301
+ FeatureFieldFree@Base 6.1.20080302
+ FeatureFieldFromCDSGeneProtField@Base 6.1.20080302
+ FeatureFieldFromRnaQual@Base 6.1.20081116
+ FeatureFieldLabel@Base 6.1.20080302
+ FeatureFieldLegalAsnRead@Base 6.1.20080302
+ FeatureFieldLegalAsnWrite@Base 6.1.20080302
+ FeatureFieldLegalFree@Base 6.1.20080302
+ FeatureFieldLegalNew@Base 6.1.20080302
+ FeatureFieldNew@Base 6.1.20080302
+ FeatureFieldPairAsnRead@Base 6.1.20080302
+ FeatureFieldPairAsnWrite@Base 6.1.20080302
+ FeatureFieldPairFree@Base 6.1.20080302
+ FeatureFieldPairNew@Base 6.1.20080302
+ FeatureOkForFeatureList@Base 6.1.20080302
+ FeatureTypeFromFieldType@Base 6.1.20081116
+ FetchFromGiSeqIdCache@Base 6.1.20050429
+ FetchFromSeqIdGiCache@Base 6.1.20030421
+ FetchSequenceByLoc@Base 6.1.20030421
+ FieldConstraintAsnRead@Base 6.1.20081116
+ FieldConstraintAsnWrite@Base 6.1.20081116
+ FieldConstraintFree@Base 6.1.20081116
+ FieldConstraintNew@Base 6.1.20081116
+ FieldDiffFree@Base 6.1.20160908
+ FieldDiffListFree@Base 6.1.20160908
+ FieldDiffNew@Base 6.1.20160908
+ FieldEditAsnRead@Base 6.1.20080302
+ FieldEditAsnWrite@Base 6.1.20080302
+ FieldEditFree@Base 6.1.20080302
+ FieldEditNew@Base 6.1.20080302
+ FieldPairTypeAsnRead@Base 6.1.20080302
+ FieldPairTypeAsnWrite@Base 6.1.20080302
+ FieldPairTypeFree@Base 6.1.20080302
+ FieldRuleAsnRead@Base 6.1.20090719
+ FieldRuleAsnWrite@Base 6.1.20090719
+ FieldRuleFree@Base 6.1.20090719
+ FieldRuleNew@Base 6.1.20090719
+ FieldSetAsnRead@Base 6.1.20090719
+ FieldSetAsnWrite@Base 6.1.20090719
+ FieldSetFree@Base 6.1.20090719
+ FieldTypeAsnRead@Base 6.1.20080302
+ FieldTypeAsnWrite@Base 6.1.20080302
+ FieldTypeChoiceFromFieldPairTypeChoice@Base 6.1.20081116
+ FieldTypeCopy@Base 6.1.20090301
+ FieldTypeFree@Base 6.1.20080302
+ FieldTypeFromAECRAction@Base 6.1.20080302
+ FieldTypeFromString@Base 6.1.20081116
+ FieldTypeListCopy@Base 6.1.20081116
+ FieldTypeListFree@Base 6.1.20081116
+ FileBioseqFetchDisable@Base 6.1.20030421
+ FileBioseqFetchEnable@Base 6.1.20030421
+ FillInUnaligned@Base 6.1.20030421
+ FilterDenseSegAlign@Base 6.1.20030421
+ FilterSeqAlign@Base 6.1.20030421
+ FilterTheDefline@Base 6.1.20030421
+ FindAdjacentDuplicateLocusTagGenes@Base 6.1.20080302
+ FindAlignSeqAnnotsForBioseq@Base 6.1.20050429
+ FindAlignmentsForBioseq@Base 6.1.20041020
+ FindBacterialNonExtendablePartials@Base 6.1.20090719
+ FindBadLatLon@Base 6.1.20110713
+ FindBadLatLonObjects@Base 6.1.20110713
+ FindBadLocusTagsInList@Base 6.1.20080302
+ FindBestModifiers@Base 6.1.20080302
+ FindBestModifiersEx@Base 6.1.20081116
+ FindBestModifiersForDeflineClauseList@Base 6.1.20081116
+ FindBestProtein@Base 6.1.20090301
+ FindBioseqInList@Base 6.1.20120620
+ FindBioseqSetByClass@Base 6.1.20030421
+ FindCDSGeneProductConflicts@Base 6.1.20070822
+ FindCDSOverlappingtRNAs@Base 6.1.20070822
+ FindCDSmRNAGeneLocationDiscrepancies@Base 6.1.20070822
+ FindCit@Base 6.1.20030421
+ FindCodingRegion@Base 6.1.20030421
+ FindCommentDescriptors@Base 6.1.20100808
+ FindContigDB@Base 6.1.20030421
+ FindContigList@Base 6.1.20030421
+ FindDiffsBetweenRuleSets@Base 6.1.20110713
+ FindDuplicateGeneLocus@Base 6.1.20070822
+ FindExactStringListMatch@Base 6.1.20100808
+ FindExtendablePartials@Base 6.1.20100808
+ FindFeatDefType@Base 6.1.20030421
+ FindFeatDefTypeFromKey@Base 6.1.20030421
+ FindFeatFromFeatDefType@Base 6.1.20030421
+ FindFeaturesOverlappingSrcFeatures@Base 6.1.20080302
+ FindFlankingGenes@Base 6.1.20160908
+ FindFrameShiftsInAlignment@Base 6.1.20120620
+ FindGlobalFrequentlyAppearingProteinNames@Base 6.1.20160908
+ FindHighestFeatureID@Base 6.1.20060507
+ FindIDForEntry@Base 6.1.20030421
+ FindInconsistentSourceAndDefline@Base 6.1.20070822
+ FindKeyFromFeatDefType@Base 6.1.20030421
+ FindMismatchedComments@Base 6.1.20100808
+ FindMissingProteinIDs@Base 6.1.20070822
+ FindModelEvidenceField@Base 6.1.20030421
+ FindNcbiAutofixUserObject@Base 6.1.20110713
+ FindNcbiCleanupUserObject@Base 6.1.20100808
+ FindNonmatchingContigSources@Base 6.1.20070822
+ FindNthBioseq@Base 6.1.20030421
+ FindNthGeneOnBspByLabelOrLocusTag@Base 6.1.20070822
+ FindNthSeqEntry@Base 6.1.20030421
+ FindNthSequinEntry@Base 6.1.20030421
+ FindNuc@Base 6.1.20030421
+ FindNucBioseq@Base 6.1.20030421
+ FindNucSeqEntry@Base 6.1.20030421
+ FindNucleotideLocationForProteinFeatureConversion@Base 6.1.20081116
+ FindOrderedLocations@Base 6.1.20100808
+ FindParticalCDSsInCompleteSequences@Base 6.1.20070822
+ FindProt@Base 6.1.20030421
+ FindProteinIDCallback@Base 6.1.20080302
+ FindPseudoDiscrepancies@Base 6.1.20070822
+ FindRNAsWithoutProducts@Base 6.1.20070822
+ FindReplaceInEntity@Base 6.1.20030421
+ FindReplaceString@Base 6.1.20031028
+ FindResidueByName@Base 6.1.20041020
+ FindSE@Base 6.1.20030421
+ FindSeqAlignInSeqEntry@Base 6.1.20030421
+ FindSeqAnnotCleanupUserObj@Base 6.1.20100808
+ FindSeqIdinSeqAlign@Base 6.1.20030421
+ FindSeqSubmitForSeqEntry@Base 6.1.20090719
+ FindShortContigs@Base 6.1.20070822
+ FindShortIntrons@Base 6.1.20090719
+ FindShortIntronsEx@Base 6.1.20160908
+ FindShortSequences@Base 6.1.20070822
+ FindSpliceSites@Base 6.1.20030421
+ FindStringConstraintInConstraintSetForField@Base 6.1.20080302
+ FindStringConstraintInConstraintSetForFieldPair@Base 6.1.20080302
+ FindStringsInEntity@Base 6.1.20060301
+ FindSuspectPhrases@Base 6.1.20070822
+ FindSuspectProductNames@Base 6.1.20070822
+ FindSuspectProductNamesInEntrezGene@Base 6.1.20110713
+ FindSuspectProductNamesInNameList@Base 6.1.20100808
+ FindTitlesOnSets@Base 6.1.20100808
+ FindTranslExceptNotes@Base 6.1.20070822
+ FindTrnaAA3@Base 6.1.20030421
+ FindTrnaAA@Base 6.1.20030421
+ FindTrnaAAIndex@Base 6.1.20030421
+ FindUnknownProteinsWithECNumbers@Base 6.1.20070822
+ FindUnverifiedUserObject@Base 6.1.20110713
+ FindUopByTag@Base 6.1.20060507
+ FindtRNAsOnSameStrand@Base 6.1.20070822
+ FiniWWW@Base 6.1.20040204
+ FinishHalfXrefs@Base 6.1.20110713
+ FirstNameToInitials@Base 6.1.20041020
+ FirstResidueInCode@Base 6.1.20030421
+ FixAbbreviationsInElement@Base 6.1.20080302
+ FixAffiliationShortWordsInElement@Base 6.1.20090719
+ FixAuthorCapsAsnRead@Base 6.1.20120620
+ FixAuthorCapsAsnWrite@Base 6.1.20120620
+ FixAuthorCapsFree@Base 6.1.20120620
+ FixAuthorCapsNew@Base 6.1.20120620
+ FixBacterialNonExtendablePartials@Base 6.1.20090719
+ FixCapitalizationInAuthor@Base 6.1.20100808
+ FixCapitalizationInCountryString@Base 6.1.20110713
+ FixCapitalizationInCountryStringEx@Base 6.1.20110713
+ FixCapitalizationInElement@Base 6.1.20080302
+ FixCapitalizationInString@Base 6.1.20100808
+ FixCapitalizationInTitle@Base 6.1.20100808
+ FixCapsActionAsnRead@Base 6.1.20110713
+ FixCapsActionAsnWrite@Base 6.1.20110713
+ FixCapsActionFree@Base 6.1.20110713
+ FixCapsInPubAffil@Base 6.1.20100808
+ FixCapsInPubAffilEx@Base 6.1.20110713
+ FixDuplicateColumns@Base 6.1.20120620
+ FixExtendablePartials@Base 6.1.20100808
+ FixFormatActionAsnRead@Base 6.1.20110713
+ FixFormatActionAsnWrite@Base 6.1.20110713
+ FixFormatActionFree@Base 6.1.20110713
+ FixHumanHosts@Base 6.1.20100808
+ FixKnownAbbreviationsInElement@Base 6.1.20110713
+ FixLatLonFormat@Base 6.1.20070822
+ FixMismatchedComments@Base 6.1.20100808
+ FixNonWGSSets@Base 6.1.20100808
+ FixOrderedLocations@Base 6.1.20100808
+ FixOrgModVoucher@Base 6.1.20160908
+ FixOrgNamesInString@Base 6.1.20080302
+ FixProductNameProblems@Base 6.1.20120620
+ FixProductWordCapitalization@Base 6.1.20110713
+ FixPubCapsActionAsnRead@Base 6.1.20100808
+ FixPubCapsActionAsnWrite@Base 6.1.20100808
+ FixPubCapsActionFree@Base 6.1.20100808
+ FixPubCapsActionNew@Base 6.1.20100808
+ FixSetsActionAsnRead@Base 6.1.20120620
+ FixSetsActionAsnWrite@Base 6.1.20120620
+ FixSetsActionFree@Base 6.1.20120620
+ FixSrcQualCaps@Base 6.1.20110713
+ FixStateAbbreviationsInAffil@Base 6.1.20110713
+ FixSuspectProductNamesInEntrezGene@Base 6.1.20120620
+ FixSuspectProductNamesInNameList@Base 6.1.20120620
+ FixUsaAndStateAbbreviations@Base 6.1.20100808
+ FixWrongFuzzOnMinusStrand@Base 6.1.20170106
+ FixWrongFuzzOnPlusStrand@Base 6.1.20170106
+ FixiPCRPrimerSeqsCallback@Base 6.1.20110713
+ FixupCountryQuals@Base 6.1.20110713
+ FixupCountryQualsWithLog@Base 6.1.20110713
+ FixupMouseStrains@Base 6.1.20110713
+ FlatAlignNode@Base 6.1.20030421
+ FlatAnnotPartial@Base 6.1.20030421
+ FlatAuthor@Base 6.1.20030421
+ FlatCleanEquals@Base 6.1.20030421
+ FlatDateFromCreate@Base 6.1.20030421
+ FlatIgnoreThisPatentPub@Base 6.1.20030421
+ FlatJournal@Base 6.1.20030421
+ FlatLoc@Base 6.1.20030421
+ FlatLocCaret@Base 6.1.20030421
+ FlatLocElement@Base 6.1.20030421
+ FlatLocHalf@Base 6.1.20030421
+ FlatLocHalfCaret@Base 6.1.20030421
+ FlatLocPoint@Base 6.1.20030421
+ FlatNullAhead@Base 6.1.20030421
+ FlatOrganelle@Base 6.1.20030421
+ FlatPackedPoint@Base 6.1.20030421
+ FlatPubTitle@Base 6.1.20030421
+ FlatRefBest@Base 6.1.20030421
+ FlatSmartStringMove@Base 6.1.20030421
+ FlatSpliceOff@Base 6.1.20030421
+ FlatSpliceOn@Base 6.1.20030421
+ FlatStringGroupTerm@Base 6.1.20030421
+ FlatVirtLoc@Base 6.1.20030421
+ FlipAlignment@Base 6.1.20120620
+ FlipCodonRecognizedInSeqEntry@Base 6.1.20110713
+ FlipEntireAlignmentIfAllSequencesFlipped@Base 6.1.20120620
+ FlipTabTableAxes@Base 6.1.20090719
+ FlushBuffer@Base 6.1.20030421
+ FocusSeqEntry@Base 6.1.20030421
+ ForceStripSerialNumber@Base 6.1.20110713
+ FormatBasecountBlock@Base 6.1.20040204
+ FormatCommentBlock@Base 6.1.20040204
+ FormatContigBlock@Base 6.1.20040204
+ FormatFeatHeaderBlock@Base 6.1.20040616
+ FormatFeatureBlock@Base 6.1.20040204
+ FormatFeatureQuals@Base 6.1.20040204
+ FormatFtableSourceFeatBlock@Base 6.1.20040616
+ FormatOrganismBlock@Base 6.1.20040204
+ FormatReferenceBlock@Base 6.1.20040204
+ FormatRpsDbParametersAsnRead@Base 6.1.20070822
+ FormatRpsDbParametersAsnWrite@Base 6.1.20070822
+ FormatRpsDbParametersFree@Base 6.1.20070822
+ FormatRpsDbParametersNew@Base 6.1.20070822
+ FormatScoreFromSeqAlign@Base 6.1.20030421
+ FormatScoreFromSeqAlignEx@Base 6.1.20030421
+ FormatScoreFunc@Base 6.1.20030421
+ FormatSequenceBlock@Base 6.1.20040204
+ FormatSlashBlock@Base 6.1.20040204
+ FormatSourceBlock@Base 6.1.20040204
+ FormatSourceFeatBlock@Base 6.1.20040204
+ FrameShiftReportListFree@Base 6.1.20120620
+ FreeAModelstruc@Base 6.1.20030421
+ FreeAlignData@Base 6.1.20030421
+ FreeAlignNode@Base 6.1.20030421
+ FreeAllFuzz@Base 6.1.20030421
+ FreeBufferedReadList@Base 6.1.20040505
+ FreeClickableList@Base 6.1.20070822
+ FreeContextList@Base 6.1.20080302
+ FreeDeflineFeatureRequestList@Base 6.1.20100808
+ FreeEquivAlign@Base 6.1.20030421
+ FreeFeatureList@Base 6.1.20030421
+ FreeGlobalDiscrepancyList@Base 6.1.20080302
+ FreeLclTree@Base 6.1.20120620
+ FreeListDNMS@Base 6.1.20030421
+ FreeListOfObjectLists@Base 6.1.20110713
+ FreeLog@Base 6.1.20090719
+ FreeMedline@Base 6.1.20030421
+ FreeMuskSep@Base 6.1.20030421
+ FreeObjectList@Base 6.1.20081116
+ FreeObjectTableForTabTable@Base 6.1.20080302
+ FreePCRSet@Base 6.1.20070822
+ FreePubStruct@Base 6.1.20030421
+ FreeScanSeqEntryMT@Base 6.1.20090719
+ FreeSeqIdGiCache@Base 6.1.20041020
+ FreeSeqLocSetComponents@Base 6.1.20070822
+ FreeSequenceLists@Base 6.1.20081116
+ FreeTabTable@Base 6.1.20080302
+ FreeTextAlignList@Base 6.1.20030421
+ GBAltSeqDataAsnRead@Base 6.1.20100808
+ GBAltSeqDataAsnWrite@Base 6.1.20100808
+ GBAltSeqDataFree@Base 6.1.20100808
+ GBAltSeqDataNew@Base 6.1.20100808
+ GBAltSeqItemAsnRead@Base 6.1.20100808
+ GBAltSeqItemAsnWrite@Base 6.1.20100808
+ GBAltSeqItemFree@Base 6.1.20100808
+ GBAltSeqItemNew@Base 6.1.20100808
+ GBBlockAsnRead@Base 6.1.20030421
+ GBBlockAsnWrite@Base 6.1.20030421
+ GBBlockFree@Base 6.1.20030421
+ GBBlockIsCompletelyEmpty@Base 6.1.20100808
+ GBBlockNew@Base 6.1.20030421
+ GBCommentAsnRead@Base 6.1.20100808
+ GBCommentAsnWrite@Base 6.1.20100808
+ GBCommentFree@Base 6.1.20100808
+ GBCommentNew@Base 6.1.20100808
+ GBDescrComFeat@Base 6.1.20030421
+ GBFeatErrSpec@Base 6.1.20030421
+ GBFeatKeyNameValid@Base 6.1.20030421
+ GBFeatKeyQualValid@Base 6.1.20030421
+ GBFeatureAsnRead@Base 6.1.20030421
+ GBFeatureAsnWrite@Base 6.1.20030421
+ GBFeatureFree@Base 6.1.20030421
+ GBFeatureNew@Base 6.1.20030421
+ GBFeatureSetAsnRead@Base 6.1.20100808
+ GBFeatureSetAsnWrite@Base 6.1.20100808
+ GBFeatureSetFree@Base 6.1.20100808
+ GBFeatureSetNew@Base 6.1.20100808
+ GBGetAuthNames@Base 6.1.20030421
+ GBIntervalAsnRead@Base 6.1.20030421
+ GBIntervalAsnWrite@Base 6.1.20030421
+ GBIntervalFree@Base 6.1.20030421
+ GBIntervalNew@Base 6.1.20030421
+ GBQualAsnRead@Base 6.1.20030421
+ GBQualAsnWrite@Base 6.1.20030421
+ GBQualFree@Base 6.1.20030421
+ GBQualNameValid@Base 6.1.20030421
+ GBQualNew@Base 6.1.20030421
+ GBQualPresent@Base 6.1.20030421
+ GBQualSemanticValid@Base 6.1.20030421
+ GBQualSplit@Base 6.1.20030421
+ GBQualValidToAdd@Base 6.1.20030421
+ GBQual_names_split_ignore@Base 6.1.20030421
+ GBQualifierAsnRead@Base 6.1.20030421
+ GBQualifierAsnWrite@Base 6.1.20030421
+ GBQualifierFree@Base 6.1.20030421
+ GBQualifierNew@Base 6.1.20030421
+ GBReferenceAsnRead@Base 6.1.20030421
+ GBReferenceAsnWrite@Base 6.1.20030421
+ GBReferenceFree@Base 6.1.20030421
+ GBReferenceNew@Base 6.1.20030421
+ GBSeqAsnRead@Base 6.1.20030421
+ GBSeqAsnWrite@Base 6.1.20030421
+ GBSeqFree@Base 6.1.20030421
+ GBSeqNew@Base 6.1.20030421
+ GBSetAsnRead@Base 6.1.20030421
+ GBSetAsnWrite@Base 6.1.20030421
+ GBSetFree@Base 6.1.20030421
+ GBStrucCommentAsnRead@Base 6.1.20100808
+ GBStrucCommentAsnWrite@Base 6.1.20100808
+ GBStrucCommentFree@Base 6.1.20100808
+ GBStrucCommentItemAsnRead@Base 6.1.20100808
+ GBStrucCommentItemAsnWrite@Base 6.1.20100808
+ GBStrucCommentItemFree@Base 6.1.20100808
+ GBStrucCommentItemNew@Base 6.1.20100808
+ GBStrucCommentNew@Base 6.1.20100808
+ GBXrefAsnRead@Base 6.1.20060301
+ GBXrefAsnWrite@Base 6.1.20060301
+ GBXrefFree@Base 6.1.20060301
+ GBXrefNew@Base 6.1.20060301
+ GB_GetSeqDescrComms@Base 6.1.20030421
+ GB_PrintPubs@Base 6.1.20030421
+ GP_GetSeqDescrComms@Base 6.1.20030421
+ GR_PrintPubs@Base 6.1.20030421
+ GapInLocation@Base 6.1.20080302
+ GapInfoFree@Base 6.1.20081116
+ GapInfoFromSequenceString@Base 6.1.20081116
+ GapInfoNew@Base 6.1.20081116
+ GapLocFromSeqFeat@Base 6.1.20160908
+ GapToSeqLoc@Base 6.1.20030421
+ GapToSeqLocEx@Base 6.1.20041020
+ GappedSeqLocsToDeltaSeqs@Base 6.1.20030421
+ GatherData@Base 6.1.20030421
+ GatherDataForProc@Base 6.1.20030421
+ GatherDescrByChoice@Base 6.1.20030421
+ GatherDescrListByChoice@Base 6.1.20030421
+ GatherEntity@Base 6.1.20030421
+ GatherItem@Base 6.1.20030421
+ GatherItemIDByData@Base 6.1.20030421
+ GatherItemWithLock@Base 6.1.20030421
+ GatherObjectsInEntity@Base 6.1.20030421
+ GatherObjectsInEntityEx@Base 6.1.20050429
+ GatherOverWrite@Base 6.1.20030421
+ GatherProcLaunch@Base 6.1.20030421
+ GatherSeqEntry@Base 6.1.20030421
+ GatherSpecificProcLaunch@Base 6.1.20030421
+ GcIndextoCodon@Base 6.1.20030421
+ GeneCommentaryAsnRead@Base 6.1.20050429
+ GeneCommentaryAsnWrite@Base 6.1.20050429
+ GeneCommentaryFree@Base 6.1.20050429
+ GeneCommentaryNew@Base 6.1.20050429
+ GeneDataFree@Base 6.1.20030421
+ GeneFastaStream@Base 6.1.20110713
+ GeneFastaStreamEx@Base 6.1.20120620
+ GeneNomenclatureAsnRead@Base 6.1.20081116
+ GeneNomenclatureAsnWrite@Base 6.1.20081116
+ GeneNomenclatureFree@Base 6.1.20081116
+ GeneNomenclatureNew@Base 6.1.20081116
+ GeneRefAsnRead@Base 6.1.20030421
+ GeneRefAsnWrite@Base 6.1.20030421
+ GeneRefDup@Base 6.1.20030421
+ GeneRefFree@Base 6.1.20030421
+ GeneRefMatch@Base 6.1.20070822
+ GeneRefNew@Base 6.1.20030421
+ GeneSourceAsnRead@Base 6.1.20050429
+ GeneSourceAsnWrite@Base 6.1.20050429
+ GeneSourceFree@Base 6.1.20050429
+ GeneSourceNew@Base 6.1.20050429
+ GeneStructFree@Base 6.1.20030421
+ GeneStructNew@Base 6.1.20030421
+ GeneTrackAsnRead@Base 6.1.20050429
+ GeneTrackAsnWrite@Base 6.1.20050429
+ GeneTrackFree@Base 6.1.20050429
+ GeneTrackNew@Base 6.1.20050429
+ GeneXrefTypeAsnRead@Base 6.1.20110713
+ GeneXrefTypeAsnWrite@Base 6.1.20110713
+ GeneXrefTypeFree@Base 6.1.20110713
+ GeneXrefTypeNew@Base 6.1.20110713
+ GeneralAsnLoad@Base 6.1.20030421
+ GenericCompressDNA@Base 6.1.20030421
+ GenericCompressDNAEx@Base 6.1.20030421
+ GenericSeqAlignSetAsnWrite@Base 6.1.20030421
+ GeneticCodeAsnRead@Base 6.1.20030421
+ GeneticCodeAsnWrite@Base 6.1.20030421
+ GeneticCodeFind@Base 6.1.20030421
+ GeneticCodeFree@Base 6.1.20030421
+ GeneticCodeNew@Base 6.1.20030421
+ GeneticCodeTableAsnRead@Base 6.1.20030421
+ GeneticCodeTableAsnWrite@Base 6.1.20030421
+ GeneticCodeTableLoad@Base 6.1.20030421
+ GenomeFromLocName@Base 6.1.20081116
+ GenomeFromSrcLoc@Base 6.1.20080302
+ GenomePartToSegmentMap@Base 6.1.20030421
+ Get3LetterSymbol@Base 6.1.20040204
+ GetAAFeatLoc@Base 6.1.20030421
+ GetAECRExistingTextList@Base 6.1.20081116
+ GetAECRSampleFromObjectList@Base 6.1.20081116
+ GetAECRSampleFromObjectListEx@Base 6.1.20090301
+ GetAECRSampleList@Base 6.1.20081116
+ GetAECRSampleListForSeqEntry@Base 6.1.20081116
+ GetAaFromtRNA@Base 6.1.20110713
+ GetAccVerForBioseq@Base 6.1.20170106
+ GetAccessionFromSeqId@Base 6.1.20030421
+ GetAccessionVersionFromSeqId@Base 6.1.20041020
+ GetAccnVerFromServer@Base 6.1.20040204
+ GetAffiliation@Base 6.1.20030421
+ GetAlignCoordFromSeqLoc@Base 6.1.20030421
+ GetAlignLengthFromAlignNode@Base 6.1.20030421
+ GetAlignmentColumnPercentIdentities@Base 6.1.20070822
+ GetAllStructuredCommentKeywords@Base 6.1.20160908
+ GetAnnotTitle@Base 6.1.20030421
+ GetAuthListForPub@Base 6.1.20090719
+ GetAuthListPtr@Base 6.1.20040204
+ GetAuthorListForPub@Base 6.1.20110713
+ GetAuthorListString@Base 6.1.20160908
+ GetAuthors@Base 6.1.20030421
+ GetAuthorsString@Base 6.1.20040204
+ GetBankitCommentsInSep@Base 6.1.20081116
+ GetBankitCommentsOnSep@Base 6.1.20081116
+ GetBarcodeDiscrepancies@Base 6.1.20070822
+ GetBarcodePassFail@Base 6.1.20070822
+ GetBarcodeTestFailureReasons@Base 6.1.20081116
+ GetBarcodeTestName@Base 6.1.20070822
+ GetBarcodeTestNumFromBarcodeTestName@Base 6.1.20070822
+ GetBestProteinFeatureUnindexed@Base 6.1.20030421
+ GetBestSeqEntryForItem@Base 6.1.20100808
+ GetBestTopParentForData@Base 6.1.20030421
+ GetBestTopParentForDataEx@Base 6.1.20030421
+ GetBestTopParentForItemID@Base 6.1.20030421
+ GetBestTopParentForItemIDEx@Base 6.1.20030421
+ GetBioProjectID@Base 6.1.20120620
+ GetBioProjectIdFromBioseq@Base 6.1.20120620
+ GetBioSourceFieldDiffs@Base 6.1.20160908
+ GetBioSourceFromObject@Base 6.1.20080302
+ GetBiomolForRnaType@Base 6.1.20080302
+ GetBiomolNameForRnaType@Base 6.1.20080302
+ GetBiopForBsp@Base 6.1.20080302
+ GetBioseqGivenIDs@Base 6.1.20030421
+ GetBioseqGivenSeqLoc@Base 6.1.20030421
+ GetBioseqLabel@Base 6.1.20081116
+ GetBioseqMatchesForSequenceIDs@Base 6.1.20110713
+ GetBioseqReferencedByAnnot@Base 6.1.20120620
+ GetBioseqSetLabel@Base 6.1.20070822
+ GetBlockInfo@Base 6.1.20030421
+ GetBlockOrientation@Base 6.1.20030421
+ GetBondTypeList@Base 6.1.20081116
+ GetCDSformRNA@Base 6.1.20110713
+ GetCitListsForSeqEntry@Base 6.1.20090301
+ GetCitationNumberForMinPub@Base 6.1.20090301
+ GetCodesFortRNA@Base 6.1.20110713
+ GetCommentRuleFromRuleSet@Base 6.1.20090719
+ GetCommonOrgRefForSeqEntry@Base 6.1.20100808
+ GetCompletednessTypeList@Base 6.1.20080302
+ GetConsensusReadAln@Base 6.1.20090301
+ GetCorrectedCountryCapitalization@Base 6.1.20090301
+ GetCountryFix@Base 6.1.20070822
+ GetDBLinkFieldTypeFromDBLinkName@Base 6.1.20110713
+ GetDBLinkNameFromDBLinkFieldType@Base 6.1.20110713
+ GetDBXrefFromGene@Base 6.1.20030421
+ GetDBxrefFromBioSource@Base 6.1.20100808
+ GetDNAbyAccessionDotVersion@Base 6.1.20030421
+ GetDaysInMonth@Base 6.1.20081116
+ GetDbtagString@Base 6.1.20120620
+ GetDefinitionLine@Base 6.1.20030421
+ GetDefinitionLineFASTAModifiers@Base 6.1.20120620
+ GetDefinitionLineFASTAModifiersByList@Base 6.1.20160908
+ GetDeflinePosForFieldName@Base 6.1.20160908
+ GetDeflinePosForFieldType@Base 6.1.20090301
+ GetDeltaSeqForPosition@Base 6.1.20160908
+ GetDeltaSeqLen@Base 6.1.20080302
+ GetDescrOnSeqEntry@Base 6.1.20030421
+ GetDescriptorNameFromDescriptorType@Base 6.1.20090301
+ GetDiscrepancyItemText@Base 6.1.20070822
+ GetDiscrepancyItemTextEx@Base 6.1.20081116
+ GetDiscrepancyTestConfName@Base 6.1.20070822
+ GetDiscrepancyTestSettingName@Base 6.1.20070822
+ GetDiscrepancyTypeFromSettingName@Base 6.1.20070822
+ GetDuplicateFeaturesForRemoval@Base 6.1.20110713
+ GetEMBLDate@Base 6.1.20030421
+ GetEntityIdFromObject@Base 6.1.20090719
+ GetEntryVersion@Base 6.1.20030421
+ GetEquivAlignType@Base 6.1.20030421
+ GetExistingTextForParseAction@Base 6.1.20090301
+ GetFeatQualByName@Base 6.1.20080302
+ GetFeatQualName@Base 6.1.20080302
+ GetFeatdefFromFeatureType@Base 6.1.20080302
+ GetFeatureNameFromFeatureType@Base 6.1.20080302
+ GetFeatureTypeByName@Base 6.1.20080302
+ GetFeatureTypeForRnaType@Base 6.1.20081116
+ GetFeatureTypeFromFeatdef@Base 6.1.20081116
+ GetFeaturesForSuspectRules@Base 6.1.20110713
+ GetFieldListForFieldType@Base 6.1.20081116
+ GetFieldSampleFromList@Base 6.1.20081116
+ GetFieldTypeListFromAECRAction@Base 6.1.20090301
+ GetFieldValueForObject@Base 6.1.20081116
+ GetFieldValueForObjectEx@Base 6.1.20090301
+ GetFirstGBQualMatch@Base 6.1.20120620
+ GetFlatFileAffilString@Base 6.1.20090301
+ GetFormerCountryList@Base 6.1.20120620
+ GetFrameFromLoc@Base 6.1.20030421
+ GetFromFieldFromFieldPair@Base 6.1.20080302
+ GetGBDate@Base 6.1.20030421
+ GetGBFeatKeyForFeature@Base 6.1.20110713
+ GetGBSourceLine@Base 6.1.20030421
+ GetGIForSeqId@Base 6.1.20030421
+ GetGINumFromSip@Base 6.1.20030421
+ GetGINumber@Base 6.1.20030421
+ GetGIs@Base 6.1.20030421
+ GetGPDate@Base 6.1.20030421
+ GetGapCode@Base 6.1.20030421
+ GetGenCodeForBsp@Base 6.1.20120620
+ GetGenDate@Base 6.1.20030421
+ GetGeneByFeat@Base 6.1.20120620
+ GetGeneByXref@Base 6.1.20120620
+ GetGeneForFeature@Base 6.1.20080302
+ GetGeneInfoForFeature@Base 6.1.20110713
+ GetGeneQuals@Base 6.1.20030421
+ GetGeneticCodeFromSeqId@Base 6.1.20030421
+ GetGenomeProjectID@Base 6.1.20090719
+ GetGenomeProjectIDDescriptor@Base 6.1.20081116
+ GetGibbsqComment@Base 6.1.20030421
+ GetGibbsqCommentLength@Base 6.1.20030421
+ GetGibbsqNumber@Base 6.1.20030421
+ GetGibbsqStatement@Base 6.1.20030421
+ GetGlobalDiscrepancyItem@Base 6.1.20080302
+ GetGlobalDiscrepancyStr@Base 6.1.20080302
+ GetImportFeatureName@Base 6.1.20081116
+ GetIndexForResidue@Base 6.1.20030421
+ GetItemIDGivenPointer@Base 6.1.20030421
+ GetKeywordLine@Base 6.1.20030421
+ GetKeywordPrefix@Base 6.1.20100808
+ GetLODScoreBitValue@Base 6.1.20030421
+ GetLODScoreNumber@Base 6.1.20030421
+ GetLeftAndRightOffsetsInBioseq@Base 6.1.20090301
+ GetLocationList@Base 6.1.20080302
+ GetLocusPartsAwp@Base 6.1.20030421
+ GetLocusTagPrefixList@Base 6.1.20100808
+ GetLongSymbolForAA@Base 6.1.20120620
+ GetLongSymbolForResidue@Base 6.1.20030421
+ GetMacroBondTypeName@Base 6.1.20081116
+ GetMacroSiteTypeName@Base 6.1.20081116
+ GetMapFeats@Base 6.1.20030421
+ GetMinPubForCitationNumber@Base 6.1.20090301
+ GetModifierIndicesFromModList@Base 6.1.20080302
+ GetMolInfo@Base 6.1.20030421
+ GetMolTypeQual@Base 6.1.20040204
+ GetMoleculeClassTypeList@Base 6.1.20080302
+ GetMoleculeTypeList@Base 6.1.20080302
+ GetMonthAbbrev@Base 6.1.20081116
+ GetMonthFromToken@Base 6.1.20081116
+ GetMonthNumFromAbbrev@Base 6.1.20081116
+ GetMultipleFieldValuesForObject@Base 6.1.20100808
+ GetMultipleSourceQualsFromBioSource@Base 6.1.20100808
+ GetNAFeatKey@Base 6.1.20030421
+ GetNameForResidue@Base 6.1.20030421
+ GetNameForRnaField@Base 6.1.20081116
+ GetNextDescriptorUnindexed@Base 6.1.20030421
+ GetNthValNode@Base 6.1.20120620
+ GetNumDBLinkFields@Base 6.1.20110713
+ GetNumFeatQual@Base 6.1.20080302
+ GetNumOfSeqBlks@Base 6.1.20030421
+ GetNumberObjMgrSelect@Base 6.1.20030421
+ GetObjectIdString@Base 6.1.20100808
+ GetObjectListForAECRAction@Base 6.1.20080302
+ GetObjectListForAECRActionEx@Base 6.1.20090301
+ GetObjectListForFieldType@Base 6.1.20081116
+ GetObjectTableForTabTable@Base 6.1.20080302
+ GetOffsetInBioseq@Base 6.1.20030421
+ GetOffsetInBioseqEx@Base 6.1.20090301
+ GetOffsetInLoc@Base 6.1.20030421
+ GetOrderBySeqId@Base 6.1.20030421
+ GetOrgModQualFromSrcQual@Base 6.1.20100808
+ GetOrgModQualName@Base 6.1.20070822
+ GetOrgModSearch@Base 6.1.20100808
+ GetOrganismTaxLookupFailuresInSeqEntry@Base 6.1.20070822
+ GetOriginList@Base 6.1.20080302
+ GetPDBSourceLine@Base 6.1.20030421
+ GetPRGDDictionary@Base 6.1.20030421
+ GetParentLabelForDiscrepancyItem@Base 6.1.20080302
+ GetPointerForIDs@Base 6.1.20030421
+ GetPointsForLeftAndRightOffsets@Base 6.1.20090301
+ GetProductFromCDS@Base 6.1.20030421
+ GetProductSeqId@Base 6.1.20030421
+ GetProtFeature@Base 6.1.20090809
+ GetProtRefForFeature@Base 6.1.20110713
+ GetProtRefInfo@Base 6.1.20030421
+ GetProteinLocationForNucleotideFeatureConversion@Base 6.1.20081116
+ GetPubClassList@Base 6.1.20160908
+ GetPubFieldFromLabel@Base 6.1.20160908
+ GetPubFieldFromPub@Base 6.1.20090301
+ GetPubFieldLabel@Base 6.1.20081116
+ GetPubFieldList@Base 6.1.20081116
+ GetPubMLStatus@Base 6.1.20090301
+ GetPubMedForUid@Base 6.1.20031028
+ GetPubclassFromPub@Base 6.1.20160908
+ GetPublicationTitlesInSep@Base 6.1.20081116
+ GetPublicationTitlesOnSep@Base 6.1.20081116
+ GetPubsAwp@Base 6.1.20030421
+ GetQualFromFeature@Base 6.1.20080302
+ GetQualFromFeatureEx@Base 6.1.20090301
+ GetRNAProductString@Base 6.1.20090301
+ GetRNAQualFromFeature@Base 6.1.20110713
+ GetRNARefProductString@Base 6.1.20100808
+ GetRNATypeList@Base 6.1.20081116
+ GetRemovableItemName@Base 6.1.20080302
+ GetRepliconChromosomeName@Base 6.1.20120620
+ GetRepliconLocation@Base 6.1.20120620
+ GetRepliconType@Base 6.1.20120620
+ GetRepresentativeBioseqFromBioseqSet@Base 6.1.20081116
+ GetResidueForLongSymbol@Base 6.1.20030421
+ GetResidueForSymbol@Base 6.1.20030421
+ GetRidOfLocusInSeqIds@Base 6.1.20030421
+ GetRnaFieldList@Base 6.1.20081116
+ GetSUCCommonList@Base 6.1.20160908
+ GetScoreAndEvalue@Base 6.1.20030421
+ GetScoresbyAccessionDotVersion@Base 6.1.20030421
+ GetScoresbySeqId@Base 6.1.20030421
+ GetSeqEntryParent@Base 6.1.20030421
+ GetSeqFeat@Base 6.1.20030421
+ GetSeqFeatCallback@Base 6.1.20030421
+ GetSeqIdForGI@Base 6.1.20030421
+ GetSeqIdList@Base 6.1.20030421
+ GetSeqIdSetForGI@Base 6.1.20030421
+ GetSeqLocPartialSet@Base 6.1.20100808
+ GetSequenceByBsp@Base 6.1.20030421
+ GetSequenceByBspEx@Base 6.1.20160908
+ GetSequenceByFeature@Base 6.1.20030421
+ GetSequenceByFeatureEx@Base 6.1.20160908
+ GetSequenceByIdOrAccnDotVer@Base 6.1.20030421
+ GetSequenceByIdOrAccnDotVerEx@Base 6.1.20160908
+ GetSequenceByLocation@Base 6.1.20120620
+ GetSequenceByLocationEx@Base 6.1.20160908
+ GetSequenceForObject@Base 6.1.20081116
+ GetSequenceListForConstraint@Base 6.1.20110713
+ GetSequenceListsForMatchTypeInTabTable@Base 6.1.20081116
+ GetSetClassName@Base 6.1.20100808
+ GetSiteTypeList@Base 6.1.20081116
+ GetSortOrderName@Base 6.1.20110713
+ GetSourceQualDescList@Base 6.1.20080302
+ GetSourceQualDescListEx@Base 6.1.20110713
+ GetSourceQualFieldListFromBioSource@Base 6.1.20081116
+ GetSourceQualFromBioSource@Base 6.1.20080302
+ GetSourceQualList@Base 6.1.20080302
+ GetSourceQualName@Base 6.1.20080302
+ GetSourceQualSampleFieldList@Base 6.1.20081116
+ GetSourceQualSampleFieldListForSeqEntryList@Base 6.1.20081116
+ GetSourceQualTypeByName@Base 6.1.20080302
+ GetSpecialCharacterReplacement@Base 6.1.20080302
+ GetSpecialMacCharacterReplacement@Base 6.1.20080302
+ GetSpecialPlastidGenCode@Base 6.1.20100808
+ GetSpecialWinCharacterReplacement@Base 6.1.20080302
+ GetSrcQualFromSubSrcOrOrgMod@Base 6.1.20081116
+ GetStateAbbreviation@Base 6.1.20080302
+ GetStrForStructuredComment@Base 6.1.20160908
+ GetStrandTypeList@Base 6.1.20080302
+ GetStructuredCommentFieldDiffs@Base 6.1.20160908
+ GetStructuredCommentFieldFromUserObject@Base 6.1.20110713
+ GetStructuredCommentFieldList@Base 6.1.20160908
+ GetStructuredCommentFieldListFromUserObject@Base 6.1.20160908
+ GetStructuredCommentPrefix@Base 6.1.20160908
+ GetStructuredCommentPrefixList@Base 6.1.20110713
+ GetSubSrcQualFromSrcQual@Base 6.1.20160908
+ GetSubsourceQualName@Base 6.1.20070822
+ GetSuspectRuleDiscrepancies@Base 6.1.20110713
+ GetSymbolForResidue@Base 6.1.20030421
+ GetTSAIDDB@Base 6.1.20120620
+ GetTechniqueTypeList@Base 6.1.20080302
+ GetTextPortionFromString@Base 6.1.20081116
+ GetThePointForOffsetEx@Base 6.1.20090301
+ GetToFieldFromFieldPair@Base 6.1.20080302
+ GetTopSeqEntryForEntityID@Base 6.1.20030421
+ GetTopologyTypeList@Base 6.1.20080302
+ GetTransitionsFromGapInfo@Base 6.1.20081116
+ GetTxAlignOptionValue@Base 6.1.20030421
+ GetUniGeneIDForSeqId@Base 6.1.20030421
+ GetUnverifiedMatchName@Base 6.1.20120620
+ GetUseThisGi@Base 6.1.20030421
+ GetValidCategoryName@Base 6.1.20050429
+ GetValidCountryList@Base 6.1.20040616
+ GetValidErrorName@Base 6.1.20050429
+ GetValidExplanation@Base 6.1.20070822
+ GetValueFromTwoStringHash@Base 6.1.20110713
+ GetWWW@Base 6.1.20040204
+ GetYearFromToken@Base 6.1.20081116
+ GetmRNAForFeature@Base 6.1.20080302
+ GetmRNALocationFromCDSLocation@Base 6.1.20090719
+ GetmRNAforCDS@Base 6.1.20110713
+ GetncRNAClass@Base 6.1.20100808
+ GetsDocsumTitle@Base 6.1.20100808
+ GettmRNATagPeptide@Base 6.1.20100808
+ GiAccVerAsynchronousQuery@Base 6.1.20041020
+ GiAccVerCheckQueue@Base 6.1.20041020
+ GiAccVerOpenConnection@Base 6.1.20041020
+ GiAccVerReadReply@Base 6.1.20041020
+ GiAccVerSynchronousQuery@Base 6.1.20041020
+ GiAccVerWaitForReply@Base 6.1.20041020
+ GiRevHistAsynchronousQuery@Base 6.1.20030421
+ GiRevHistCheckQueue@Base 6.1.20030421
+ GiRevHistLookupFarSeqIDs@Base 6.1.20030421
+ GiRevHistLookupSeqIdSet@Base 6.1.20030421
+ GiRevHistOpenConnection@Base 6.1.20030421
+ GiRevHistPreLoadSeqIdGiCache@Base 6.1.20030421
+ GiRevHistPreLoadSeqIdGiCacheEx@Base 6.1.20070822
+ GiRevHistReadReply@Base 6.1.20030421
+ GiRevHistSynchronousQuery@Base 6.1.20030421
+ GiRevHistWaitForReply@Base 6.1.20030421
+ GiSeqIdSetAsynchronousQuery@Base 6.1.20030421
+ GiSeqIdSetCheckQueue@Base 6.1.20030421
+ GiSeqIdSetOpenConnection@Base 6.1.20030421
+ GiSeqIdSetReadReply@Base 6.1.20030421
+ GiSeqIdSetSynchronousQuery@Base 6.1.20030421
+ GiSeqIdSetWaitForReply@Base 6.1.20030421
+ GiimAsnRead@Base 6.1.20030421
+ GiimAsnWrite@Base 6.1.20030421
+ GiimFree@Base 6.1.20030421
+ GiimNew@Base 6.1.20030421
+ GlobalDiscrepReportFree@Base 6.1.20081116
+ GlobalDiscrepReportNew@Base 6.1.20081116
+ GlobalDiscrepancyFree@Base 6.1.20080302
+ GlobalDiscrepancyNew@Base 6.1.20080302
+ GuessCountryForLatLon@Base 6.1.20070822
+ H_atoms@Base 6.1.20030421
+ HasAlignmentsWithLocalIDs@Base 6.1.20120620
+ HasAllKeywordsForStructuredComment@Base 6.1.20160908
+ HasAnyKeywordForStructuredComment@Base 6.1.20160908
+ HasBARCODETech@Base 6.1.20090719
+ HasKeywordForStructuredCommentName@Base 6.1.20100808
+ HasTaxonomyID@Base 6.1.20110713
+ HasTpaUserObject@Base 6.1.20070822
+ Heartbeat@Base 6.1.20160908
+ INSDAltSeqDataAsnRead@Base 6.1.20100808
+ INSDAltSeqDataAsnWrite@Base 6.1.20100808
+ INSDAltSeqDataFree@Base 6.1.20100808
+ INSDAltSeqDataNew@Base 6.1.20100808
+ INSDAltSeqItemAsnRead@Base 6.1.20100808
+ INSDAltSeqItemAsnWrite@Base 6.1.20100808
+ INSDAltSeqItemFree@Base 6.1.20100808
+ INSDAltSeqItemNew@Base 6.1.20100808
+ INSDCommentAsnRead@Base 6.1.20100808
+ INSDCommentAsnWrite@Base 6.1.20100808
+ INSDCommentFree@Base 6.1.20100808
+ INSDCommentNew@Base 6.1.20100808
+ INSDFeatureAsnRead@Base 6.1.20040505
+ INSDFeatureAsnWrite@Base 6.1.20040505
+ INSDFeatureFree@Base 6.1.20040505
+ INSDFeatureNew@Base 6.1.20040505
+ INSDFeatureSetAsnRead@Base 6.1.20100808
+ INSDFeatureSetAsnWrite@Base 6.1.20100808
+ INSDFeatureSetFree@Base 6.1.20100808
+ INSDFeatureSetNew@Base 6.1.20100808
+ INSDIntervalAsnRead@Base 6.1.20040505
+ INSDIntervalAsnWrite@Base 6.1.20040505
+ INSDIntervalFree@Base 6.1.20040505
+ INSDIntervalNew@Base 6.1.20040505
+ INSDQualifierAsnRead@Base 6.1.20040505
+ INSDQualifierAsnWrite@Base 6.1.20040505
+ INSDQualifierFree@Base 6.1.20040505
+ INSDQualifierNew@Base 6.1.20040505
+ INSDReferenceAsnRead@Base 6.1.20040505
+ INSDReferenceAsnWrite@Base 6.1.20040505
+ INSDReferenceFree@Base 6.1.20040505
+ INSDReferenceNew@Base 6.1.20040505
+ INSDSeqAsnRead@Base 6.1.20040505
+ INSDSeqAsnWrite@Base 6.1.20040505
+ INSDSeqFree@Base 6.1.20040505
+ INSDSeqNew@Base 6.1.20040505
+ INSDSetAsnRead@Base 6.1.20040505
+ INSDSetAsnWrite@Base 6.1.20040505
+ INSDSetFree@Base 6.1.20040505
+ INSDStrucCommentAsnRead@Base 6.1.20100808
+ INSDStrucCommentAsnWrite@Base 6.1.20100808
+ INSDStrucCommentFree@Base 6.1.20100808
+ INSDStrucCommentItemAsnRead@Base 6.1.20100808
+ INSDStrucCommentItemAsnWrite@Base 6.1.20100808
+ INSDStrucCommentItemFree@Base 6.1.20100808
+ INSDStrucCommentItemNew@Base 6.1.20100808
+ INSDStrucCommentNew@Base 6.1.20100808
+ INSDXrefAsnRead@Base 6.1.20060301
+ INSDXrefAsnWrite@Base 6.1.20060301
+ INSDXrefFree@Base 6.1.20060301
+ INSDXrefNew@Base 6.1.20060301
+ ISADeltaSeqsToSeqLoc@Base 6.1.20030421
+ ISAGappedSeqLoc@Base 6.1.20030421
+ IS_BOGO_Product@Base 6.1.20030421
+ IS_NUM_GENE@Base 6.1.20030421
+ IS_ntdb_accession@Base 6.1.20030421
+ IS_one_loc@Base 6.1.20030421
+ IS_protSeqLoc@Base 6.1.20030421
+ IS_protdb_accession@Base 6.1.20030421
+ IdListsMatch@Base 6.1.20110713
+ IdPatAsnRead@Base 6.1.20030421
+ IdPatAsnWrite@Base 6.1.20030421
+ IdPatFree@Base 6.1.20030421
+ IdPatMatch@Base 6.1.20030421
+ IdPatNew@Base 6.1.20030421
+ IdentifiedByHasSpecWords@Base 6.1.20160908
+ ImpFeatAsnRead@Base 6.1.20030421
+ ImpFeatAsnWrite@Base 6.1.20030421
+ ImpFeatFree@Base 6.1.20030421
+ ImpFeatNew@Base 6.1.20030421
+ ImportNucleotideFASTASequencesFromFile@Base 6.1.20120620
+ ImportNucleotideFASTASequencesFromFileEx@Base 6.1.20160908
+ ImportProteinFASTASequences@Base 6.1.20120620
+ ImposeCDSPartials@Base 6.1.20160908
+ ImposeCodingRegionPartials@Base 6.1.20160908
+ ImposeGenePartials@Base 6.1.20160908
+ ImprintAsnRead@Base 6.1.20030421
+ ImprintAsnWrite@Base 6.1.20030421
+ ImprintFree@Base 6.1.20030421
+ ImprintMatch@Base 6.1.20030421
+ ImprintNew@Base 6.1.20030421
+ IncompatibleGapFeatQuals@Base 6.1.20160908
+ IndexBlocks@Base 6.1.20030421
+ IndexForCodon@Base 6.1.20030421
+ IndexNewBlocks@Base 6.1.20030421
+ IndexedFastaLibFetchDisable@Base 6.1.20030421
+ IndexedFastaLibFetchEnable@Base 6.1.20030421
+ InferenceSupportAsnRead@Base 6.1.20110713
+ InferenceSupportAsnWrite@Base 6.1.20110713
+ InferenceSupportFree@Base 6.1.20110713
+ InferenceSupportNew@Base 6.1.20110713
+ InitFeatureRequests@Base 6.1.20080302
+ InitOrganismDescriptionModifiers@Base 6.1.20100808
+ InitValNodeBlock@Base 6.1.20110713
+ InitWWW@Base 6.1.20040204
+ InstantiateMatPeptideProducts@Base 6.1.20081116
+ InstantiateNCTitle@Base 6.1.20100808
+ InstantiateNMTitles@Base 6.1.20100808
+ InstantiateProteinTitles@Base 6.1.20030421
+ IntFuzzAsnRead@Base 6.1.20030421
+ IntFuzzAsnWrite@Base 6.1.20030421
+ IntFuzzClip@Base 6.1.20030421
+ IntFuzzFree@Base 6.1.20030421
+ IntFuzzNew@Base 6.1.20030421
+ IntFuzzPrint@Base 6.1.20030421
+ IsBarcodeID@Base 6.1.20070822
+ IsBioseqInAnyAlignment@Base 6.1.20120620
+ IsBioseqInGPS@Base 6.1.20081116
+ IsBioseqOrganelle@Base 6.1.20160908
+ IsBioseqSetInGPS@Base 6.1.20081116
+ IsCDSGeneProtQualConstraintEmpty@Base 6.1.20080302
+ IsConversionSupported@Base 6.1.20081116
+ IsCorrectLatLonFormat@Base 6.1.20070822
+ IsCountryInLatLonList@Base 6.1.20070822
+ IsDBLinkObject@Base 6.1.20160908
+ IsDeltaSeqGap@Base 6.1.20070822
+ IsDeltaSeqKnownGap@Base 6.1.20070822
+ IsDeltaSeqUnknownGap@Base 6.1.20070822
+ IsDeltaSeqWithFarpointers@Base 6.1.20120620
+ IsEllipsis@Base 6.1.20040204
+ IsFeatInGPS@Base 6.1.20081116
+ IsFeatureFieldEmpty@Base 6.1.20080302
+ IsFieldConstraintEmpty@Base 6.1.20081116
+ IsFieldSortable@Base 6.1.20110713
+ IsFieldTypeCDSProduct@Base 6.1.20080302
+ IsFieldTypeEmpty@Base 6.1.20080302
+ IsFieldTypeNonText@Base 6.1.20100808
+ IsFixPubCapsActionEmpty@Base 6.1.20100808
+ IsGeneXrefRedundant@Base 6.1.20110713
+ IsGenomeProjectIDDescriptor@Base 6.1.20081116
+ IsIBOL@Base 6.1.20100808
+ IsIdenticalPublication@Base 6.1.20160908
+ IsLocAInBonSameStrand@Base 6.1.20080302
+ IsLocationConstraintEmpty@Base 6.1.20081116
+ IsLocationOrganelle@Base 6.1.20110713
+ IsMobileElement@Base 6.1.20080302
+ IsMolinfoFieldConstraintEmpty@Base 6.1.20110713
+ IsMrnaSequence@Base 6.1.20160908
+ IsNCBIFileID@Base 6.1.20110713
+ IsNonGappedLiteral@Base 6.1.20030421
+ IsNonTextFieldType@Base 6.1.20081116
+ IsNonTextSourceQual@Base 6.1.20080302
+ IsNuclAcc@Base 6.1.20030421
+ IsNucleotideChar@Base 6.1.20030421
+ IsNumString@Base 6.1.20030421
+ IsPopPhyEtcSet@Base 6.1.20030421
+ IsPrefixPlusNumbers@Base 6.1.20110713
+ IsProductNameOk@Base 6.1.20100808
+ IsProteinChar@Base 6.1.20030421
+ IsPseudo@Base 6.1.20090301
+ IsPublicationConstraintEmpty@Base 6.1.20081116
+ IsQualValidForFeature@Base 6.1.20110713
+ IsRegulatorySubtype@Base 6.1.20160908
+ IsRnaQualEmpty@Base 6.1.20081116
+ IsSearchFuncEmpty@Base 6.1.20110713
+ IsSeqIndexMap@Base 6.1.20030421
+ IsSequenceChar@Base 6.1.20030421
+ IsSequenceConstraintEmpty@Base 6.1.20080302
+ IsSequenceFirstInPairwise@Base 6.1.20050429
+ IsShortrRNA@Base 6.1.20160908
+ IsSkippableDbtag@Base 6.1.20070822
+ IsSourceConstraintEmpty@Base 6.1.20080302
+ IsSpName@Base 6.1.20080302
+ IsStringConstraintEmpty@Base 6.1.20080302
+ IsStringInNcRNAClassList@Base 6.1.20080302
+ IsStringInRecombinationClassList@Base 6.1.20170106
+ IsStringInRegulatoryClassList@Base 6.1.20160908
+ IsStringInSpanInList@Base 6.1.20080302
+ IsStructuredCommentPrefix@Base 6.1.20160908
+ IsStructuredCommentSuffix@Base 6.1.20160908
+ IsStructuredCommentValid@Base 6.1.20090719
+ IsStructuredCommentValidForRule@Base 6.1.20090719
+ IsSuspectRuleEmpty@Base 6.1.20110713
+ IsTSA@Base 6.1.20081116
+ IsTestTypeAppropriateForReportType@Base 6.1.20081116
+ IsTextMarkerEmpty@Base 6.1.20100808
+ IsTextTransformEmpty@Base 6.1.20110713
+ IsTranslationConstraintEmpty@Base 6.1.20110713
+ IsUnverifiedUserObject@Base 6.1.20110713
+ IsUserFieldStructuredCommentPrefixOrSuffix@Base 6.1.20160908
+ IsUserObjectStructuredComment@Base 6.1.20110713
+ IsValidId@Base 6.1.20030421
+ IsValidIdChar@Base 6.1.20030421
+ IsWholeWordSubstr@Base 6.1.20040204
+ Is_Local_Seq@Base 6.1.20030421
+ JoinShortTrnas@Base 6.1.20160908
+ KeyFromTag@Base 6.1.20030421
+ KeyTagClear@Base 6.1.20030421
+ KeyTagInit@Base 6.1.20030421
+ KeywordForStructuredCommentName@Base 6.1.20100808
+ KeywordForStructuredCommentPrefix@Base 6.1.20160908
+ KnownAbbreviationList@Base 6.1.20110713
+ LabelUserField@Base 6.1.20160908
+ LastResidueInCode@Base 6.1.20030421
+ LatLonAutocorrectList@Base 6.1.20110713
+ LeaveBestCDD@Base 6.1.20030421
+ LinkCDSmRNAbyLabel@Base 6.1.20061015
+ LinkCDSmRNAbyLabelAndLocation@Base 6.1.20110713
+ LinkCDSmRNAbyOverlap@Base 6.1.20050828
+ LinkCDSmRNAbyProduct@Base 6.1.20050828
+ LinkGeneData@Base 6.1.20030421
+ LinkSetAsnRead@Base 6.1.20030421
+ LinkSetAsnWrite@Base 6.1.20030421
+ LinkSetFree@Base 6.1.20030421
+ LinkSetNew@Base 6.1.20030421
+ LinkTwoFeatures@Base 6.1.20110713
+ LinkageEvidenceAsnRead@Base 6.1.20120620
+ LinkageEvidenceAsnWrite@Base 6.1.20120620
+ LinkageEvidenceFree@Base 6.1.20120620
+ LinkageEvidenceNew@Base 6.1.20120620
+ ListBioseqsInSeqEntry@Base 6.1.20120620
+ ListCodingRegionsContainedInSourceFeatures@Base 6.1.20080302
+ ListFeaturesInLocation@Base 6.1.20080302
+ ListFeaturesOverlappingLocation@Base 6.1.20080302
+ ListFeaturesOverlappingLocationEx@Base 6.1.20100808
+ ListFree@Base 6.1.20030421
+ ListSequencesWithAlignments@Base 6.1.20120620
+ LoadCommentRuleSet@Base 6.1.20090719
+ LoadDict@Base 6.1.20030421
+ LoadLandMarkGene@Base 6.1.20030421
+ LoadPap@Base 6.1.20030421
+ LoadProteinForCdRegion@Base 6.1.20030421
+ LocNameFromGenome@Base 6.1.20080302
+ LocalAlignToSeqAnnotDimn@Base 6.1.20030421
+ LocalSeqFetchDisable@Base 6.1.20030421
+ LocalSeqFetchInit@Base 6.1.20030421
+ LocateInSeqAlign@Base 6.1.20030421
+ LocateInSeqAlignDenSeg@Base 6.1.20030421
+ LocationChoiceAsnRead@Base 6.1.20080302
+ LocationChoiceAsnWrite@Base 6.1.20080302
+ LocationChoiceFree@Base 6.1.20080302
+ LocationConstraintAsnRead@Base 6.1.20080302
+ LocationConstraintAsnWrite@Base 6.1.20080302
+ LocationConstraintFree@Base 6.1.20080302
+ LocationConstraintNew@Base 6.1.20080302
+ LocationContainsGaps@Base 6.1.20080302
+ LocationEditTypeAsnRead@Base 6.1.20080302
+ LocationEditTypeAsnWrite@Base 6.1.20080302
+ LocationEditTypeFree@Base 6.1.20080302
+ LocationHasNullsBetween@Base 6.1.20030421
+ LocationIntervalAsnRead@Base 6.1.20080302
+ LocationIntervalAsnWrite@Base 6.1.20080302
+ LocationIntervalFree@Base 6.1.20080302
+ LocationIntervalNew@Base 6.1.20080302
+ LocationPosConstraintAsnRead@Base 6.1.20100808
+ LocationPosConstraintAsnWrite@Base 6.1.20100808
+ LocationPosConstraintFree@Base 6.1.20100808
+ LockFarAlignmentBioseqs@Base 6.1.20061015
+ LockFarComponents@Base 6.1.20030421
+ LockFarComponentsEx@Base 6.1.20030421
+ LogTrimmedLocation@Base 6.1.20160908
+ LookForECnumberPattern@Base 6.1.20070822
+ LookForFuzz@Base 6.1.20030421
+ LooksLikeISSN@Base 6.1.20120620
+ LookupArticlesWithEutils@Base 6.1.20160908
+ LookupCountryByLatLon@Base 6.1.20110713
+ LookupFarSeqIDs@Base 6.1.20030421
+ LookupPubsInSeqEntry@Base 6.1.20160908
+ LookupWaterByLatLon@Base 6.1.20110713
+ LoopConstraintAsnRead@Base 6.1.20070822
+ LoopConstraintAsnWrite@Base 6.1.20070822
+ LoopConstraintFree@Base 6.1.20070822
+ LoopConstraintNew@Base 6.1.20070822
+ MacroActionChoiceAsnRead@Base 6.1.20080302
+ MacroActionChoiceAsnWrite@Base 6.1.20080302
+ MacroActionChoiceFree@Base 6.1.20080302
+ MacroActionListAsnRead@Base 6.1.20080302
+ MacroActionListAsnWrite@Base 6.1.20080302
+ MacroActionListFree@Base 6.1.20080302
+ MacroBondTypeFromAsn1BondType@Base 6.1.20081116
+ MacroSiteTypeFromAsn1SiteType@Base 6.1.20081116
+ MakeAModelstruc@Base 6.1.20030421
+ MakeAnAccession@Base 6.1.20030421
+ MakeAutoDefOptionsUserObject@Base 6.1.20160908
+ MakeBaseAccession@Base 6.1.20030421
+ MakeBaseLocusAwp@Base 6.1.20030421
+ MakeBlastnStyleScore@Base 6.1.20030421
+ MakeCdRegionFeature@Base 6.1.20030421
+ MakeCodeBreakList@Base 6.1.20070822
+ MakeCommentFeature@Base 6.1.20030421
+ MakeCompleteChromTitle@Base 6.1.20081116
+ MakeFastaStreamIdSuffix@Base 6.1.20160908
+ MakeFeatureFieldField@Base 6.1.20110713
+ MakeFeatureRequestsMatchExpectedTitle@Base 6.1.20100808
+ MakeFeatureXrefsFromProteinIdQuals@Base 6.1.20110713
+ MakeFeatureXrefsFromTranscriptIdQuals@Base 6.1.20110713
+ MakeGBSelectNote@Base 6.1.20030421
+ MakeGeneFeature@Base 6.1.20030421
+ MakeGeneLocForFeatureLoc@Base 6.1.20120620
+ MakeGeneXrefActionAsnRead@Base 6.1.20110713
+ MakeGeneXrefActionAsnWrite@Base 6.1.20110713
+ MakeGeneXrefActionFree@Base 6.1.20110713
+ MakeGeneXrefActionNew@Base 6.1.20110713
+ MakeGroupsForUniqueValues@Base 6.1.20100808
+ MakeImpFeature@Base 6.1.20030421
+ MakeNewProteinSeqId@Base 6.1.20030421
+ MakeNewProteinSeqIdEx@Base 6.1.20030421
+ MakeNewProteinSeqIdExMT@Base 6.1.20030421
+ MakeProteinFeature@Base 6.1.20030421
+ MakePubFeature@Base 6.1.20030421
+ MakeRNAFeature@Base 6.1.20030421
+ MakeRegionFeature@Base 6.1.20030421
+ MakeReversedSeqIdString@Base 6.1.20030421
+ MakeSeqEntryFromContig@Base 6.1.20081116
+ MakeSeqEntryFromRead@Base 6.1.20090301
+ MakeSeqID@Base 6.1.20030421
+ MakeSequinDataFromAlignment@Base 6.1.20040505
+ MakeSequinDataFromAlignmentEx@Base 6.1.20041020
+ MakeSiteFeature@Base 6.1.20030421
+ MakeSyntheticSeqFeat@Base 6.1.20030421
+ MakeTextTextMarker@Base 6.1.20100808
+ MakeTokensFromLine@Base 6.1.20081116
+ MakeTwoStringHashFromTabTable@Base 6.1.20110713
+ MakeUniqueSeqID@Base 6.1.20030421
+ MapAnchorToLoc@Base 6.1.20030421
+ MapLayoutFree@Base 6.1.20030421
+ MapLocToAnchor@Base 6.1.20030421
+ MapNa2ByteTo4BitString@Base 6.1.20040204
+ MapNa2ByteToIUPACString@Base 6.1.20030421
+ MapNa2ByteToNa4String@Base 6.1.20030421
+ MapNa4ByteTo4BitString@Base 6.1.20040204
+ MapNa4ByteToIUPACString@Base 6.1.20030421
+ MapNa4ByteToIUPACplusGapString@Base 6.1.20050605
+ MapsAsnRead@Base 6.1.20050429
+ MapsAsnWrite@Base 6.1.20050429
+ MapsFree@Base 6.1.20050429
+ MapsNew@Base 6.1.20050429
+ MarkFeaturesInGapsForDeletion@Base 6.1.20080302
+ MarkOverlappingCDSs@Base 6.1.20090719
+ MatchAAGeneToFeat@Base 6.1.20030421
+ MatchArrayStringIcase@Base 6.1.20030421
+ MatchNAGeneToFeat@Base 6.1.20030421
+ MatchRef@Base 6.1.20040204
+ MatchTypeFree@Base 6.1.20081116
+ MatchTypeFromTableMatchType@Base 6.1.20120620
+ MatchTypeNew@Base 6.1.20081116
+ MaxLengthSeqLoc@Base 6.1.20030421
+ MedlarsEntryAsnRead@Base 6.1.20030421
+ MedlarsEntryAsnWrite@Base 6.1.20030421
+ MedlarsEntryFree@Base 6.1.20030421
+ MedlarsEntryNew@Base 6.1.20030421
+ MedlarsEntryToAbsFile@Base 6.1.20030421
+ MedlarsEntryToDataFile@Base 6.1.20030421
+ MedlarsEntryToDocFile@Base 6.1.20030421
+ MedlarsRecordAsnRead@Base 6.1.20030421
+ MedlarsRecordAsnWrite@Base 6.1.20030421
+ MedlarsRecordFree@Base 6.1.20030421
+ MedlarsRecordNew@Base 6.1.20030421
+ MedlineAsnLoad@Base 6.1.20030421
+ MedlineEntryAsnRead@Base 6.1.20030421
+ MedlineEntryAsnWrite@Base 6.1.20030421
+ MedlineEntryFree@Base 6.1.20030421
+ MedlineEntryNew@Base 6.1.20030421
+ MedlineEntryToAbsFile@Base 6.1.20030421
+ MedlineEntryToDataFile@Base 6.1.20030421
+ MedlineEntryToDocFile@Base 6.1.20030421
+ MedlineFieldAsnRead@Base 6.1.20030421
+ MedlineFieldAsnWrite@Base 6.1.20030421
+ MedlineFieldFree@Base 6.1.20030421
+ MedlineFieldNew@Base 6.1.20030421
+ MedlineMeshAsnRead@Base 6.1.20030421
+ MedlineMeshAsnWrite@Base 6.1.20030421
+ MedlineMeshFree@Base 6.1.20030421
+ MedlineMeshNew@Base 6.1.20030421
+ MedlineRnAsnRead@Base 6.1.20030421
+ MedlineRnAsnWrite@Base 6.1.20030421
+ MedlineRnFree@Base 6.1.20030421
+ MedlineRnNew@Base 6.1.20030421
+ MedlineSiAsnRead@Base 6.1.20030421
+ MedlineSiAsnWrite@Base 6.1.20030421
+ MedlineSiFree@Base 6.1.20030421
+ MergeAdjacentAnnotsInList@Base 6.1.20100808
+ MergeAssemblyGapFeats@Base 6.1.20160908
+ MergeFFValNodeStrs@Base 6.1.20040204
+ MergeFeatureIntervalsToParts@Base 6.1.20070822
+ MergeFunc@Base 6.1.20030421
+ MergePCRPrimers@Base 6.1.20110713
+ MergeTwoAlignList@Base 6.1.20030421
+ MergeValNodeStrings@Base 6.1.20080302
+ MimAllelicVariantAsnRead@Base 6.1.20030421
+ MimAllelicVariantAsnWrite@Base 6.1.20030421
+ MimAllelicVariantFree@Base 6.1.20030421
+ MimAllelicVariantNew@Base 6.1.20030421
+ MimAsynchronousQuery@Base 6.1.20030421
+ MimAuthorAsnRead@Base 6.1.20030421
+ MimAuthorAsnWrite@Base 6.1.20030421
+ MimAuthorFree@Base 6.1.20030421
+ MimAuthorNew@Base 6.1.20030421
+ MimCheckQueue@Base 6.1.20030421
+ MimCitAsnRead@Base 6.1.20030421
+ MimCitAsnWrite@Base 6.1.20030421
+ MimCitFree@Base 6.1.20030421
+ MimCitNew@Base 6.1.20030421
+ MimDateAsnRead@Base 6.1.20030421
+ MimDateAsnWrite@Base 6.1.20030421
+ MimDateFree@Base 6.1.20030421
+ MimDateNew@Base 6.1.20030421
+ MimEditItemAsnRead@Base 6.1.20030421
+ MimEditItemAsnWrite@Base 6.1.20030421
+ MimEditItemFree@Base 6.1.20030421
+ MimEditItemNew@Base 6.1.20030421
+ MimEntryAsnRead@Base 6.1.20030421
+ MimEntryAsnWrite@Base 6.1.20030421
+ MimEntryFree@Base 6.1.20030421
+ MimEntryNew@Base 6.1.20030421
+ MimIndexTermAsnRead@Base 6.1.20030421
+ MimIndexTermAsnWrite@Base 6.1.20030421
+ MimIndexTermFree@Base 6.1.20030421
+ MimIndexTermNew@Base 6.1.20030421
+ MimLinkAsnRead@Base 6.1.20030421
+ MimLinkAsnWrite@Base 6.1.20030421
+ MimLinkFree@Base 6.1.20030421
+ MimLinkNew@Base 6.1.20030421
+ MimOpenConnection@Base 6.1.20030421
+ MimPageAsnRead@Base 6.1.20030421
+ MimPageAsnWrite@Base 6.1.20030421
+ MimPageFree@Base 6.1.20030421
+ MimPageNew@Base 6.1.20030421
+ MimReadReply@Base 6.1.20030421
+ MimReferenceAsnRead@Base 6.1.20030421
+ MimReferenceAsnWrite@Base 6.1.20030421
+ MimReferenceFree@Base 6.1.20030421
+ MimReferenceNew@Base 6.1.20030421
+ MimSetAsnRead@Base 6.1.20030421
+ MimSetAsnWrite@Base 6.1.20030421
+ MimSetFree@Base 6.1.20030421
+ MimSetNew@Base 6.1.20030421
+ MimSynchronousQuery@Base 6.1.20030421
+ MimTextAsnRead@Base 6.1.20030421
+ MimTextAsnWrite@Base 6.1.20030421
+ MimTextFree@Base 6.1.20030421
+ MimTextNew@Base 6.1.20030421
+ MimWaitForReply@Base 6.1.20030421
+ MinimizePub@Base 6.1.20030421
+ Mla22RequestAsnRead@Base 6.1.20070822
+ Mla2AsynchronousQuery@Base 6.1.20070822
+ Mla2BackAsnRead@Base 6.1.20070822
+ Mla2BackAsnWrite@Base 6.1.20070822
+ Mla2BackFree@Base 6.1.20070822
+ Mla2CheckQueue@Base 6.1.20070822
+ Mla2CorrectCitArt@Base 6.1.20070822
+ Mla2CreateCitArtJournalRequest@Base 6.1.20070822
+ Mla2CreateCitArtMatchRequest@Base 6.1.20070822
+ Mla2CreateCitationtMatchRequest@Base 6.1.20070822
+ Mla2CreateJournalTitleRequest@Base 6.1.20070822
+ Mla2CreatePubFetchRequest@Base 6.1.20070822
+ Mla2ExtractCitMatchReply@Base 6.1.20070822
+ Mla2ExtractJournalTitleReply@Base 6.1.20070822
+ Mla2ExtractPubFetchReply@Base 6.1.20070822
+ Mla2IsEPubOnlyJournal@Base 6.1.20080302
+ Mla2OpenConnection@Base 6.1.20070822
+ Mla2ReadReply@Base 6.1.20070822
+ Mla2RequestAsnWrite@Base 6.1.20070822
+ Mla2RequestFree@Base 6.1.20070822
+ Mla2SynchronousQuery@Base 6.1.20070822
+ Mla2WaitForReply@Base 6.1.20070822
+ ModelEvidenceItemAsnRead@Base 6.1.20110713
+ ModelEvidenceItemAsnWrite@Base 6.1.20110713
+ ModelEvidenceItemFree@Base 6.1.20110713
+ ModelEvidenceItemNew@Base 6.1.20110713
+ ModelEvidenceSupportAsnRead@Base 6.1.20110713
+ ModelEvidenceSupportAsnWrite@Base 6.1.20110713
+ ModelEvidenceSupportFree@Base 6.1.20110713
+ ModelEvidenceSupportNew@Base 6.1.20110713
+ ModernizeGeneFields@Base 6.1.20081116
+ ModernizePCRPrimers@Base 6.1.20081116
+ ModernizeRNAFields@Base 6.1.20081116
+ MolFromMoleculeClassType@Base 6.1.20080302
+ MolInfoAsnRead@Base 6.1.20030421
+ MolInfoAsnWrite@Base 6.1.20030421
+ MolInfoFree@Base 6.1.20030421
+ MolInfoNew@Base 6.1.20030421
+ MolNameFromMol@Base 6.1.20080302
+ MolTypeForGI@Base 6.1.20030421
+ MolWtForBsp@Base 6.1.20050828
+ MolWtForLoc@Base 6.1.20030421
+ MolWtForStr@Base 6.1.20050828
+ MolinfoBlockAsnRead@Base 6.1.20081116
+ MolinfoBlockAsnWrite@Base 6.1.20081116
+ MolinfoBlockFree@Base 6.1.20081116
+ MolinfoBlockNew@Base 6.1.20081116
+ MolinfoCompletednessPairAsnRead@Base 6.1.20080302
+ MolinfoCompletednessPairAsnWrite@Base 6.1.20080302
+ MolinfoCompletednessPairFree@Base 6.1.20080302
+ MolinfoCompletednessPairNew@Base 6.1.20080302
+ MolinfoFieldAsnRead@Base 6.1.20080302
+ MolinfoFieldAsnWrite@Base 6.1.20080302
+ MolinfoFieldConstraintAsnRead@Base 6.1.20110713
+ MolinfoFieldConstraintAsnWrite@Base 6.1.20110713
+ MolinfoFieldConstraintFree@Base 6.1.20110713
+ MolinfoFieldConstraintNew@Base 6.1.20110713
+ MolinfoFieldFree@Base 6.1.20080302
+ MolinfoFieldListAsnRead@Base 6.1.20081116
+ MolinfoFieldListAsnWrite@Base 6.1.20081116
+ MolinfoFieldListFree@Base 6.1.20081116
+ MolinfoFieldPairAsnRead@Base 6.1.20080302
+ MolinfoFieldPairAsnWrite@Base 6.1.20080302
+ MolinfoFieldPairFree@Base 6.1.20080302
+ MolinfoMolClassPairAsnRead@Base 6.1.20080302
+ MolinfoMolClassPairAsnWrite@Base 6.1.20080302
+ MolinfoMolClassPairFree@Base 6.1.20080302
+ MolinfoMolClassPairNew@Base 6.1.20080302
+ MolinfoMoleculePairAsnRead@Base 6.1.20080302
+ MolinfoMoleculePairAsnWrite@Base 6.1.20080302
+ MolinfoMoleculePairFree@Base 6.1.20080302
+ MolinfoMoleculePairNew@Base 6.1.20080302
+ MolinfoStrandPairAsnRead@Base 6.1.20080302
+ MolinfoStrandPairAsnWrite@Base 6.1.20080302
+ MolinfoStrandPairFree@Base 6.1.20080302
+ MolinfoStrandPairNew@Base 6.1.20080302
+ MolinfoTechniquePairAsnRead@Base 6.1.20080302
+ MolinfoTechniquePairAsnWrite@Base 6.1.20080302
+ MolinfoTechniquePairFree@Base 6.1.20080302
+ MolinfoTechniquePairNew@Base 6.1.20080302
+ MolinfoTopologyPairAsnRead@Base 6.1.20080302
+ MolinfoTopologyPairAsnWrite@Base 6.1.20080302
+ MolinfoTopologyPairFree@Base 6.1.20080302
+ MolinfoTopologyPairNew@Base 6.1.20080302
+ MoveSequencesFromSetToWrapper@Base 6.1.20110713
+ MrnaTransCheck@Base 6.1.20030421
+ MultSeqAlignFromPairSeqAlign@Base 6.1.20030421
+ MuskSeqIdWrite@Base 6.1.20030421
+ MyFGetLine@Base 6.1.20040505
+ NAccnIsDDBJ@Base 6.1.20030421
+ NAccnIsEMBL@Base 6.1.20030421
+ NAccnIsGENBANK@Base 6.1.20030421
+ NCBISubBuild@Base 6.1.20030421
+ NCBISubCreate@Base 6.1.20030421
+ NCBISubFree@Base 6.1.20030421
+ NCBISubValidate@Base 6.1.20030421
+ NCBISubWrite@Base 6.1.20030421
+ NC_Cleanup@Base 6.1.20030421
+ N_atoms@Base 6.1.20030421
+ NaI2TableFree@Base 6.1.20030421
+ NameStdAsnRead@Base 6.1.20030421
+ NameStdAsnWrite@Base 6.1.20030421
+ NameStdFree@Base 6.1.20030421
+ NameStdMatch@Base 6.1.20050605
+ NameStdNew@Base 6.1.20030421
+ NcrnaOTHER@Base 6.1.20080302
+ NeedlemanWunschQuadraticByLoc@Base 6.1.20030421
+ NetTestAsynchronousQuery@Base 6.1.20031028
+ NetTestCheckQueue@Base 6.1.20031028
+ NetTestReadReply@Base 6.1.20031028
+ NewClickableItem@Base 6.1.20070822
+ NewClickableItemNoList@Base 6.1.20110713
+ NewContLine@Base 6.1.20030421
+ NewCreateDefLine@Base 6.1.20081116
+ NewCreateDefLineBuf@Base 6.1.20081116
+ NewCreateDefLineEx@Base 6.1.20160908
+ NewCreateDefLineExEx@Base 6.1.20160908
+ NewDescrOnSeqEntry@Base 6.1.20030421
+ NewFeatureClause@Base 6.1.20080302
+ NewRuleForStructuredComment@Base 6.1.20160908
+ Nlm_gbgap@Base 6.1.20030421
+ Nlm_gbint@Base 6.1.20030421
+ Nlm_gbint_ver@Base 6.1.20030421
+ Nlm_gbload_number@Base 6.1.20030421
+ Nlm_gbloc@Base 6.1.20030421
+ Nlm_gbloc_ver@Base 6.1.20030421
+ Nlm_gbparse_better_be_done@Base 6.1.20030421
+ Nlm_gbparse_error@Base 6.1.20030421
+ Nlm_gbparse_lexfree@Base 6.1.20030421
+ Nlm_gbparse_point@Base 6.1.20030421
+ Nlm_gbparseint@Base 6.1.20030421
+ Nlm_gbparseint_ver@Base 6.1.20030421
+ Nlm_gbparselex@Base 6.1.20030421
+ Nlm_gbparselex_ver@Base 6.1.20030421
+ Nlm_gbpintpnt@Base 6.1.20030421
+ Nlm_gbreplace@Base 6.1.20030421
+ Nlm_gbreplace_ver@Base 6.1.20030421
+ Nlm_install_gbparse_error_handler@Base 6.1.20030421
+ Nlm_install_gbparse_range_func@Base 6.1.20030421
+ Nlm_non_white@Base 6.1.20030421
+ NormalizeDescriptorOrder@Base 6.1.20081116
+ NormalizeNullsBetween@Base 6.1.20110713
+ NoteStructFree@Base 6.1.20030421
+ NoteStructNew@Base 6.1.20030421
+ NoteStructReset@Base 6.1.20030421
+ NoteText@Base 6.1.20081116
+ NoteToCharPtrStack@Base 6.1.20030421
+ NumContAsnRead@Base 6.1.20030421
+ NumContAsnWrite@Base 6.1.20030421
+ NumContFree@Base 6.1.20030421
+ NumContNew@Base 6.1.20030421
+ NumDefLineModifiers@Base 6.1.20080302
+ NumEnumAsnRead@Base 6.1.20030421
+ NumEnumAsnWrite@Base 6.1.20030421
+ NumEnumFree@Base 6.1.20030421
+ NumEnumNew@Base 6.1.20030421
+ NumRealAsnRead@Base 6.1.20030421
+ NumRealAsnWrite@Base 6.1.20030421
+ NumRealFree@Base 6.1.20030421
+ NumRealNew@Base 6.1.20030421
+ NumberingAsnRead@Base 6.1.20030421
+ NumberingAsnWrite@Base 6.1.20030421
+ NumberingDefaultGet@Base 6.1.20030421
+ NumberingDefaultLoad@Base 6.1.20030421
+ NumberingFree@Base 6.1.20030421
+ NumberingOffset@Base 6.1.20030421
+ NumberingValue@Base 6.1.20030421
+ NumberingValueBySeqId@Base 6.1.20030421
+ OMGetNextUserKey@Base 6.1.20030421
+ OOFDisplayTraceBack1@Base 6.1.20030421
+ OOFDisplayTraceBack2@Base 6.1.20030421
+ OOFShowBlastAlignment@Base 6.1.20030421
+ OOFTranslateDNAInAllFrames@Base 6.1.20030421
+ O_atoms@Base 6.1.20030421
+ ObjMgrAdd@Base 6.1.20030421
+ ObjMgrAddEntityID@Base 6.1.20030421
+ ObjMgrAddIndexOnEntityID@Base 6.1.20030421
+ ObjMgrAddToClipBoard@Base 6.1.20030421
+ ObjMgrAddUserData@Base 6.1.20030421
+ ObjMgrAlsoSelect@Base 6.1.20030421
+ ObjMgrCheckHold@Base 6.1.20030421
+ ObjMgrClearHold@Base 6.1.20030421
+ ObjMgrClearOptions@Base 6.1.20030421
+ ObjMgrConnect@Base 6.1.20030421
+ ObjMgrConnectFunc@Base 6.1.20030421
+ ObjMgrDeSelect@Base 6.1.20030421
+ ObjMgrDeSelectAll@Base 6.1.20030421
+ ObjMgrDelete@Base 6.1.20030421
+ ObjMgrDeleteAllInRecord@Base 6.1.20030421
+ ObjMgrDeleteIndexOnEntityID@Base 6.1.20030421
+ ObjMgrDetach@Base 6.1.20030421
+ ObjMgrDetachFunc@Base 6.1.20030421
+ ObjMgrDump@Base 6.1.20030421
+ ObjMgrFindByData@Base 6.1.20030421
+ ObjMgrFindTop@Base 6.1.20030421
+ ObjMgrFree@Base 6.1.20030421
+ ObjMgrFreeByEntityID@Base 6.1.20030421
+ ObjMgrFreeCache@Base 6.1.20030421
+ ObjMgrFreeClipBoard@Base 6.1.20030421
+ ObjMgrFreeUserData@Base 6.1.20030421
+ ObjMgrGenericAsnTextFileRead@Base 6.1.20030421
+ ObjMgrGet@Base 6.1.20030421
+ ObjMgrGetChoiceForData@Base 6.1.20030421
+ ObjMgrGetChoiceForEntityID@Base 6.1.20030421
+ ObjMgrGetClipBoard@Base 6.1.20030421
+ ObjMgrGetData@Base 6.1.20030421
+ ObjMgrGetDataStruct@Base 6.1.20030421
+ ObjMgrGetDirtyFlag@Base 6.1.20030421
+ ObjMgrGetEntityIDForChoice@Base 6.1.20030421
+ ObjMgrGetEntityIDForPointer@Base 6.1.20030421
+ ObjMgrGetOptions@Base 6.1.20030421
+ ObjMgrGetProcID@Base 6.1.20030421
+ ObjMgrGetSelected@Base 6.1.20030421
+ ObjMgrGetUserData@Base 6.1.20030421
+ ObjMgrIsChild@Base 6.1.20030421
+ ObjMgrIsTemp@Base 6.1.20030421
+ ObjMgrLock@Base 6.1.20030421
+ ObjMgrLookup@Base 6.1.20030421
+ ObjMgrLookupIndexOnEntityID@Base 6.1.20030421
+ ObjMgrMatch@Base 6.1.20030421
+ ObjMgrMemCopy@Base 6.1.20030421
+ ObjMgrProcAdd@Base 6.1.20030421
+ ObjMgrProcFind@Base 6.1.20030421
+ ObjMgrProcFindNext@Base 6.1.20030421
+ ObjMgrProcLoad@Base 6.1.20030421
+ ObjMgrProcLoadEx@Base 6.1.20030421
+ ObjMgrProcLookup@Base 6.1.20030421
+ ObjMgrProcOpen@Base 6.1.20030421
+ ObjMgrReadLock@Base 6.1.20030421
+ ObjMgrReap@Base 6.1.20030421
+ ObjMgrReapOne@Base 6.1.20030421
+ ObjMgrRecordOmdpByEntityID@Base 6.1.20030421
+ ObjMgrRegister@Base 6.1.20030421
+ ObjMgrRemoveEntityIDFromRecycle@Base 6.1.20030421
+ ObjMgrReportFunc@Base 6.1.20030421
+ ObjMgrReportProc@Base 6.1.20061015
+ ObjMgrResetAll@Base 6.1.20030421
+ ObjMgrSelect@Base 6.1.20030421
+ ObjMgrSelectPrint@Base 6.1.20030421
+ ObjMgrSendMsg@Base 6.1.20030421
+ ObjMgrSendMsgNoFeatureChange@Base 6.1.20100808
+ ObjMgrSendMsgOnlyFeatLabelChange@Base 6.1.20100808
+ ObjMgrSendProcMsg@Base 6.1.20030421
+ ObjMgrSendRowMsg@Base 6.1.20030421
+ ObjMgrSetChoice@Base 6.1.20030421
+ ObjMgrSetColor@Base 6.1.20030421
+ ObjMgrSetDirtyFlag@Base 6.1.20030421
+ ObjMgrSetHold@Base 6.1.20030421
+ ObjMgrSetOptions@Base 6.1.20030421
+ ObjMgrSetTempLoad@Base 6.1.20030421
+ ObjMgrStatusString@Base 6.1.20050429
+ ObjMgrTestOptions@Base 6.1.20030421
+ ObjMgrTypeAdd@Base 6.1.20030421
+ ObjMgrTypeFind@Base 6.1.20030421
+ ObjMgrTypeFindNext@Base 6.1.20030421
+ ObjMgrTypeLoad@Base 6.1.20030421
+ ObjMgrTypeLookup@Base 6.1.20030421
+ ObjMgrTypeSetLabelFunc@Base 6.1.20030421
+ ObjMgrUnlock@Base 6.1.20030421
+ ObjMgrWholeEntity@Base 6.1.20030421
+ ObjMgrWriteLock@Base 6.1.20030421
+ ObjPrtAsnLoad@Base 6.1.20030421
+ ObjectIdAsnRead@Base 6.1.20030421
+ ObjectIdAsnWrite@Base 6.1.20030421
+ ObjectIdCompare@Base 6.1.20081116
+ ObjectIdDup@Base 6.1.20030421
+ ObjectIdFree@Base 6.1.20030421
+ ObjectIdMatch@Base 6.1.20030421
+ ObjectIdMatchEx@Base 6.1.20081116
+ ObjectIdNew@Base 6.1.20030421
+ OffsetFeatureIDXrefs@Base 6.1.20060507
+ OffsetFeatureIDs@Base 6.1.20060507
+ OkToTaxFix@Base 6.1.20160908
+ OncallerToolPseudoDiscrepanciesFix@Base 6.1.20100808
+ OneLetterCode@Base 6.1.20030421
+ OpenLog@Base 6.1.20090719
+ OpenMMDBAPI@Base 6.1.20030421
+ OrderFeatProc@Base 6.1.20030421
+ OrgModAsnRead@Base 6.1.20030421
+ OrgModAsnWrite@Base 6.1.20030421
+ OrgModFree@Base 6.1.20030421
+ OrgModNew@Base 6.1.20030421
+ OrgModSetAsnRead@Base 6.1.20030421
+ OrgModSetAsnWrite@Base 6.1.20030421
+ OrgModSetCompare@Base 6.1.20081116
+ OrgModSetFree@Base 6.1.20030421
+ OrgModSetMatch@Base 6.1.20050605
+ OrgModSetMatchExceptOldName@Base 6.1.20120620
+ OrgModText@Base 6.1.20081116
+ OrgNameAsnRead@Base 6.1.20030421
+ OrgNameAsnWrite@Base 6.1.20030421
+ OrgNameCompare@Base 6.1.20081116
+ OrgNameFree@Base 6.1.20030421
+ OrgNameMatch@Base 6.1.20050605
+ OrgNameMatchExceptOldName@Base 6.1.20120620
+ OrgNameNew@Base 6.1.20030421
+ OrgNameSetAsnRead@Base 6.1.20030421
+ OrgNameSetAsnWrite@Base 6.1.20030421
+ OrgNameSetFree@Base 6.1.20030421
+ OrgRefAsnRead@Base 6.1.20030421
+ OrgRefAsnWrite@Base 6.1.20030421
+ OrgRefCompare@Base 6.1.20081116
+ OrgRefFree@Base 6.1.20030421
+ OrgRefMatch@Base 6.1.20050605
+ OrgRefNew@Base 6.1.20030421
+ OrganizePubList@Base 6.1.20030421
+ OrganizeSeqFeat@Base 6.1.20030421
+ OriginFromSrcOrig@Base 6.1.20080302
+ OriginNameFromOrigin@Base 6.1.20080302
+ OtherSourceAsnRead@Base 6.1.20050429
+ OtherSourceAsnWrite@Base 6.1.20050429
+ OtherSourceFree@Base 6.1.20050429
+ OtherSourceNew@Base 6.1.20050429
+ PCRPrimerAsnRead@Base 6.1.20081116
+ PCRPrimerAsnWrite@Base 6.1.20081116
+ PCRPrimerFree@Base 6.1.20081116
+ PCRPrimerNew@Base 6.1.20081116
+ PCRPrimerSetAsnRead@Base 6.1.20081116
+ PCRPrimerSetAsnWrite@Base 6.1.20081116
+ PCRPrimerSetFree@Base 6.1.20081116
+ PCRReactionAsnRead@Base 6.1.20081116
+ PCRReactionAsnWrite@Base 6.1.20081116
+ PCRReactionFree@Base 6.1.20081116
+ PCRReactionIsEmpty@Base 6.1.20110713
+ PCRReactionNew@Base 6.1.20081116
+ PCRReactionSetAsnRead@Base 6.1.20081116
+ PCRReactionSetAsnWrite@Base 6.1.20081116
+ PCRReactionSetFree@Base 6.1.20081116
+ PDBSeqIdAsnRead@Base 6.1.20030421
+ PDBSeqIdAsnWrite@Base 6.1.20030421
+ PDBSeqIdFree@Base 6.1.20030421
+ PDBSeqIdNew@Base 6.1.20030421
+ PackSegAsnRead@Base 6.1.20030421
+ PackSegAsnWrite@Base 6.1.20030421
+ PackSegFree@Base 6.1.20030421
+ PackSegGapList@Base 6.1.20030421
+ PackSegNew@Base 6.1.20030421
+ PackSegStats@Base 6.1.20030421
+ PackSeqIntAsnRead@Base 6.1.20030421
+ PackSeqIntAsnWrite@Base 6.1.20030421
+ PackSeqPntAsnRead@Base 6.1.20030421
+ PackSeqPntAsnWrite@Base 6.1.20030421
+ PackSeqPntCheck@Base 6.1.20030421
+ PackSeqPntDelete@Base 6.1.20030421
+ PackSeqPntFree@Base 6.1.20030421
+ PackSeqPntGet@Base 6.1.20030421
+ PackSeqPntInsert@Base 6.1.20030421
+ PackSeqPntNew@Base 6.1.20030421
+ PackSeqPntNum@Base 6.1.20030421
+ PackSeqPntPut@Base 6.1.20030421
+ PairSeqAlign2MultiSeqAlign@Base 6.1.20030421
+ PairwiseSeqAlignHasLinkout@Base 6.1.20030421
+ ParFlat_AA_array@Base 6.1.20030421
+ ParFlat_ExpString@Base 6.1.20030421
+ ParFlat_IntOrString@Base 6.1.20030421
+ ParFlat_LRBString@Base 6.1.20030421
+ ParFlat_RptString@Base 6.1.20030421
+ ParseActionAsnRead@Base 6.1.20080302
+ ParseActionAsnWrite@Base 6.1.20080302
+ ParseActionFree@Base 6.1.20080302
+ ParseActionNew@Base 6.1.20080302
+ ParseAnticodon@Base 6.1.20040505
+ ParseCodeBreak@Base 6.1.20030421
+ ParseDegenerateCodon@Base 6.1.20030421
+ ParseDestAsnRead@Base 6.1.20080302
+ ParseDestAsnWrite@Base 6.1.20080302
+ ParseDestFree@Base 6.1.20080302
+ ParseDstOrgAsnRead@Base 6.1.20080302
+ ParseDstOrgAsnWrite@Base 6.1.20080302
+ ParseDstOrgFree@Base 6.1.20080302
+ ParseDstOrgNew@Base 6.1.20080302
+ ParseExtractorResultsTableToFeatures@Base 6.1.20110713
+ ParseGoTermsFromFields@Base 6.1.20080302
+ ParseLatLon@Base 6.1.20070822
+ ParseMedline@Base 6.1.20030421
+ ParsePCRSet@Base 6.1.20070822
+ ParsePCRStrings@Base 6.1.20070822
+ ParsePubFromEndnote@Base 6.1.20120620
+ ParseRNAFeatListTableToFeatures@Base 6.1.20160908
+ ParseSimpleSeqLoc@Base 6.1.20090719
+ ParseSrcAsnRead@Base 6.1.20080302
+ ParseSrcAsnWrite@Base 6.1.20080302
+ ParseSrcFree@Base 6.1.20080302
+ ParseSrcGeneralIdAsnRead@Base 6.1.20110713
+ ParseSrcGeneralIdAsnWrite@Base 6.1.20110713
+ ParseSrcGeneralIdFree@Base 6.1.20110713
+ ParseSrcOrgAsnRead@Base 6.1.20080302
+ ParseSrcOrgAsnWrite@Base 6.1.20080302
+ ParseSrcOrgChoiceAsnRead@Base 6.1.20080302
+ ParseSrcOrgChoiceAsnWrite@Base 6.1.20080302
+ ParseSrcOrgChoiceFree@Base 6.1.20080302
+ ParseSrcOrgFree@Base 6.1.20080302
+ ParseSrcOrgNew@Base 6.1.20080302
+ ParseStringIntoSeqHist@Base 6.1.20040204
+ ParseStringIntoStructuredComment@Base 6.1.20060507
+ ParseStructuredVoucher@Base 6.1.20081116
+ ParseTRnaString@Base 6.1.20030421
+ ParseTaxNameToQuals@Base 6.1.20100808
+ ParseTitleIntoBioSource@Base 6.1.20030421
+ ParseTitleIntoBioseq@Base 6.1.20030421
+ ParseTitleIntoDBLinkBioProject@Base 6.1.20120620
+ ParseTitleIntoDBLinkBioSample@Base 6.1.20120620
+ ParseTitleIntoDBLinkSeqReadArch@Base 6.1.20120620
+ ParseTitleIntoGenBank@Base 6.1.20030421
+ ParseTitleIntoGeneRef@Base 6.1.20030421
+ ParseTitleIntoGenomeProjectsDB@Base 6.1.20070822
+ ParseTitleIntoMolInfo@Base 6.1.20030421
+ ParseTitleIntoProtRef@Base 6.1.20030421
+ ParseTitleIntoSeqHist@Base 6.1.20030421
+ ParseTitleIntoSubmitBlock@Base 6.1.20100808
+ ParseTitleIntoTpaAssembly@Base 6.1.20030421
+ Partial3SetActionAsnRead@Base 6.1.20080302
+ Partial3SetActionAsnWrite@Base 6.1.20080302
+ Partial3SetActionFree@Base 6.1.20080302
+ Partial3SetActionNew@Base 6.1.20080302
+ Partial5SetActionAsnRead@Base 6.1.20080302
+ Partial5SetActionAsnWrite@Base 6.1.20080302
+ Partial5SetActionFree@Base 6.1.20080302
+ Partial5SetActionNew@Base 6.1.20080302
+ PartialBothSetActionAsnRead@Base 6.1.20110713
+ PartialBothSetActionAsnWrite@Base 6.1.20110713
+ PartialBothSetActionFree@Base 6.1.20110713
+ PartialBothSetActionNew@Base 6.1.20110713
+ PassBarcodeTests@Base 6.1.20070822
+ PatPriorityNew@Base 6.1.20030421
+ PatPrioritySetAsnRead@Base 6.1.20030421
+ PatPrioritySetAsnWrite@Base 6.1.20030421
+ PatPrioritySetFree@Base 6.1.20030421
+ PatchBadSequence@Base 6.1.20030421
+ PatentSeqIdAsnRead@Base 6.1.20030421
+ PatentSeqIdAsnWrite@Base 6.1.20030421
+ PatentSeqIdFree@Base 6.1.20030421
+ PatentSeqIdNew@Base 6.1.20030421
+ PdbBlockAsnRead@Base 6.1.20030421
+ PdbBlockAsnWrite@Base 6.1.20030421
+ PdbBlockFree@Base 6.1.20030421
+ PdbBlockNew@Base 6.1.20030421
+ PercentNInBioseq@Base 6.1.20100808
+ PercentNInBioseqInterval@Base 6.1.20120620
+ PersistentTransTableByCdRegion@Base 6.1.20030421
+ PersistentTransTableByGenCode@Base 6.1.20030421
+ PersonIdAsnRead@Base 6.1.20030421
+ PersonIdAsnWrite@Base 6.1.20030421
+ PersonIdFree@Base 6.1.20030421
+ PersonIdLabel@Base 6.1.20030421
+ PersonIdMatch@Base 6.1.20050605
+ PersonIdNew@Base 6.1.20030421
+ PersonIdPrint@Base 6.1.20030421
+ PhenotypeAsnRead@Base 6.1.20100808
+ PhenotypeAsnWrite@Base 6.1.20100808
+ PhenotypeFree@Base 6.1.20100808
+ PhenotypeNew@Base 6.1.20100808
+ PhrapGraphForContig@Base 6.1.20030421
+ PhraseListAsnRead@Base 6.1.20160908
+ PhraseListAsnWrite@Base 6.1.20160908
+ PhraseListFree@Base 6.1.20160908
+ PirBlockAsnRead@Base 6.1.20030421
+ PirBlockAsnWrite@Base 6.1.20030421
+ PirBlockFree@Base 6.1.20030421
+ PirBlockNew@Base 6.1.20030421
+ PopSetAutoDefRetro@Base 6.1.20100808
+ PopulateGapLocQuals@Base 6.1.20160908
+ PopulationDataAsnRead@Base 6.1.20100808
+ PopulationDataAsnWrite@Base 6.1.20100808
+ PopulationDataFree@Base 6.1.20100808
+ PopulationDataNew@Base 6.1.20100808
+ PostARefErrMessage@Base 6.1.20030421
+ PowerBLASTASN1Detected@Base 6.1.20030421
+ PrepareSequenceListForSegregateByBioseqList@Base 6.1.20120620
+ PrepareSequenceListForSegregateByNumberOfSets@Base 6.1.20100808
+ PrepareSequenceListForSegregateByNumberPerSet@Base 6.1.20100808
+ PrepareSourceFeatQuals@Base 6.1.20030421
+ PreprocessMacroForRepeatedUse@Base 6.1.20120620
+ PrfBlockAsnRead@Base 6.1.20030421
+ PrfBlockAsnWrite@Base 6.1.20030421
+ PrfBlockFree@Base 6.1.20030421
+ PrfBlockNew@Base 6.1.20030421
+ PrintAAFeatByNumber@Base 6.1.20030421
+ PrintACEFormatErrorXML@Base 6.1.20081116
+ PrintACEFormatErrorXMLEnd@Base 6.1.20081116
+ PrintACEFormatErrorXMLStart@Base 6.1.20081116
+ PrintAccessLine@Base 6.1.20030421
+ PrintAlignForText@Base 6.1.20030421
+ PrintBaseCount@Base 6.1.20030421
+ PrintCharFunc@Base 6.1.20030421
+ PrintComment@Base 6.1.20030421
+ PrintCommentByNumber@Base 6.1.20030421
+ PrintDBSourceLine@Base 6.1.20030421
+ PrintDate@Base 6.1.20030421
+ PrintDateLines@Base 6.1.20030421
+ PrintDefLinesExtra@Base 6.1.20030421
+ PrintDefLinesFromAnnot@Base 6.1.20030421
+ PrintDefLinesFromSeqAlign@Base 6.1.20030421
+ PrintDefLinesFromSeqAlignEx2@Base 6.1.20030421
+ PrintDefLinesFromSeqAlignEx@Base 6.1.20030421
+ PrintDefLinesFromSeqAlignWithPath@Base 6.1.20040204
+ PrintDefinitionLine@Base 6.1.20030421
+ PrintDiscrepancyTestList@Base 6.1.20081116
+ PrintEPLocusLine@Base 6.1.20030421
+ PrintEPSequence@Base 6.1.20030421
+ PrintFTCodeBreak@Base 6.1.20100808
+ PrintFTCodeBreakEx@Base 6.1.20120620
+ PrintFeatHeader@Base 6.1.20030421
+ PrintFirstComment@Base 6.1.20030421
+ PrintFormAsnRead@Base 6.1.20030421
+ PrintFormAsnWrite@Base 6.1.20030421
+ PrintFormBlockAsnRead@Base 6.1.20030421
+ PrintFormBlockAsnWrite@Base 6.1.20030421
+ PrintFormBlockFree@Base 6.1.20030421
+ PrintFormBlockNew@Base 6.1.20030421
+ PrintFormBooleanAsnRead@Base 6.1.20030421
+ PrintFormBooleanAsnWrite@Base 6.1.20030421
+ PrintFormBooleanFree@Base 6.1.20030421
+ PrintFormBooleanNew@Base 6.1.20030421
+ PrintFormEnumAsnRead@Base 6.1.20030421
+ PrintFormEnumAsnWrite@Base 6.1.20030421
+ PrintFormEnumFree@Base 6.1.20030421
+ PrintFormEnumNew@Base 6.1.20030421
+ PrintFormFree@Base 6.1.20030421
+ PrintFormTextAsnRead@Base 6.1.20030421
+ PrintFormTextAsnWrite@Base 6.1.20030421
+ PrintFormTextFree@Base 6.1.20030421
+ PrintFormTextNew@Base 6.1.20030421
+ PrintFormatAsnRead@Base 6.1.20030421
+ PrintFormatAsnWrite@Base 6.1.20030421
+ PrintFormatFree@Base 6.1.20030421
+ PrintFormatListBuild@Base 6.1.20030421
+ PrintFormatListFind@Base 6.1.20030421
+ PrintFormatListFree@Base 6.1.20030421
+ PrintFormatListFreeAll@Base 6.1.20030421
+ PrintFormatListGet@Base 6.1.20030421
+ PrintFormatListGetMaxKey@Base 6.1.20030421
+ PrintFormatListNew@Base 6.1.20030421
+ PrintFormatNew@Base 6.1.20030421
+ PrintFormatTraverse@Base 6.1.20030421
+ PrintFrameShiftReportList@Base 6.1.20120620
+ PrintFtableIntervals@Base 6.1.20040616
+ PrintFtableLocAndQuals@Base 6.1.20040616
+ PrintGBOrganismLine@Base 6.1.20030421
+ PrintGBSourceLine@Base 6.1.20030421
+ PrintGenome@Base 6.1.20030421
+ PrintImpFeat@Base 6.1.20030421
+ PrintImpFeatEx@Base 6.1.20030421
+ PrintKeywordLine@Base 6.1.20030421
+ PrintLocusLine@Base 6.1.20030421
+ PrintNAFeatByNumber@Base 6.1.20030421
+ PrintNCBI_GI@Base 6.1.20030421
+ PrintNID@Base 6.1.20030421
+ PrintOrganismLine@Base 6.1.20030421
+ PrintOriginLine@Base 6.1.20030421
+ PrintPubsByNumber@Base 6.1.20030421
+ PrintQBlastQueue@Base 6.1.20030421
+ PrintQualityScores@Base 6.1.20030421
+ PrintQualityScoresForContig@Base 6.1.20030421
+ PrintQualityScoresToBuffer@Base 6.1.20030421
+ PrintSPBlock@Base 6.1.20030421
+ PrintSegmentLine@Base 6.1.20030421
+ PrintSeqAlignCallback@Base 6.1.20030421
+ PrintSeqBlk@Base 6.1.20030421
+ PrintSeqBlkEx@Base 6.1.20030421
+ PrintSequence@Base 6.1.20030421
+ PrintSourceFeat@Base 6.1.20030421
+ PrintStackAddItem@Base 6.1.20030421
+ PrintStackBuild@Base 6.1.20030421
+ PrintStackDump@Base 6.1.20030421
+ PrintStackFree@Base 6.1.20030421
+ PrintStackGetSize@Base 6.1.20030421
+ PrintStackItemGet@Base 6.1.20030421
+ PrintStackItemNew@Base 6.1.20030421
+ PrintStackPrint@Base 6.1.20030421
+ PrintStackSort@Base 6.1.20030421
+ PrintStringConvert@Base 6.1.20030421
+ PrintSuspectRuleMatches@Base 6.1.20110713
+ PrintTaxonomy@Base 6.1.20030421
+ PrintTemplateAsnRead@Base 6.1.20030421
+ PrintTemplateAsnWrite@Base 6.1.20030421
+ PrintTemplateFind@Base 6.1.20030421
+ PrintTemplateFree@Base 6.1.20030421
+ PrintTemplateFreeAll@Base 6.1.20030421
+ PrintTemplateInMem@Base 6.1.20030421
+ PrintTemplateNew@Base 6.1.20030421
+ PrintTemplateSetAsnRead@Base 6.1.20030421
+ PrintTemplateSetLoad@Base 6.1.20030421
+ PrintTemplateSetLoadEx@Base 6.1.20040204
+ PrintTerminator@Base 6.1.20030421
+ PrintVecScreenQueue@Base 6.1.20030421
+ PrintVersionLine@Base 6.1.20030421
+ PrintXX@Base 6.1.20030421
+ PrintXrefLine@Base 6.1.20030421
+ ProcessLargeACEFileForContigFastaAndQualScores@Base 6.1.20090301
+ ProcessTextAlignNode2@Base 6.1.20030421
+ ProcessTextAlignNode@Base 6.1.20030421
+ ProductContainsTerm@Base 6.1.20110713
+ ProductPosAsnRead@Base 6.1.20061015
+ ProductPosAsnWrite@Base 6.1.20061015
+ ProductPosFree@Base 6.1.20061015
+ ProductUpdateTableFree@Base 6.1.20110713
+ ProductsMatchForRefSeq@Base 6.1.20110713
+ ProgramIdAsnRead@Base 6.1.20110713
+ ProgramIdAsnWrite@Base 6.1.20110713
+ ProgramIdFree@Base 6.1.20110713
+ ProgramIdNew@Base 6.1.20110713
+ ProjdescAsnRead@Base 6.1.20030421
+ ProjdescAsnWrite@Base 6.1.20030421
+ ProjdescFree@Base 6.1.20030421
+ ProjectAsnRead@Base 6.1.20030421
+ ProjectAsnWrite@Base 6.1.20030421
+ ProjectDescrAsnRead@Base 6.1.20030421
+ ProjectDescrAsnWrite@Base 6.1.20030421
+ ProjectDescrFree@Base 6.1.20030421
+ ProjectDescrNew@Base 6.1.20030421
+ ProjectFree@Base 6.1.20030421
+ ProjectItemAsnRead@Base 6.1.20030421
+ ProjectItemAsnWrite@Base 6.1.20030421
+ ProjectItemFree@Base 6.1.20030421
+ ProjectNew@Base 6.1.20030421
+ PromoteAllToBestID@Base 6.1.20120620
+ PromoteAllToWorstID@Base 6.1.20120620
+ PromoteCommonTitlesToSet@Base 6.1.20100808
+ PromoteXrefs@Base 6.1.20030421
+ PromoteXrefsEx@Base 6.1.20030421
+ PromoteXrefsExEx@Base 6.1.20041020
+ PropagateDblinkDescriptors@Base 6.1.20120620
+ PropagateFeatureByApply@Base 6.1.20030421
+ PropagateFeatureBySeqLock@Base 6.1.20030421
+ PropagateMissingOldNames@Base 6.1.20120620
+ PropagateSomeDescriptors@Base 6.1.20120620
+ PropagateStrandInfo@Base 6.1.20030421
+ PropagateThisDescriptor@Base 6.1.20160908
+ ProtPosAsnRead@Base 6.1.20061015
+ ProtPosAsnWrite@Base 6.1.20061015
+ ProtPosFree@Base 6.1.20061015
+ ProtPosNew@Base 6.1.20061015
+ ProtRefAsnRead@Base 6.1.20030421
+ ProtRefAsnWrite@Base 6.1.20030421
+ ProtRefDup@Base 6.1.20030421
+ ProtRefFree@Base 6.1.20030421
+ ProtRefMatch@Base 6.1.20081116
+ ProtRefNew@Base 6.1.20030421
+ ProtSearchAddProteinPattern@Base 6.1.20061015
+ ProtSearchFree@Base 6.1.20061015
+ ProtSearchNew@Base 6.1.20061015
+ ProtSearchProcessBioseq@Base 6.1.20061015
+ ProtSearchProcessCharacter@Base 6.1.20061015
+ ProtSearchReset@Base 6.1.20061015
+ ProteinFromCdRegion@Base 6.1.20030421
+ ProteinFromCdRegionEx@Base 6.1.20030421
+ ProteinFromCdRegionExEx@Base 6.1.20040505
+ ProteinFromCdRegionExWithTrailingCodonHandling@Base 6.1.20040204
+ PssmAsnRead@Base 6.1.20070822
+ PssmAsnWrite@Base 6.1.20070822
+ PssmFinalDataAsnRead@Base 6.1.20070822
+ PssmFinalDataAsnWrite@Base 6.1.20070822
+ PssmFinalDataFree@Base 6.1.20070822
+ PssmFinalDataNew@Base 6.1.20070822
+ PssmFree@Base 6.1.20070822
+ PssmIntermediateDataAsnRead@Base 6.1.20070822
+ PssmIntermediateDataAsnWrite@Base 6.1.20070822
+ PssmIntermediateDataFree@Base 6.1.20070822
+ PssmIntermediateDataNew@Base 6.1.20070822
+ PssmNew@Base 6.1.20070822
+ PssmParametersAsnRead@Base 6.1.20070822
+ PssmParametersAsnWrite@Base 6.1.20070822
+ PssmParametersFree@Base 6.1.20070822
+ PssmParametersNew@Base 6.1.20070822
+ PssmWithParametersAsnRead@Base 6.1.20070822
+ PssmWithParametersAsnWrite@Base 6.1.20070822
+ PssmWithParametersFree@Base 6.1.20070822
+ PssmWithParametersNew@Base 6.1.20070822
+ PubAsnLoad@Base 6.1.20030421
+ PubAsnRead@Base 6.1.20030421
+ PubAsnWrite@Base 6.1.20030421
+ PubEquivAsnRead@Base 6.1.20030421
+ PubEquivAsnWrite@Base 6.1.20030421
+ PubEquivFree@Base 6.1.20030421
+ PubEquivMatch@Base 6.1.20030421
+ PubFieldConstraintAsnRead@Base 6.1.20081116
+ PubFieldConstraintAsnWrite@Base 6.1.20081116
+ PubFieldConstraintFree@Base 6.1.20081116
+ PubFieldConstraintNew@Base 6.1.20081116
+ PubFieldSpecialConstraintAsnRead@Base 6.1.20100808
+ PubFieldSpecialConstraintAsnWrite@Base 6.1.20100808
+ PubFieldSpecialConstraintFree@Base 6.1.20100808
+ PubFieldSpecialConstraintNew@Base 6.1.20100808
+ PubFieldSpecialConstraintTypeAsnRead@Base 6.1.20100808
+ PubFieldSpecialConstraintTypeAsnWrite@Base 6.1.20100808
+ PubFieldSpecialConstraintTypeFree@Base 6.1.20100808
+ PubFree@Base 6.1.20030421
+ PubIsEffectivelyEmpty@Base 6.1.20080302
+ PubLabel@Base 6.1.20030421
+ PubLabelMatch@Base 6.1.20030421
+ PubLabelUnique@Base 6.1.20030421
+ PubMatch@Base 6.1.20030421
+ PubMedAsynchronousQuery@Base 6.1.20030421
+ PubMedCheckQueue@Base 6.1.20030421
+ PubMedFetchDisable@Base 6.1.20031028
+ PubMedFetchEnable@Base 6.1.20031028
+ PubMedFetchOpenConnection@Base 6.1.20030421
+ PubMedReadReply@Base 6.1.20030421
+ PubMedSetFetchFunc@Base 6.1.20031028
+ PubMedSynchronousQuery@Base 6.1.20030421
+ PubMedWaitForReply@Base 6.1.20030421
+ PubSeqAsynchronousQuery@Base 6.1.20030421
+ PubSeqCheckQueue@Base 6.1.20030421
+ PubSeqFetchDisable@Base 6.1.20030421
+ PubSeqFetchEnable@Base 6.1.20030421
+ PubSeqFetchEnableEx@Base 6.1.20061015
+ PubSeqFetchOpenConnection@Base 6.1.20030421
+ PubSeqFetchOpenConnectionString@Base 6.1.20120620
+ PubSeqFetchSRAOpenConnection@Base 6.1.20090719
+ PubSeqFetchTraceOpenConnection@Base 6.1.20080302
+ PubSeqReadReply@Base 6.1.20030421
+ PubSeqSynchronousQuery@Base 6.1.20030421
+ PubSeqSynchronousQueryEx@Base 6.1.20120620
+ PubSeqSynchronousQueryId@Base 6.1.20120620
+ PubSeqSynchronousQuerySRA@Base 6.1.20090719
+ PubSeqSynchronousQueryString@Base 6.1.20120620
+ PubSeqSynchronousQueryTI@Base 6.1.20080302
+ PubSeqWaitForReply@Base 6.1.20030421
+ PubSerialNumberListFree@Base 6.1.20090301
+ PubSetAsnRead@Base 6.1.20030421
+ PubSetAsnWrite@Base 6.1.20030421
+ PubSetFree@Base 6.1.20030421
+ PubSetLabel@Base 6.1.20030421
+ PubStatusDateAsnRead@Base 6.1.20030421
+ PubStatusDateAsnWrite@Base 6.1.20030421
+ PubStatusDateFree@Base 6.1.20030421
+ PubStatusDateNew@Base 6.1.20030421
+ PubdescAsnRead@Base 6.1.20030421
+ PubdescAsnWrite@Base 6.1.20030421
+ PubdescContentMatch@Base 6.1.20060301
+ PubdescFree@Base 6.1.20030421
+ PubdescNew@Base 6.1.20030421
+ PublicationConstraintAsnRead@Base 6.1.20081116
+ PublicationConstraintAsnWrite@Base 6.1.20081116
+ PublicationConstraintFree@Base 6.1.20081116
+ PublicationConstraintNew@Base 6.1.20081116
+ PubmedEntryAsnRead@Base 6.1.20030421
+ PubmedEntryAsnWrite@Base 6.1.20030421
+ PubmedEntryFree@Base 6.1.20030421
+ PubmedEntryNew@Base 6.1.20030421
+ PubmedEntryToAbsFile@Base 6.1.20031028
+ PubmedEntryToDataFile@Base 6.1.20031028
+ PubmedEntryToDocFile@Base 6.1.20031028
+ PubmedUrlAsnRead@Base 6.1.20030421
+ PubmedUrlAsnWrite@Base 6.1.20030421
+ PubmedUrlFree@Base 6.1.20030421
+ PubmedUrlNew@Base 6.1.20030421
+ QBBioseqToFasta@Base 6.1.20030421
+ QBlastAsynchronousRequest@Base 6.1.20030421
+ QBlastCheckQueue@Base 6.1.20030421
+ QBlastCheckRequest@Base 6.1.20030421
+ QBlastCloseQueue@Base 6.1.20030421
+ QBlastOpenConnection@Base 6.1.20030421
+ QBlastWaitForReply@Base 6.1.20030421
+ QualLocCreate@Base 6.1.20030421
+ QualLocWrite@Base 6.1.20030421
+ QuantityConstraintAsnRead@Base 6.1.20100808
+ QuantityConstraintAsnWrite@Base 6.1.20100808
+ QuantityConstraintFree@Base 6.1.20100808
+ RDBTaxNamesClone@Base 6.1.20030421
+ RDBTaxNamesFree@Base 6.1.20030421
+ RID_glb@Base 6.1.20030421
+ RNAGenAsnRead@Base 6.1.20081116
+ RNAGenAsnWrite@Base 6.1.20081116
+ RNAGenFree@Base 6.1.20081116
+ RNAGenNew@Base 6.1.20081116
+ RNAQualAsnRead@Base 6.1.20081116
+ RNAQualAsnWrite@Base 6.1.20081116
+ RNAQualFree@Base 6.1.20081116
+ RNAQualNew@Base 6.1.20081116
+ RNAQualSetAsnRead@Base 6.1.20081116
+ RNAQualSetAsnWrite@Base 6.1.20081116
+ RNAQualSetFree@Base 6.1.20081116
+ ReMapIntFuzz@Base 6.1.20030421
+ ReadACEFile@Base 6.1.20081116
+ ReadAlignFileLine@Base 6.1.20030421
+ ReadAlignmentFile2@Base 6.1.20120620
+ ReadAlignmentFile@Base 6.1.20040204
+ ReadAlignmentFileEx2@Base 6.1.20120620
+ ReadAlignmentFileEx@Base 6.1.20051206
+ ReadAsnFastaOrFlatFile@Base 6.1.20030421
+ ReadAsnFastaOrFlatFileEx@Base 6.1.20051206
+ ReadAssemblyFile@Base 6.1.20081116
+ ReadBufferFromSap@Base 6.1.20030421
+ ReadBufferFromSep@Base 6.1.20030421
+ ReadCodingRegionBases@Base 6.1.20030421
+ ReadCompletenessFromString@Base 6.1.20060301
+ ReadContigFromString@Base 6.1.20081116
+ ReadContigList@Base 6.1.20030421
+ ReadContigListEx@Base 6.1.20030421
+ ReadDeltaFasta@Base 6.1.20050429
+ ReadDeltaFastaEx@Base 6.1.20051206
+ ReadDeltaFastaExEx@Base 6.1.20160908
+ ReadDeltaFastaWithEmptyDefline@Base 6.1.20050828
+ ReadDiscrepancyConfig@Base 6.1.20070822
+ ReadDiscrepancyConfigEx@Base 6.1.20081116
+ ReadElandStandaloneFile@Base 6.1.20081116
+ ReadFastaOnly@Base 6.1.20051206
+ ReadFeatureTableFile@Base 6.1.20070822
+ ReadFilteredAsn@Base 6.1.20100808
+ ReadFromElandMostCompressed@Base 6.1.20081116
+ ReadFromElandSanger@Base 6.1.20081116
+ ReadFromElandStandalone@Base 6.1.20081116
+ ReadFromMAQString@Base 6.1.20081116
+ ReadMAQFile@Base 6.1.20081116
+ ReadNameListFromString@Base 6.1.20160908
+ ReadNumberFromToken@Base 6.1.20081116
+ ReadOneColumnList@Base 6.1.20100808
+ ReadPhrapFile@Base 6.1.20030421
+ ReadPhrapQuality@Base 6.1.20030421
+ ReadPhrapQualityFC@Base 6.1.20050828
+ ReadProductUpdateTable@Base 6.1.20110713
+ ReadSeqIdPairListFromFile@Base 6.1.20081116
+ ReadSequenceAsnFile@Base 6.1.20090719
+ ReadTabTableFromFile@Base 6.1.20080302
+ ReadTechFromString@Base 6.1.20050828
+ RearrangeSegments@Base 6.1.20030421
+ ReassignFeatureIDs@Base 6.1.20060507
+ RebuildDNA_4na@Base 6.1.20030421
+ RecalculateConsensusSequences@Base 6.1.20081116
+ RecordInSeqIdGiCache@Base 6.1.20030421
+ ReformatAssemblyDate@Base 6.1.20160908
+ ReformatDateStringEx@Base 6.1.20081116
+ ReformatDateWithMonthNames@Base 6.1.20110713
+ RefreshGeneData@Base 6.1.20030421
+ RegenerateAutoDef@Base 6.1.20160908
+ RegionTypeAsnRead@Base 6.1.20081116
+ RegionTypeAsnWrite@Base 6.1.20081116
+ RegionTypeFree@Base 6.1.20081116
+ RegionTypeNew@Base 6.1.20081116
+ RegulatoryOTHER@Base 6.1.20160908
+ ReintegrateFilteredAsn@Base 6.1.20100808
+ RelaxedSeqIdIn@Base 6.1.20120620
+ RemoveActionAsnRead@Base 6.1.20080302
+ RemoveActionAsnWrite@Base 6.1.20080302
+ RemoveActionFree@Base 6.1.20080302
+ RemoveActionNew@Base 6.1.20080302
+ RemoveAlignmentsWithElementsOfSet@Base 6.1.20160908
+ RemoveAlignmentsWithSequence@Base 6.1.20120620
+ RemoveAllNcbiCleanupUserObjects@Base 6.1.20090719
+ RemoveAllSeqAnnotCleanupUserObjs@Base 6.1.20100808
+ RemoveAllStructuredCommentKeywords@Base 6.1.20160908
+ RemoveAllVersionLocusGIFromID@Base 6.1.20120620
+ RemoveAutodefObjects@Base 6.1.20160908
+ RemoveAutodefObjectsForDesc@Base 6.1.20160908
+ RemoveBadCodonRecognizedInSeqEntry@Base 6.1.20110713
+ RemoveBadInstitutionCollection@Base 6.1.20160908
+ RemoveBadInstitutionCountry@Base 6.1.20160908
+ RemoveBarcodeKeywordFromBioseq@Base 6.1.20110713
+ RemoveBarcodeKeywords@Base 6.1.20070822
+ RemoveBarcodeKeywordsFromObjectList@Base 6.1.20100808
+ RemoveBarcodeTech@Base 6.1.20090719
+ RemoveBarcodeTechFromBioseq@Base 6.1.20110713
+ RemoveConsortiumFromPub@Base 6.1.20090719
+ RemoveConsortiums@Base 6.1.20090719
+ RemoveCultureNotes@Base 6.1.20110713
+ RemoveDBxrefForBioSource@Base 6.1.20100808
+ RemoveDescriptorActionAsnRead@Base 6.1.20090301
+ RemoveDescriptorActionAsnWrite@Base 6.1.20090301
+ RemoveDescriptorActionFree@Base 6.1.20090301
+ RemoveDescriptorActionNew@Base 6.1.20090301
+ RemoveDuplicateFeatureActionAsnRead@Base 6.1.20110713
+ RemoveDuplicateFeatureActionAsnWrite@Base 6.1.20110713
+ RemoveDuplicateFeatureActionFree@Base 6.1.20110713
+ RemoveDuplicateFeatureActionNew@Base 6.1.20110713
+ RemoveDuplicateFeaturesInList@Base 6.1.20110713
+ RemoveDuplicateFeaturesInSeqEntry@Base 6.1.20110713
+ RemoveDuplicateItems@Base 6.1.20081116
+ RemoveDuplicateNestedSetsForEntityID@Base 6.1.20100808
+ RemoveDuplicateNestedSetsForEntityIDNoUpdate@Base 6.1.20120620
+ RemoveDuplicateStructuredCommentsInSeqEntry@Base 6.1.20160908
+ RemoveEmptyStructuredComments@Base 6.1.20160908
+ RemoveExonsOnMrna@Base 6.1.20100808
+ RemoveFeatureActionAsnRead@Base 6.1.20080302
+ RemoveFeatureActionAsnWrite@Base 6.1.20080302
+ RemoveFeatureActionFree@Base 6.1.20080302
+ RemoveFeatureActionNew@Base 6.1.20080302
+ RemoveFeatureLink@Base 6.1.20110713
+ RemoveGBQualMatch@Base 6.1.20120620
+ RemoveGapCharsFromSequenceString@Base 6.1.20081116
+ RemoveMRnaTitles@Base 6.1.20110713
+ RemoveNcbiAutofixUserObjects@Base 6.1.20110713
+ RemoveNucProtSetTitles@Base 6.1.20080302
+ RemoveOneSequenceFromAlignment@Base 6.1.20120620
+ RemoveOutsideActionAsnRead@Base 6.1.20120620
+ RemoveOutsideActionAsnWrite@Base 6.1.20120620
+ RemoveOutsideActionFree@Base 6.1.20120620
+ RemoveOutsideActionNew@Base 6.1.20120620
+ RemovePopsetTitles@Base 6.1.20100808
+ RemoveProteinTitles@Base 6.1.20100808
+ RemoveQualFromFeature@Base 6.1.20100808
+ RemoveQualityScores@Base 6.1.20120620
+ RemoveQuotesFromTabTable@Base 6.1.20081116
+ RemoveRNAProductString@Base 6.1.20100808
+ RemoveRNAQualFromFeature@Base 6.1.20110713
+ RemoveSegGapsInSeqEntry@Base 6.1.20100808
+ RemoveSeqEntryFromSeqEntry@Base 6.1.20030421
+ RemoveSequenceFromAlignments@Base 6.1.20050429
+ RemoveSequencesActionAsnRead@Base 6.1.20120620
+ RemoveSequencesActionAsnWrite@Base 6.1.20120620
+ RemoveSequencesActionFree@Base 6.1.20120620
+ RemoveSequencesActionNew@Base 6.1.20120620
+ RemoveSequencesWithoutUpdates@Base 6.1.20120620
+ RemoveSingleItemSet@Base 6.1.20120620
+ RemoveSourceQualFromBioSource@Base 6.1.20081116
+ RemoveSpeciesSpecific@Base 6.1.20160908
+ RemoveStringConstraintPortionFromString@Base 6.1.20081116
+ RemoveStructuredCommentKeywords@Base 6.1.20100808
+ RemoveTaxRef@Base 6.1.20080302
+ RemoveTextPortionFromString@Base 6.1.20100808
+ RemoveUnnecessaryGeneXrefs@Base 6.1.20110713
+ RemoveUnverifiedUserObjects@Base 6.1.20110713
+ RemoveValNodeStringMatch@Base 6.1.20090719
+ RemoveXrefsActionAsnRead@Base 6.1.20110713
+ RemoveXrefsActionAsnWrite@Base 6.1.20110713
+ RemoveXrefsActionFree@Base 6.1.20110713
+ RemoveXrefsActionNew@Base 6.1.20110713
+ RenormalizeNucProtSets@Base 6.1.20030421
+ ReorderStructuredCommentFields@Base 6.1.20120620
+ ReorderStructuredCommentsInSeqEntry@Base 6.1.20160908
+ ReparseTabTableConvertFirstSpaceToTab@Base 6.1.20100808
+ ReparseTabTableConvertMultiSpaceToTab@Base 6.1.20100808
+ ReparseTabTableSeparateColumnAtDelimiter@Base 6.1.20110713
+ ReplaceBioSourceAndPubs@Base 6.1.20030421
+ ReplaceCollidingUpdateIDs@Base 6.1.20120620
+ ReplaceComplexLocation@Base 6.1.20120620
+ ReplaceConsensusSequenceFromTraces@Base 6.1.20081116
+ ReplaceDataForProc@Base 6.1.20030421
+ ReplaceDefinitionLine@Base 6.1.20100808
+ ReplaceDiscrepancyItemWithFeatureTableStrings@Base 6.1.20080302
+ ReplaceFakeIDWithIDFromTitle@Base 6.1.20120620
+ ReplaceFuncAsnRead@Base 6.1.20110713
+ ReplaceFuncAsnWrite@Base 6.1.20110713
+ ReplaceFuncFree@Base 6.1.20110713
+ ReplaceOneSequence@Base 6.1.20120620
+ ReplaceRuleAsnRead@Base 6.1.20110713
+ ReplaceRuleAsnWrite@Base 6.1.20110713
+ ReplaceRuleFree@Base 6.1.20110713
+ ReplaceRuleNew@Base 6.1.20110713
+ ReplaceSeqAlignInSeqEntry@Base 6.1.20030421
+ ReplaceSeqEntryWithSeqEntry@Base 6.1.20030421
+ ReplaceSeqIdWithSeqId@Base 6.1.20081116
+ ReplaceSeqIdWithSeqIdInFeat@Base 6.1.20100808
+ ReplaceStopsWithSelenocysteineInSeqEntry@Base 6.1.20160908
+ ReplaceStringConstraintPortionInString@Base 6.1.20110713
+ ReportBadLocusTagFormat@Base 6.1.20080302
+ ReportCoverageForBioseqSeqHist@Base 6.1.20081116
+ ReportInconsistentGlobalDiscrepancyPrefixes@Base 6.1.20080302
+ ReportInconsistentGlobalDiscrepancyStrings@Base 6.1.20080302
+ ReportMissingFields@Base 6.1.20080302
+ ReportNonUniqueGlobalDiscrepancy@Base 6.1.20080302
+ ReportPrint@Base 6.1.20030421
+ ReportProductNameProblems@Base 6.1.20110713
+ ResetCapitalization@Base 6.1.20080302
+ ResetSeqFeatInterval@Base 6.1.20030421
+ ResolveExistingIDsCallback@Base 6.1.20120620
+ RestoreSeqEntryObjMgrData@Base 6.1.20030421
+ ResynchCDSPartials@Base 6.1.20030421
+ ResynchCodingRegionPartials@Base 6.1.20030421
+ ResynchCodingRegionPartialsEx@Base 6.1.20100808
+ ResynchMRNAPartials@Base 6.1.20030421
+ ResynchMessengerRNAPartials@Base 6.1.20030421
+ ResynchPeptidePartials@Base 6.1.20031028
+ ResynchProteinPartials@Base 6.1.20031028
+ RetranslateCdsActionAsnRead@Base 6.1.20160908
+ RetranslateCdsActionAsnWrite@Base 6.1.20160908
+ RetranslateCdsActionFree@Base 6.1.20160908
+ RetranslateCdsActionNew@Base 6.1.20160908
+ RetranslateOneCDS@Base 6.1.20090301
+ RevCompBioseqList@Base 6.1.20120620
+ RevCompFeats@Base 6.1.20110713
+ RevCompOneFeatForBioseq@Base 6.1.20081116
+ ReverseAlignmentStrand@Base 6.1.20081116
+ ReverseBioseqInAlignment@Base 6.1.20120620
+ ReverseQualityScores@Base 6.1.20100808
+ ReverseSeqData@Base 6.1.20080302
+ ReverseSeqGraph@Base 6.1.20100808
+ RnaFeatTypeAsnRead@Base 6.1.20081116
+ RnaFeatTypeAsnWrite@Base 6.1.20081116
+ RnaFeatTypeFree@Base 6.1.20081116
+ RnaQualAsnRead@Base 6.1.20081116
+ RnaQualAsnWrite@Base 6.1.20081116
+ RnaQualFree@Base 6.1.20081116
+ RnaQualFromFeatureField@Base 6.1.20081116
+ RnaQualNew@Base 6.1.20081116
+ RnaQualPairAsnRead@Base 6.1.20081116
+ RnaQualPairAsnWrite@Base 6.1.20081116
+ RnaQualPairFree@Base 6.1.20081116
+ RnaQualPairNew@Base 6.1.20081116
+ RnaRefAsnRead@Base 6.1.20030421
+ RnaRefAsnWrite@Base 6.1.20030421
+ RnaRefFree@Base 6.1.20030421
+ RnaRefFromLabel@Base 6.1.20081116
+ RnaRefNew@Base 6.1.20030421
+ RnaTypeFromFeatdef@Base 6.1.20081116
+ RowSourceFree@Base 6.1.20030421
+ RowSourceNew@Base 6.1.20030421
+ RsiteRefAsnRead@Base 6.1.20030421
+ RsiteRefAsnWrite@Base 6.1.20030421
+ RsiteRefFree@Base 6.1.20030421
+ SAClearMove@Base 6.1.20030421
+ SAIndex2Free2@Base 6.1.20030421
+ SAIndexFree@Base 6.1.20030421
+ SAIndexNew@Base 6.1.20030421
+ SAM_Add2SeqAlign@Base 6.1.20030421
+ SAM_AlignIdComp@Base 6.1.20030421
+ SAM_AlignIdCompare@Base 6.1.20030421
+ SAM_AlignIdDup@Base 6.1.20030421
+ SAM_AlignIdDupList@Base 6.1.20030421
+ SAM_AlignIdIn@Base 6.1.20030421
+ SAM_ExtractSips@Base 6.1.20030421
+ SAM_FreeSeqIdSet@Base 6.1.20030421
+ SAM_InRange@Base 6.1.20030421
+ SAM_LexicalComp@Base 6.1.20030421
+ SAM_MakeTemp@Base 6.1.20030421
+ SAM_MakeViewerFree@Base 6.1.20030421
+ SAM_NewDenseSeg@Base 6.1.20030421
+ SAM_NewSeqAlign@Base 6.1.20030421
+ SAM_OrderSeqID@Base 6.1.20030421
+ SAM_OrderSeqIDChain@Base 6.1.20030421
+ SAM_RangeOverlap@Base 6.1.20030421
+ SAM_ReplaceGI@Base 6.1.20030421
+ SAM_SeqAlignExtract@Base 6.1.20030421
+ SAM_SeqIdCompareAll@Base 6.1.20030421
+ SAM_SeqIdFromSeqLoc@Base 6.1.20030421
+ SAM_ValNodeByPosition@Base 6.1.20030421
+ SAM_ValNodeExtract@Base 6.1.20030421
+ SAM_ValNodePut@Base 6.1.20030421
+ SAMergeBlocks@Base 6.1.20030421
+ SARegionBounds@Base 6.1.20030421
+ SARemoveSequence@Base 6.1.20030421
+ SAReturnBlock@Base 6.1.20030421
+ SAReturnSegment@Base 6.1.20030421
+ SASeqDatFree@Base 6.1.20030421
+ SASeqDatNew@Base 6.1.20030421
+ SASplitBlock@Base 6.1.20030421
+ SATraverse@Base 6.1.20030421
+ SATraverseBlock@Base 6.1.20030421
+ SPBlockAsnRead@Base 6.1.20030421
+ SPBlockAsnWrite@Base 6.1.20030421
+ SPBlockFree@Base 6.1.20030421
+ SPBlockNew@Base 6.1.20030421
+ SPCompressDNA@Base 6.1.20030421
+ SPCompressFree@Base 6.1.20030421
+ SPCompressNew@Base 6.1.20030421
+ SPRebuildDNA@Base 6.1.20030421
+ SUnculturedLen@Base 6.1.20160908
+ S_atoms@Base 6.1.20030421
+ Safe_seqid_to_string@Base 6.1.20160908
+ SalpStatsInputBlockFree@Base 6.1.20030421
+ SalpStatsInputBlockNew@Base 6.1.20030421
+ SalpStatsResultsFree@Base 6.1.20030421
+ SalpStatsResultsNew@Base 6.1.20030421
+ SaveDiscrepancyConfig@Base 6.1.20070822
+ SaveDiscrepancyConfigEx@Base 6.1.20100808
+ SaveNoteToCharPtrStack@Base 6.1.20030421
+ SaveSeqEntryObjMgrData@Base 6.1.20030421
+ Saved_ch@Base 6.1.20030421
+ ScanBioseqSetRelease@Base 6.1.20030421
+ ScanBioseqSetReleaseMT@Base 6.1.20090719
+ ScanEmbedQual@Base 6.1.20030421
+ ScanEntrezgeneSetRelease@Base 6.1.20050429
+ ScanTabTableForSpecialCharacters@Base 6.1.20080302
+ ScoreAdd@Base 6.1.20030421
+ ScoreAndEvalueToBuffers@Base 6.1.20040616
+ ScoreDup@Base 6.1.20030421
+ ScoreDupAdd@Base 6.1.20030421
+ ScoreNew@Base 6.1.20030421
+ ScorePtrUseThisGi@Base 6.1.20030421
+ ScoreRead@Base 6.1.20030421
+ ScoreSetAsnRead@Base 6.1.20030421
+ ScoreSetAsnWrite@Base 6.1.20030421
+ ScoreSetFree@Base 6.1.20030421
+ Se_atoms@Base 6.1.20030421
+ SearchFuncAsnRead@Base 6.1.20110713
+ SearchFuncAsnWrite@Base 6.1.20110713
+ SearchFuncFree@Base 6.1.20110713
+ SegHasParts@Base 6.1.20050828
+ SegLocToParts@Base 6.1.20030421
+ SegLocToPartsEx@Base 6.1.20030421
+ SegOrDeltaBioseqToRaw@Base 6.1.20030421
+ SegregateSetsByBioseqList@Base 6.1.20120620
+ SegregateSetsByFungusGroup@Base 6.1.20120620
+ SegregateSetsByNumber@Base 6.1.20100808
+ SegregateSetsByNumberPerSet@Base 6.1.20100808
+ SegregateSetsByPlantGroup@Base 6.1.20120620
+ SelEdStructAdd@Base 6.1.20030421
+ SelEdStructDel@Base 6.1.20030421
+ SelEdStructDup@Base 6.1.20030421
+ SelEdStructListDel@Base 6.1.20030421
+ SelStructAdd@Base 6.1.20030421
+ SelStructCpy@Base 6.1.20030421
+ SelStructDel@Base 6.1.20030421
+ SelStructDelList@Base 6.1.20030421
+ SelStructDup@Base 6.1.20030421
+ SelStructNew@Base 6.1.20030421
+ SelectBestPub@Base 6.1.20030421
+ SelectLongestSeqAlign@Base 6.1.20030421
+ SelectType@Base 6.1.20030421
+ SendTextToFile@Base 6.1.20030421
+ SeqAlignAddInSeqEntry@Base 6.1.20030421
+ SeqAlignAlignability@Base 6.1.20030421
+ SeqAlignAsnLoad@Base 6.1.20030421
+ SeqAlignAsnRead@Base 6.1.20030421
+ SeqAlignAsnWrite@Base 6.1.20030421
+ SeqAlignBestScore@Base 6.1.20030421
+ SeqAlignBioseqDeleteById@Base 6.1.20030421
+ SeqAlignBioseqDeleteByIdFromSeqEntry@Base 6.1.20030421
+ SeqAlignBioseqsOrder@Base 6.1.20030421
+ SeqAlignBoolSegCpy@Base 6.1.20030421
+ SeqAlignBoolSegToDenseSeg@Base 6.1.20030421
+ SeqAlignConsistentOverlap@Base 6.1.20030421
+ SeqAlignConvertDspToDdpList@Base 6.1.20030421
+ SeqAlignCount@Base 6.1.20030421
+ SeqAlignCountMismatches@Base 6.1.20030421
+ SeqAlignCountSegs@Base 6.1.20030421
+ SeqAlignDeleteByLoc@Base 6.1.20030421
+ SeqAlignDeleteByLocCallback@Base 6.1.20051206
+ SeqAlignDenseSegToBoolSeg@Base 6.1.20030421
+ SeqAlignDup@Base 6.1.20030421
+ SeqAlignDupAdd@Base 6.1.20030421
+ SeqAlignDupRegion@Base 6.1.20030421
+ SeqAlignEndExtend@Base 6.1.20030421
+ SeqAlignExtend@Base 6.1.20030421
+ SeqAlignExtractByIds@Base 6.1.20030421
+ SeqAlignFilterByCoverage@Base 6.1.20030421
+ SeqAlignFindSeqId@Base 6.1.20030421
+ SeqAlignFree@Base 6.1.20030421
+ SeqAlignGapCount@Base 6.1.20030421
+ SeqAlignGapList@Base 6.1.20030421
+ SeqAlignIDCache@Base 6.1.20030421
+ SeqAlignIDList@Base 6.1.20030421
+ SeqAlignIDUncache@Base 6.1.20030421
+ SeqAlignIDUncacheAll@Base 6.1.20030421
+ SeqAlignId@Base 6.1.20030421
+ SeqAlignIdReplace@Base 6.1.20030421
+ SeqAlignIndexFree@Base 6.1.20030421
+ SeqAlignIndexNew@Base 6.1.20030421
+ SeqAlignInsertByLoc@Base 6.1.20060301
+ SeqAlignLabel@Base 6.1.20030421
+ SeqAlignLength@Base 6.1.20030421
+ SeqAlignLengthForId@Base 6.1.20030421
+ SeqAlignLink@Base 6.1.20030421
+ SeqAlignListCountMismatches@Base 6.1.20030421
+ SeqAlignListDup@Base 6.1.20030421
+ SeqAlignListFree@Base 6.1.20030421
+ SeqAlignListGapList@Base 6.1.20030421
+ SeqAlignListGlobalStats@Base 6.1.20030421
+ SeqAlignListLongestSegment@Base 6.1.20030421
+ SeqAlignListMergeAll@Base 6.1.20030421
+ SeqAlignListReverseStrand@Base 6.1.20030421
+ SeqAlignListStartStop@Base 6.1.20030421
+ SeqAlignLongestFN@Base 6.1.20030421
+ SeqAlignLongestSegment@Base 6.1.20030421
+ SeqAlignMapOnFirstSeq@Base 6.1.20030421
+ SeqAlignMerge@Base 6.1.20030421
+ SeqAlignMolType@Base 6.1.20030421
+ SeqAlignNew@Base 6.1.20030421
+ SeqAlignNonOverlap@Base 6.1.20030421
+ SeqAlignNonRedundant@Base 6.1.20030421
+ SeqAlignOverlapLen@Base 6.1.20030421
+ SeqAlignOverlapLenByLoc@Base 6.1.20030421
+ SeqAlignPrint@Base 6.1.20030421
+ SeqAlignReplaceId@Base 6.1.20030421
+ SeqAlignReverse@Base 6.1.20030421
+ SeqAlignSameIdMerge@Base 6.1.20030421
+ SeqAlignScoreFix@Base 6.1.20030421
+ SeqAlignScorePtrGet@Base 6.1.20030421
+ SeqAlignScoreRead@Base 6.1.20030421
+ SeqAlignSeqLocComp@Base 6.1.20030421
+ SeqAlignSetAsnRead@Base 6.1.20030421
+ SeqAlignSetAsnWrite@Base 6.1.20030421
+ SeqAlignSetFree@Base 6.1.20030421
+ SeqAlignSetNew@Base 6.1.20030421
+ SeqAlignSimpleStats@Base 6.1.20030421
+ SeqAlignSort@Base 6.1.20030421
+ SeqAlignSortByEvalue@Base 6.1.20030421
+ SeqAlignSortByLength@Base 6.1.20030421
+ SeqAlignSortByRegion@Base 6.1.20030421
+ SeqAlignSortByScore@Base 6.1.20030421
+ SeqAlignSortByStart@Base 6.1.20030421
+ SeqAlignStart@Base 6.1.20030421
+ SeqAlignStartStop@Base 6.1.20030421
+ SeqAlignStartStopById@Base 6.1.20030421
+ SeqAlignStartStopOverlap@Base 6.1.20030421
+ SeqAlignStats@Base 6.1.20030421
+ SeqAlignStop@Base 6.1.20030421
+ SeqAlignStrand@Base 6.1.20030421
+ SeqAlignSwapOrder@Base 6.1.20030421
+ SeqAlignToBS@Base 6.1.20030421
+ SeqAlignTrunc2@Base 6.1.20030421
+ SeqAlignTrunc@Base 6.1.20030421
+ SeqAlignWindowScore@Base 6.1.20030421
+ SeqAlignWindowScoreFN@Base 6.1.20030421
+ SeqAlignWindowStats@Base 6.1.20030421
+ SeqAlignWrite@Base 6.1.20030421
+ SeqAnnotAsnRead@Base 6.1.20030421
+ SeqAnnotAsnWrite@Base 6.1.20030421
+ SeqAnnotBoolSegToDenseSeg@Base 6.1.20030421
+ SeqAnnotDenseSegToBoolSeg@Base 6.1.20030421
+ SeqAnnotForSeqAlign@Base 6.1.20030421
+ SeqAnnotFree@Base 6.1.20030421
+ SeqAnnotLabel@Base 6.1.20030421
+ SeqAnnotMerge@Base 6.1.20030421
+ SeqAnnotNew@Base 6.1.20030421
+ SeqAnnotSetAsnRead@Base 6.1.20030421
+ SeqAnnotSetAsnWrite@Base 6.1.20030421
+ SeqAnnotSetExtraCheck@Base 6.1.20030421
+ SeqAsnLoad@Base 6.1.20030421
+ SeqBlockAsnLoad@Base 6.1.20030421
+ SeqBondAsnRead@Base 6.1.20030421
+ SeqBondAsnWrite@Base 6.1.20030421
+ SeqBondFree@Base 6.1.20030421
+ SeqBondNew@Base 6.1.20030421
+ SeqCodeAsnLoad@Base 6.1.20030421
+ SeqCodeSetAsnRead@Base 6.1.20030421
+ SeqCodeSetAsnWrite@Base 6.1.20030421
+ SeqCodeSetFree@Base 6.1.20030421
+ SeqCodeSetLoad@Base 6.1.20030421
+ SeqCodeSetNew@Base 6.1.20030421
+ SeqCodeTableAsnRead@Base 6.1.20030421
+ SeqCodeTableAsnWrite@Base 6.1.20030421
+ SeqCodeTableComp@Base 6.1.20030421
+ SeqCodeTableFind@Base 6.1.20030421
+ SeqCodeTableFindObj@Base 6.1.20030421
+ SeqCodeTableFree@Base 6.1.20030421
+ SeqCodeTableNew@Base 6.1.20030421
+ SeqCoordToAlignCoord@Base 6.1.20030421
+ SeqDataAsnRead@Base 6.1.20030421
+ SeqDataAsnWrite@Base 6.1.20030421
+ SeqDataAsnWriteXML@Base 6.1.20050429
+ SeqDataFree@Base 6.1.20070822
+ SeqDeleteByLoc@Base 6.1.20030421
+ SeqDeleteByLocEx@Base 6.1.20100808
+ SeqDescAsnRead@Base 6.1.20030421
+ SeqDescAsnWrite@Base 6.1.20030421
+ SeqDescFree@Base 6.1.20030421
+ SeqDescLabel@Base 6.1.20030421
+ SeqDescrAdd@Base 6.1.20030421
+ SeqDescrAddPointer@Base 6.1.20030421
+ SeqDescrAsnRead@Base 6.1.20030421
+ SeqDescrAsnWrite@Base 6.1.20030421
+ SeqDescrExtraCheck@Base 6.1.20030421
+ SeqDescrFree@Base 6.1.20030421
+ SeqDescrFromBioSample@Base 6.1.20160908
+ SeqDescrNew@Base 6.1.20030421
+ SeqEdAdjustFeatureInterval@Base 6.1.20100808
+ SeqEdDeleteFromBsp@Base 6.1.20041020
+ SeqEdFeatureAdjust@Base 6.1.20041020
+ SeqEdFixProteinFeatures@Base 6.1.20080302
+ SeqEdGetNextFeature@Base 6.1.20041020
+ SeqEdGetNthIntervalEndPoints@Base 6.1.20041020
+ SeqEdInsert@Base 6.1.20041020
+ SeqEdInsertAdjustCdRgn@Base 6.1.20041020
+ SeqEdInsertAdjustRNA@Base 6.1.20041020
+ SeqEdJournalFree@Base 6.1.20041020
+ SeqEdJournalNewFeatEdit@Base 6.1.20041020
+ SeqEdJournalNewSeqEdit@Base 6.1.20041020
+ SeqEdReindexAffectedFeatures@Base 6.1.20041020
+ SeqEdReindexFeature@Base 6.1.20041020
+ SeqEdRemapLocation@Base 6.1.20080302
+ SeqEdRepairIntervalOrder@Base 6.1.20041020
+ SeqEdSeqFeatDelete@Base 6.1.20090719
+ SeqEdSeqLocDelete@Base 6.1.20041020
+ SeqEdSeqLocInsert@Base 6.1.20041020-3~
+ SeqEdTranslateOneCDS@Base 6.1.20080302
+ SeqEntryAsnGet@Base 6.1.20030421
+ SeqEntryAsnOut@Base 6.1.20030421
+ SeqEntryAsnRead@Base 6.1.20030421
+ SeqEntryAsnWrite@Base 6.1.20030421
+ SeqEntryContainsSeqIdOfMolType@Base 6.1.20030421
+ SeqEntryConvert@Base 6.1.20030421
+ SeqEntryDelFeat@Base 6.1.20030421
+ SeqEntryDelFeatEx@Base 6.1.20100808
+ SeqEntryDoConvert@Base 6.1.20030421
+ SeqEntryFasta@Base 6.1.20030421
+ SeqEntryFastaStream@Base 6.1.20040505
+ SeqEntryFastaStreamEx@Base 6.1.20070822
+ SeqEntryFind@Base 6.1.20030421
+ SeqEntryFree@Base 6.1.20030421
+ SeqEntryFreeComponents@Base 6.1.20030421
+ SeqEntryGetScope@Base 6.1.20030421
+ SeqEntryGetSeqDescr@Base 6.1.20030421
+ SeqEntryGetSeqFeat@Base 6.1.20030421
+ SeqEntryGetTitle@Base 6.1.20030421
+ SeqEntryHasAligns@Base 6.1.20030421
+ SeqEntryHasNucs@Base 6.1.20030421
+ SeqEntryHasPairwiseAlignments@Base 6.1.20120620
+ SeqEntryHasProts@Base 6.1.20030421
+ SeqEntryLabel@Base 6.1.20030421
+ SeqEntryList@Base 6.1.20030421
+ SeqEntryLoad@Base 6.1.20030421
+ SeqEntryNew@Base 6.1.20030421
+ SeqEntryReplaceSeqID@Base 6.1.20030421
+ SeqEntrySetScope@Base 6.1.20030421
+ SeqEntryToBioSource@Base 6.1.20030421
+ SeqEntryToEntrez@Base 6.1.20030421
+ SeqEntryToFasta@Base 6.1.20030421
+ SeqEntryToFastaEx@Base 6.1.20030421
+ SeqEntryToFlat@Base 6.1.20030421
+ SeqEntryToFlatAjp@Base 6.1.20030421
+ SeqEntryToFlatEx@Base 6.1.20030421
+ SeqEntryToGBFlatNoSeq@Base 6.1.20030421
+ SeqEntryToGeneticCode@Base 6.1.20030421
+ SeqEntryToGnbk@Base 6.1.20030421
+ SeqEntryToPartRpt@Base 6.1.20030421
+ SeqEntryToSeqLoc@Base 6.1.20030421
+ SeqEntryToStrArray@Base 6.1.20030421
+ SeqEntryToStrArrayEx@Base 6.1.20030421
+ SeqEntryToStrArrayQEx@Base 6.1.20030421
+ SeqEntrysToDefline@Base 6.1.20030421
+ SeqEntrysToFasta@Base 6.1.20030421
+ SeqEntrysToFastaX@Base 6.1.20030421
+ SeqFeatAsnLoad@Base 6.1.20030421
+ SeqFeatAsnRead@Base 6.1.20030421
+ SeqFeatAsnWrite@Base 6.1.20030421
+ SeqFeatDataAsnRead@Base 6.1.20030421
+ SeqFeatDataAsnWrite@Base 6.1.20030421
+ SeqFeatDataFree@Base 6.1.20030421
+ SeqFeatDelete@Base 6.1.20030421
+ SeqFeatFree@Base 6.1.20030421
+ SeqFeatIdAsnRead@Base 6.1.20030421
+ SeqFeatIdAsnWrite@Base 6.1.20030421
+ SeqFeatIdDup@Base 6.1.20030421
+ SeqFeatIdFree@Base 6.1.20030421
+ SeqFeatNew@Base 6.1.20030421
+ SeqFeatSetAsnRead@Base 6.1.20030421
+ SeqFeatSetAsnWrite@Base 6.1.20030421
+ SeqFeatSetAsnWriteExtra@Base 6.1.20030421
+ SeqFeatSupportAsnRead@Base 6.1.20110713
+ SeqFeatSupportAsnWrite@Base 6.1.20110713
+ SeqFeatSupportFree@Base 6.1.20110713
+ SeqFeatSupportNew@Base 6.1.20110713
+ SeqFeatToXref@Base 6.1.20030421
+ SeqFeatXrefAsnRead@Base 6.1.20030421
+ SeqFeatXrefAsnWrite@Base 6.1.20030421
+ SeqFeatXrefFree@Base 6.1.20030421
+ SeqFeatXrefNew@Base 6.1.20030421
+ SeqFeatsCopy@Base 6.1.20030421
+ SeqGapAsnRead@Base 6.1.20070822
+ SeqGapAsnWrite@Base 6.1.20070822
+ SeqGapFree@Base 6.1.20070822
+ SeqGapNew@Base 6.1.20070822
+ SeqGenomeToFlat@Base 6.1.20030421
+ SeqGenomeToFlatEx@Base 6.1.20030421
+ SeqGraphAsnRead@Base 6.1.20030421
+ SeqGraphAsnWrite@Base 6.1.20030421
+ SeqGraphFree@Base 6.1.20030421
+ SeqGraphLabel@Base 6.1.20030421
+ SeqGraphNew@Base 6.1.20030421
+ SeqGraphSetAsnRead@Base 6.1.20030421
+ SeqGraphSetAsnWrite@Base 6.1.20030421
+ SeqHistAlignLabel@Base 6.1.20030421
+ SeqHistAsnRead@Base 6.1.20030421
+ SeqHistAsnWrite@Base 6.1.20030421
+ SeqHistFree@Base 6.1.20030421
+ SeqHistNew@Base 6.1.20030421
+ SeqIdAsnRead@Base 6.1.20030421
+ SeqIdAsnWrite@Base 6.1.20030421
+ SeqIdBestRank@Base 6.1.20030421
+ SeqIdComp@Base 6.1.20030421
+ SeqIdDup@Base 6.1.20030421
+ SeqIdDupBestList@Base 6.1.20030421
+ SeqIdDupList@Base 6.1.20030421
+ SeqIdFindBest@Base 6.1.20030421
+ SeqIdFindBestAccession@Base 6.1.20030421
+ SeqIdFindWorst@Base 6.1.20030421
+ SeqIdForSameBioseq@Base 6.1.20030421
+ SeqIdFree@Base 6.1.20030421
+ SeqIdFromAccession@Base 6.1.20030421
+ SeqIdFromAccessionDotVersion@Base 6.1.20030421
+ SeqIdFromAccessionEx@Base 6.1.20030421
+ SeqIdFromAlignNode@Base 6.1.20030421
+ SeqIdFromPubSeqString@Base 6.1.20120620
+ SeqIdIn@Base 6.1.20030421
+ SeqIdInSeqLocList@Base 6.1.20030421
+ SeqIdIndexElementCmp@Base 6.1.20030421
+ SeqIdLabel@Base 6.1.20030421
+ SeqIdLabelLen@Base 6.1.20090719
+ SeqIdListToCharArray@Base 6.1.20030421
+ SeqIdListToValNodeSeqIdList@Base 6.1.20110713
+ SeqIdListfromSeqLoc@Base 6.1.20030421
+ SeqIdLocate@Base 6.1.20030421
+ SeqIdMatch@Base 6.1.20030421
+ SeqIdOrderInBioseqIdList@Base 6.1.20030421
+ SeqIdOrderInList@Base 6.1.20030421
+ SeqIdParse@Base 6.1.20030421
+ SeqIdPrint@Base 6.1.20030421
+ SeqIdPtrFromSeqAlign@Base 6.1.20030421
+ SeqIdReplaceID@Base 6.1.20030421
+ SeqIdReplaceListFree@Base 6.1.20090301
+ SeqIdSelect@Base 6.1.20030421
+ SeqIdSetAsnRead@Base 6.1.20030421
+ SeqIdSetAsnWrite@Base 6.1.20030421
+ SeqIdSetDup@Base 6.1.20030421
+ SeqIdSetFree@Base 6.1.20030421
+ SeqIdStripLocus@Base 6.1.20030421
+ SeqIdWholeLabel@Base 6.1.20090719
+ SeqIdWrite@Base 6.1.20030421
+ SeqInsertByLoc@Base 6.1.20030421
+ SeqIntAsnRead@Base 6.1.20030421
+ SeqIntAsnWrite@Base 6.1.20030421
+ SeqIntCheck@Base 6.1.20030421
+ SeqIntFree@Base 6.1.20030421
+ SeqIntNew@Base 6.1.20030421
+ SeqLineReEval@Base 6.1.20030421
+ SeqLitAsnRead@Base 6.1.20030421
+ SeqLitAsnWrite@Base 6.1.20030421
+ SeqLitFastaStream@Base 6.1.20110713
+ SeqLitFree@Base 6.1.20030421
+ SeqLitNew@Base 6.1.20030421
+ SeqLitPack@Base 6.1.20030421
+ SeqLocAdd@Base 6.1.20030421
+ SeqLocAinB@Base 6.1.20030421
+ SeqLocAsnLoad@Base 6.1.20030421
+ SeqLocAsnRead@Base 6.1.20030421
+ SeqLocAsnWrite@Base 6.1.20030421
+ SeqLocBadSortOrder@Base 6.1.20030421
+ SeqLocCheck@Base 6.1.20030421
+ SeqLocCompare@Base 6.1.20030421
+ SeqLocCompareEx@Base 6.1.20100808
+ SeqLocCopy@Base 6.1.20050429
+ SeqLocCopyPart@Base 6.1.20030421
+ SeqLocCopyRegion@Base 6.1.20030421
+ SeqLocDelete@Base 6.1.20030421
+ SeqLocDeleteEx@Base 6.1.20030421
+ SeqLocEquivAsnRead@Base 6.1.20030421
+ SeqLocEquivAsnWrite@Base 6.1.20030421
+ SeqLocFastaStream@Base 6.1.20050429
+ SeqLocFindNext@Base 6.1.20030421
+ SeqLocFindPart@Base 6.1.20030421
+ SeqLocFree@Base 6.1.20030421
+ SeqLocFromSeqAlign@Base 6.1.20030421
+ SeqLocGetSegLens@Base 6.1.20030421
+ SeqLocId@Base 6.1.20030421
+ SeqLocIdForProduct@Base 6.1.20040204
+ SeqLocInsert@Base 6.1.20030421
+ SeqLocIntNew@Base 6.1.20030421
+ SeqLocLabel@Base 6.1.20030421
+ SeqLocLen@Base 6.1.20030421
+ SeqLocListFromSeqAlign@Base 6.1.20030421
+ SeqLocListHasLegend@Base 6.1.20030421
+ SeqLocListMatch@Base 6.1.20030421
+ SeqLocListOfBioseqsFromSeqAlign@Base 6.1.20030421
+ SeqLocMerge@Base 6.1.20030421
+ SeqLocMergeEx@Base 6.1.20030421
+ SeqLocMergeExEx@Base 6.1.20040616
+ SeqLocMixAsnRead@Base 6.1.20030421
+ SeqLocMixAsnWrite@Base 6.1.20030421
+ SeqLocMixFromSeqAlign@Base 6.1.20030421
+ SeqLocMixedStrands@Base 6.1.20030421
+ SeqLocMol@Base 6.1.20030421
+ SeqLocOffset@Base 6.1.20030421
+ SeqLocOrder@Base 6.1.20030421
+ SeqLocPackage@Base 6.1.20030421
+ SeqLocPartialCheck@Base 6.1.20030421
+ SeqLocPartialCheckEx@Base 6.1.20070822
+ SeqLocPntNew@Base 6.1.20030421
+ SeqLocPrint@Base 6.1.20030421
+ SeqLocPrintUseBestID@Base 6.1.20060301
+ SeqLocReMap@Base 6.1.20030421
+ SeqLocReMapEx@Base 6.1.20040204
+ SeqLocReplace@Base 6.1.20030421
+ SeqLocReplaceID@Base 6.1.20030421
+ SeqLocRevCmp@Base 6.1.20030421
+ SeqLocSetAsnRead@Base 6.1.20030421
+ SeqLocSetAsnWrite@Base 6.1.20030421
+ SeqLocSetFree@Base 6.1.20030421
+ SeqLocStart@Base 6.1.20030421
+ SeqLocStop@Base 6.1.20030421
+ SeqLocStrand@Base 6.1.20030421
+ SeqLocSubtract@Base 6.1.20030421
+ SeqLocToFastaSeqAlign@Base 6.1.20030421
+ SeqLocToFlat@Base 6.1.20030421
+ SeqLocWholeNew@Base 6.1.20080302
+ SeqLocsToDeltaSeqs@Base 6.1.20030421
+ SeqMapTableAsnRead@Base 6.1.20030421
+ SeqMapTableAsnWrite@Base 6.1.20030421
+ SeqMapTableConvert@Base 6.1.20030421
+ SeqMapTableFind@Base 6.1.20030421
+ SeqMapTableFindObj@Base 6.1.20030421
+ SeqMapTableFree@Base 6.1.20030421
+ SeqMapTableNew@Base 6.1.20030421
+ SeqMgrAdd@Base 6.1.20030421
+ SeqMgrAddToBioseqIndex@Base 6.1.20030421
+ SeqMgrAlsoSelect@Base 6.1.20030421
+ SeqMgrBuildFeatureIndex@Base 6.1.20030421
+ SeqMgrClearBioseqIndex@Base 6.1.20070822
+ SeqMgrClearFeatureIndexes@Base 6.1.20030421
+ SeqMgrDeSelect@Base 6.1.20030421
+ SeqMgrDelete@Base 6.1.20030421
+ SeqMgrDeleteFromBioseqIndex@Base 6.1.20030421
+ SeqMgrDeleteIndexesInRecord@Base 6.1.20030421
+ SeqMgrExploreBioseqs@Base 6.1.20030421
+ SeqMgrExploreDescriptors@Base 6.1.20030421
+ SeqMgrExploreFeatures@Base 6.1.20030421
+ SeqMgrExploreFeaturesRev@Base 6.1.20030421
+ SeqMgrExploreSegments@Base 6.1.20030421
+ SeqMgrFeaturesAreIndexed@Base 6.1.20030421
+ SeqMgrFindAnnotDescByID@Base 6.1.20050429
+ SeqMgrFindSMFeatItemByID@Base 6.1.20030421
+ SeqMgrFindSMFeatItemPtr@Base 6.1.20030421
+ SeqMgrFindSeqAlignByID@Base 6.1.20030421
+ SeqMgrFreeBioseqExtraFunc@Base 6.1.20030421
+ SeqMgrFreeCache@Base 6.1.20030421
+ SeqMgrGeneIsSuppressed@Base 6.1.20030421
+ SeqMgrGet@Base 6.1.20030421
+ SeqMgrGetAllOverlappingFeatures@Base 6.1.20030421
+ SeqMgrGetBestProteinFeature@Base 6.1.20030421
+ SeqMgrGetBioseqContext@Base 6.1.20030421
+ SeqMgrGetCDSgivenProduct@Base 6.1.20030421
+ SeqMgrGetDesiredAnnotDesc@Base 6.1.20050429
+ SeqMgrGetDesiredDescriptor@Base 6.1.20030421
+ SeqMgrGetDesiredFeature@Base 6.1.20030421
+ SeqMgrGetEntityIDForSeqEntry@Base 6.1.20030421
+ SeqMgrGetExtraDataForOmdp@Base 6.1.20090719
+ SeqMgrGetFeatureByFeatID@Base 6.1.20050828
+ SeqMgrGetFeatureByLabel@Base 6.1.20030421
+ SeqMgrGetFeatureInIndex@Base 6.1.20030421
+ SeqMgrGetGeneByLocusTag@Base 6.1.20050828
+ SeqMgrGetGeneXref@Base 6.1.20030421
+ SeqMgrGetGeneXrefEx@Base 6.1.20110713
+ SeqMgrGetLocationSupersetmRNA@Base 6.1.20041020
+ SeqMgrGetNextAnnotDesc@Base 6.1.20050429
+ SeqMgrGetNextDescriptor@Base 6.1.20030421
+ SeqMgrGetNextFeature@Base 6.1.20030421
+ SeqMgrGetNextFeatureByLabel@Base 6.1.20030421
+ SeqMgrGetNextGeneByLocusTag@Base 6.1.20040505
+ SeqMgrGetOmdpForBioseq@Base 6.1.20070822
+ SeqMgrGetOverlappingCDS@Base 6.1.20030421
+ SeqMgrGetOverlappingFeature@Base 6.1.20030421
+ SeqMgrGetOverlappingFeatureEx@Base 6.1.20110713
+ SeqMgrGetOverlappingGene@Base 6.1.20030421
+ SeqMgrGetOverlappingOperon@Base 6.1.20031028
+ SeqMgrGetOverlappingPub@Base 6.1.20030421
+ SeqMgrGetOverlappingSource@Base 6.1.20030421
+ SeqMgrGetOverlappingmRNA@Base 6.1.20030421
+ SeqMgrGetPROTgivenProduct@Base 6.1.20030421
+ SeqMgrGetParentOfPart@Base 6.1.20030421
+ SeqMgrGetProtXref@Base 6.1.20030421
+ SeqMgrGetRNAgivenProduct@Base 6.1.20030421
+ SeqMgrGetSeqEntryForData@Base 6.1.20030421
+ SeqMgrGetSeqEntryForEntityID@Base 6.1.20030421
+ SeqMgrGetSfpProductList@Base 6.1.20030421
+ SeqMgrHoldIndexing@Base 6.1.20030421
+ SeqMgrIndexAlignments@Base 6.1.20030421
+ SeqMgrIndexFeatures@Base 6.1.20030421
+ SeqMgrIndexFeaturesEx@Base 6.1.20030421
+ SeqMgrIndexFeaturesExEx@Base 6.1.20050429
+ SeqMgrLinkSeqEntry@Base 6.1.20030421
+ SeqMgrMapPartToSegmentedBioseq@Base 6.1.20030421
+ SeqMgrReadLock@Base 6.1.20030421
+ SeqMgrReapBioseqExtraFunc@Base 6.1.20030421
+ SeqMgrRedoDescriptorIndexes@Base 6.1.20100808
+ SeqMgrRedoFeatByLabelIndexes@Base 6.1.20100808
+ SeqMgrReloadBioseqExtraFunc@Base 6.1.20030421
+ SeqMgrReplaceInBioseqIndex@Base 6.1.20030421
+ SeqMgrSelect@Base 6.1.20030421
+ SeqMgrSeqEntry@Base 6.1.20030421
+ SeqMgrSetAccnVerFunc@Base 6.1.20030421
+ SeqMgrSetBSFetchTop@Base 6.1.20030421
+ SeqMgrSetColor@Base 6.1.20030421
+ SeqMgrSetFetchOnLock@Base 6.1.20030421
+ SeqMgrSetLenFunc@Base 6.1.20030421
+ SeqMgrSetPreCache@Base 6.1.20030421
+ SeqMgrSetSeqIdSetFunc@Base 6.1.20030421
+ SeqMgrUnlock@Base 6.1.20030421
+ SeqMgrVisitDescriptors@Base 6.1.20030421
+ SeqMgrVisitFeatures@Base 6.1.20030421
+ SeqMgrWriteLock@Base 6.1.20030421
+ SeqPntAsnRead@Base 6.1.20030421
+ SeqPntAsnWrite@Base 6.1.20030421
+ SeqPntCheck@Base 6.1.20030421
+ SeqPntFree@Base 6.1.20030421
+ SeqPntNew@Base 6.1.20030421
+ SeqPointPrint@Base 6.1.20030421
+ SeqPointWrite@Base 6.1.20030421
+ SeqPortAdjustLength@Base 6.1.20030421
+ SeqPortFree@Base 6.1.20030421
+ SeqPortGetResidue@Base 6.1.20030421
+ SeqPortNew@Base 6.1.20030421
+ SeqPortNewByLoc@Base 6.1.20030421
+ SeqPortRead@Base 6.1.20030421
+ SeqPortSeek@Base 6.1.20030421
+ SeqPortSetUpAlphabet@Base 6.1.20030421
+ SeqPortSetUpFields@Base 6.1.20030421
+ SeqPortSetValues@Base 6.1.20030421
+ SeqPortSet_do_virtual@Base 6.1.20030421
+ SeqPortSet_do_virtualEx@Base 6.1.20030421
+ SeqPortSet_is_circle@Base 6.1.20030421
+ SeqPortSet_is_seg@Base 6.1.20030421
+ SeqPortStream@Base 6.1.20030421
+ SeqPortStreamInt@Base 6.1.20040505
+ SeqPortStreamLit@Base 6.1.20110713
+ SeqPortStreamLoc@Base 6.1.20040505
+ SeqPortTell@Base 6.1.20030421
+ SeqPosFromTilingPos@Base 6.1.20081116
+ SeqPosInLineColumn@Base 6.1.20030421
+ SeqPosToLineColumn@Base 6.1.20030421
+ SeqResAsnLoad@Base 6.1.20030421
+ SeqSearchAddNucleotidePattern@Base 6.1.20030421
+ SeqSearchFree@Base 6.1.20030421
+ SeqSearchNew@Base 6.1.20030421
+ SeqSearchProcessBioseq@Base 6.1.20030421
+ SeqSearchProcessCharacter@Base 6.1.20030421
+ SeqSearchReset@Base 6.1.20030421
+ SeqSetAsnLoad@Base 6.1.20030421
+ SeqSubmitAsnRead@Base 6.1.20030421
+ SeqSubmitAsnWrite@Base 6.1.20030421
+ SeqSubmitFree@Base 6.1.20030421
+ SeqSubmitLabel@Base 6.1.20030421
+ SeqSubmitNew@Base 6.1.20030421
+ SeqSubmitToFlat@Base 6.1.20030421
+ SeqTableAsnRead@Base 6.1.20080302
+ SeqTableAsnWrite@Base 6.1.20080302
+ SeqTableColumnAsnRead@Base 6.1.20080302
+ SeqTableColumnAsnWrite@Base 6.1.20080302
+ SeqTableColumnFree@Base 6.1.20080302
+ SeqTableColumnInfoAsnRead@Base 6.1.20080302
+ SeqTableColumnInfoAsnWrite@Base 6.1.20080302
+ SeqTableColumnInfoFree@Base 6.1.20080302
+ SeqTableColumnInfoNew@Base 6.1.20080302
+ SeqTableColumnNew@Base 6.1.20080302
+ SeqTableFree@Base 6.1.20080302
+ SeqTableMultiDataAsnRead@Base 6.1.20080302
+ SeqTableMultiDataAsnWrite@Base 6.1.20080302
+ SeqTableMultiDataFree@Base 6.1.20080302
+ SeqTableNew@Base 6.1.20080302
+ SeqTableSingleDataAsnRead@Base 6.1.20080302
+ SeqTableSingleDataAsnWrite@Base 6.1.20080302
+ SeqTableSingleDataFree@Base 6.1.20080302
+ SeqTableSparseIndexAsnRead@Base 6.1.20080302
+ SeqTableSparseIndexAsnWrite@Base 6.1.20080302
+ SeqTableSparseIndexFree@Base 6.1.20080302
+ SeqToAwp@Base 6.1.20030421
+ Seq_seqAsnRead@Base 6.1.20100808
+ Seq_seqAsnWrite@Base 6.1.20100808
+ Seq_seqFree@Base 6.1.20100808
+ SeqfeatlistFree@Base 6.1.20030421
+ SeqfeatlistFree_fromID@Base 6.1.20030421
+ SequenceConstraintAsnRead@Base 6.1.20080302
+ SequenceConstraintAsnWrite@Base 6.1.20080302
+ SequenceConstraintFree@Base 6.1.20080302
+ SequenceConstraintMolTypeConstraintAsnRead@Base 6.1.20080302
+ SequenceConstraintMolTypeConstraintAsnWrite@Base 6.1.20080302
+ SequenceConstraintMolTypeConstraintFree@Base 6.1.20080302
+ SequenceConstraintNew@Base 6.1.20080302
+ SequenceInfoFree@Base 6.1.20040204
+ SequenceInfoNew@Base 6.1.20040204
+ SequenceListAsnRead@Base 6.1.20080302
+ SequenceListAsnWrite@Base 6.1.20080302
+ SequenceListChoiceAsnRead@Base 6.1.20080302
+ SequenceListChoiceAsnWrite@Base 6.1.20080302
+ SequenceListChoiceFree@Base 6.1.20080302
+ SequenceListFree@Base 6.1.20080302
+ SequenceOfIntAsnRead@Base 6.1.20100808
+ SequenceOfIntAsnWrite@Base 6.1.20100808
+ SequenceOfIntFree@Base 6.1.20100808
+ SequenceStringToSeqEntry@Base 6.1.20081116
+ SequinEntryList@Base 6.1.20030421
+ SerialNumberInString@Base 6.1.20030421
+ SetAutoDefIDModifiers@Base 6.1.20100808
+ SetBoolFromField@Base 6.1.20160908
+ SetDBxrefForBioSource@Base 6.1.20100808
+ SetDbtagString@Base 6.1.20120620
+ SetDefLineTypeFromFieldString@Base 6.1.20160908
+ SetDescriptorPropagate@Base 6.1.20100808
+ SetDiscrepancyLevels@Base 6.1.20100808
+ SetDiscrepancyReportTestsFromString@Base 6.1.20080302
+ SetEmptyGeneticCodes@Base 6.1.20030421
+ SetFieldValueForObject@Base 6.1.20081116
+ SetFieldValueForObjectEx@Base 6.1.20090301
+ SetGeneticCodeForEntry@Base 6.1.20030421
+ SetIfpFeatCount@Base 6.1.20160908
+ SetInt2FromFieldString@Base 6.1.20160908
+ SetInt4FromFieldString@Base 6.1.20160908
+ SetModifierIndices@Base 6.1.20160908
+ SetObjectIdString@Base 6.1.20100808
+ SetOnAllValsForDescStreamList@Base 6.1.20110713
+ SetPartialsAfterSplittingAtGap@Base 6.1.20160908
+ SetPhrapContigOrder@Base 6.1.20030421
+ SetProductSequencePartials@Base 6.1.20080302
+ SetPubclassOnPub@Base 6.1.20160908
+ SetQualOnFeature@Base 6.1.20100808
+ SetRNAProductString@Base 6.1.20100808
+ SetRNAQualOnFeature@Base 6.1.20110713
+ SetRNARefProductString@Base 6.1.20100808
+ SetRequiredModifiers@Base 6.1.20080302
+ SetSeqFeatData@Base 6.1.20030421
+ SetSeqFeatProduct@Base 6.1.20030421
+ SetSeqLocPartial@Base 6.1.20030421
+ SetSeqLocPartialEx@Base 6.1.20110713
+ SetSeqLocPartialSet@Base 6.1.20100808
+ SetSourceQualInBioSource@Base 6.1.20080302
+ SetStringInGBQualList@Base 6.1.20120620
+ SetStringValue@Base 6.1.20081116
+ SetStringsInValNodeStringList@Base 6.1.20090719
+ SetStructuredCommentPrefixAndSuffix@Base 6.1.20160908
+ SetSuppressedFeatures@Base 6.1.20160908
+ SetncRNAClass@Base 6.1.20100808
+ SettRNACodons_Recognized@Base 6.1.20160908
+ SettmRNATagPeptide@Base 6.1.20100808
+ SetupDataBuffer@Base 6.1.20030421
+ SetupDataPanel@Base 6.1.20030421
+ SetupMatchPatList@Base 6.1.20030421
+ ShortWordList@Base 6.1.20080302
+ ShouldBeAGBQual@Base 6.1.20110713
+ ShouldExcludeSp@Base 6.1.20100808
+ ShouldSuppressGBQual@Base 6.1.20110713
+ ShouldUseOriginalID@Base 6.1.20160908
+ ShowAlignNodeText2@Base 6.1.20030421
+ ShowAlignNodeText@Base 6.1.20030421
+ ShowAlignmentText@Base 6.1.20030421
+ ShowNextPattern@Base 6.1.20030421
+ ShowPrecPattern@Base 6.1.20030421
+ ShowTextAlignFromAnnot2@Base 6.1.20030421
+ ShowTextAlignFromAnnot3@Base 6.1.20030421
+ ShowTextAlignFromAnnot@Base 6.1.20030421
+ ShowTextAlignFromAnnotExtra@Base 6.1.20030421
+ ShuffleUpdateBioseqList@Base 6.1.20120620
+ ShuffleUpdateBioseqListWithIndex@Base 6.1.20120620
+ SimpleReplaceAsnRead@Base 6.1.20110713
+ SimpleReplaceAsnWrite@Base 6.1.20110713
+ SimpleReplaceFree@Base 6.1.20110713
+ SimpleReplaceNew@Base 6.1.20110713
+ SimpleSeqAsnRead@Base 6.1.20030421
+ SimpleSeqFree@Base 6.1.20030421
+ SimpleSeqNew@Base 6.1.20030421
+ SimpleSeqPrint@Base 6.1.20030421
+ SomaticOriginAsnRead@Base 6.1.20110713
+ SomaticOriginAsnWrite@Base 6.1.20110713
+ SomaticOriginConditionAsnRead@Base 6.1.20110713
+ SomaticOriginConditionAsnWrite@Base 6.1.20110713
+ SomaticOriginConditionFree@Base 6.1.20110713
+ SomaticOriginConditionNew@Base 6.1.20110713
+ SomaticOriginFree@Base 6.1.20110713
+ SomaticOriginNew@Base 6.1.20110713
+ SortAlignNode@Base 6.1.20030421
+ SortAlignPosition@Base 6.1.20030421
+ SortAlignmentFeature@Base 6.1.20030421
+ SortByChoice@Base 6.1.20160908
+ SortByIntvalue@Base 6.1.20040616
+ SortByPtrvalue@Base 6.1.20120620
+ SortFeatNode@Base 6.1.20030421
+ SortFeatureGBQuals@Base 6.1.20160908
+ SortFieldsActionAsnRead@Base 6.1.20110713
+ SortFieldsActionAsnWrite@Base 6.1.20110713
+ SortFieldsActionFree@Base 6.1.20110713
+ SortFieldsActionNew@Base 6.1.20110713
+ SortFieldsForObject@Base 6.1.20110713
+ SortOrganizeFeat@Base 6.1.20030421
+ SortPairwiseAlignmentsByFirstSeqRange@Base 6.1.20081116
+ SortQualOnFeature@Base 6.1.20110713
+ SortSeqAlign@Base 6.1.20030421
+ SortSeqAlignFromList@Base 6.1.20030421
+ SortSeqEntryQualifiers@Base 6.1.20100808
+ SortSuspectRuleSetByFind@Base 6.1.20110713
+ SortSuspectRuleSetByFixTypeThenFind@Base 6.1.20110713
+ SortTableRowByAnyColumn@Base 6.1.20110713
+ SortUniqueFieldTypeList@Base 6.1.20081116
+ SortValNode@Base 6.1.20030421
+ SortVnpByChoiceAndPtrvalue@Base 6.1.20120620
+ SortVnpByClickableItemChosen@Base 6.1.20081116
+ SortVnpByClickableItemDescription@Base 6.1.20070822
+ SortVnpByDiscrepancyDescription@Base 6.1.20081116
+ SortVnpByDiscrepancyItemText@Base 6.1.20081116
+ SortVnpByFieldDiffBiosampleIdThenFieldThenVal@Base 6.1.20160908
+ SortVnpByFieldDiffField@Base 6.1.20160908
+ SortVnpByFieldDiffIdThenField@Base 6.1.20160908
+ SortVnpByFieldRule@Base 6.1.20100808
+ SortVnpByFieldType@Base 6.1.20160908
+ SortVnpByFieldTypeAndSourceQualifier@Base 6.1.20160908
+ SortVnpByGlobalDiscrepancyString@Base 6.1.20080302
+ SortVnpByGlobalDiscrepancyStringCaseSensitive@Base 6.1.20160908
+ SortVnpByNaturalCI@Base 6.1.20120620
+ SortVnpByNaturalCS@Base 6.1.20120620
+ SortVnpByObject@Base 6.1.20090301
+ SortVnpByPCRSetOrder@Base 6.1.20070822
+ SortVnpByPCRSetSeq@Base 6.1.20070822
+ SortVnpBySourceQualDesc@Base 6.1.20110713
+ SortVnpByString@Base 6.1.20030421
+ SortVnpByStringCI@Base 6.1.20090719
+ SortVnpByStringCILCFirst@Base 6.1.20090719
+ SortVnpByStringCIUCFirst@Base 6.1.20090719
+ SortVnpByStringCS@Base 6.1.20090719
+ SortVnpByUserField@Base 6.1.20100808
+ SourceConstraintAsnRead@Base 6.1.20080302
+ SourceConstraintAsnWrite@Base 6.1.20080302
+ SourceConstraintFree@Base 6.1.20080302
+ SourceConstraintNew@Base 6.1.20080302
+ SourceQualChoiceAsnRead@Base 6.1.20080302
+ SourceQualChoiceAsnWrite@Base 6.1.20080302
+ SourceQualChoiceFree@Base 6.1.20080302
+ SourceQualPairAsnRead@Base 6.1.20080302
+ SourceQualPairAsnWrite@Base 6.1.20080302
+ SourceQualPairFree@Base 6.1.20080302
+ SourceQualPairNew@Base 6.1.20080302
+ SourceQualTextValAsnRead@Base 6.1.20090301
+ SourceQualTextValAsnWrite@Base 6.1.20090301
+ SourceQualTextValFree@Base 6.1.20090301
+ SourceQualTextValNew@Base 6.1.20090301
+ SourceQualValChoiceAsnRead@Base 6.1.20090301
+ SourceQualValChoiceAsnWrite@Base 6.1.20090301
+ SourceQualValChoiceFree@Base 6.1.20090301
+ SourceQualValSetAsnRead@Base 6.1.20090301
+ SourceQualValSetAsnWrite@Base 6.1.20090301
+ SourceQualValSetFree@Base 6.1.20090301
+ SourceQualValsFromBioSourcePtr@Base 6.1.20090301
+ SparseAlignAsnRead@Base 6.1.20070822
+ SparseAlignAsnWrite@Base 6.1.20070822
+ SparseAlignFree@Base 6.1.20070822
+ SparseAlignNew@Base 6.1.20070822
+ SparseSegAsnRead@Base 6.1.20070822
+ SparseSegAsnWrite@Base 6.1.20070822
+ SparseSegExtAsnRead@Base 6.1.20070822
+ SparseSegExtAsnWrite@Base 6.1.20070822
+ SparseSegExtFree@Base 6.1.20070822
+ SparseSegExtNew@Base 6.1.20070822
+ SparseSegFree@Base 6.1.20070822
+ SparseSegNew@Base 6.1.20070822
+ SpecialAbbreviationList@Base 6.1.20080302
+ SpecialCharFind@Base 6.1.20080302
+ SpecialCharFindWithContext@Base 6.1.20080302
+ SpecialCharReplace@Base 6.1.20080302
+ SpecialSeqAlignSetAsnRead@Base 6.1.20030421
+ SpecialSeqAlignSetAsnWrite@Base 6.1.20030421
+ SpecificHostFixListFree@Base 6.1.20070822
+ SpellCallBack@Base 6.1.20030421
+ SpellCheckSeqFeat@Base 6.1.20030421
+ SpellCheckString@Base 6.1.20030421
+ SpliceCheck@Base 6.1.20030421
+ SpliceSiteAsnRead@Base 6.1.20061015
+ SpliceSiteAsnWrite@Base 6.1.20061015
+ SpliceSiteFree@Base 6.1.20061015
+ SpliceSiteNew@Base 6.1.20061015
+ SplicedExonAsnRead@Base 6.1.20061015
+ SplicedExonAsnWrite@Base 6.1.20061015
+ SplicedExonChunkAsnRead@Base 6.1.20061015
+ SplicedExonChunkAsnWrite@Base 6.1.20061015
+ SplicedExonChunkFree@Base 6.1.20061015
+ SplicedExonFree@Base 6.1.20061015
+ SplicedExonNew@Base 6.1.20061015
+ SplicedSegAsnRead@Base 6.1.20061015
+ SplicedSegAsnWrite@Base 6.1.20061015
+ SplicedSegFree@Base 6.1.20061015
+ SplicedSegModifierAsnRead@Base 6.1.20061015
+ SplicedSegModifierAsnWrite@Base 6.1.20061015
+ SplicedSegModifierFree@Base 6.1.20061015
+ SplicedSegNew@Base 6.1.20061015
+ SplitMultiValQual@Base 6.1.20030421
+ SplitPCRPrimersByConstraints@Base 6.1.20110713
+ SplitPCRPrimersByPosition@Base 6.1.20110713
+ SplitStringAtSemicolon@Base 6.1.20160908
+ SpreadGapsInDeltaSeq@Base 6.1.20030421
+ SqnTagFind@Base 6.1.20030421
+ SqnTagFindMultiple@Base 6.1.20100808
+ SqnTagFindUnused@Base 6.1.20070822
+ SqnTagFree@Base 6.1.20030421
+ SqnTagParse@Base 6.1.20030421
+ SquishBlocks@Base 6.1.20030421
+ SrcLocFromGenome@Base 6.1.20081116
+ SrcOrigFromOrigin@Base 6.1.20090301
+ StdAuthListNamesPrint@Base 6.1.20030421
+ StdDatePrint@Base 6.1.20030421
+ StdFormatPrint@Base 6.1.20030421
+ StdPrintOptionsFree@Base 6.1.20030421
+ StdPrintOptionsNew@Base 6.1.20030421
+ StdSegAsnRead@Base 6.1.20030421
+ StdSegAsnWrite@Base 6.1.20030421
+ StdSegFree@Base 6.1.20030421
+ StdSegGapList@Base 6.1.20030421
+ StdSegNew@Base 6.1.20030421
+ StdSegStats@Base 6.1.20030421
+ StdSeqLocPrint@Base 6.1.20030421
+ StoreFeat@Base 6.1.20030421
+ StoreFeatFree@Base 6.1.20030421
+ StoreFeatTemp@Base 6.1.20030421
+ StoreNAPubCit@Base 6.1.20030421
+ StorePub@Base 6.1.20030421
+ StrandCmp@Base 6.1.20030421
+ StrandFromAlignNode@Base 6.1.20030421
+ StrandFromStrandType@Base 6.1.20080302
+ StrandNameFromStrand@Base 6.1.20080302
+ StreamAsnForDescriptors@Base 6.1.20100808
+ StreamCacheGetResidue@Base 6.1.20040505
+ StreamCacheSetPosition@Base 6.1.20040505
+ StreamCacheSetup@Base 6.1.20040505
+ StringActionForObject@Base 6.1.20080302
+ StringActionInEntity@Base 6.1.20080302
+ StringConstraintAsnRead@Base 6.1.20080302
+ StringConstraintAsnWrite@Base 6.1.20080302
+ StringConstraintFree@Base 6.1.20080302
+ StringConstraintFromFieldEdit@Base 6.1.20080302
+ StringConstraintNew@Base 6.1.20080302
+ StringConstraintSetAsnRead@Base 6.1.20110713
+ StringConstraintSetAsnWrite@Base 6.1.20110713
+ StringConstraintSetFree@Base 6.1.20110713
+ StringContainsBodyOfWater@Base 6.1.20080302
+ StringContainsUnbalancedParentheses@Base 6.1.20110713
+ StringContainsUnderscore@Base 6.1.20110713
+ StringForSeqMethod@Base 6.1.20030421
+ StringForSeqTech@Base 6.1.20030421
+ StringHasOrgModPrefix@Base 6.1.20160908
+ StringHasPrefix@Base 6.1.20160908
+ StringIsJustQuotes@Base 6.1.20040204
+ StringMayContainPlural@Base 6.1.20110713
+ StringSearchInBioseq@Base 6.1.20030421
+ StringToLower@Base 6.1.20110713
+ StringToSeqEntry@Base 6.1.20030421
+ StringsAreEquivalent@Base 6.1.20060507
+ StripAllSpaces@Base 6.1.20040204
+ StripFeatIDXrefAsnFilter@Base 6.1.20051206
+ StripGeneRnaPcrAsnFilter@Base 6.1.20090719
+ StripLocusFromSeqLoc@Base 6.1.20030421
+ StripNewFeatMolInfoFieldsAsnFilter@Base 6.1.20081116
+ StripOrgNamePgcodeAsnFilter@Base 6.1.20100808
+ StripPCRPrimerAsnFilter@Base 6.1.20081116
+ StripSeqDataGapAsnFilter@Base 6.1.20070822
+ StripSeqFeatSupportAsnFilter@Base 6.1.20110713
+ StripSuffixFromAuthor@Base 6.1.20110713
+ StructuredCommentDbnameFromString@Base 6.1.20110713
+ StructuredCommentFieldAsnRead@Base 6.1.20081116
+ StructuredCommentFieldAsnWrite@Base 6.1.20081116
+ StructuredCommentFieldFree@Base 6.1.20081116
+ StructuredCommentFieldPairAsnRead@Base 6.1.20081116
+ StructuredCommentFieldPairAsnWrite@Base 6.1.20081116
+ StructuredCommentFieldPairFree@Base 6.1.20081116
+ StructuredCommentFieldPairNew@Base 6.1.20081116
+ StructuredCommentPrefixForKeyword@Base 6.1.20160908
+ SubSourceAsnRead@Base 6.1.20030421
+ SubSourceAsnWrite@Base 6.1.20030421
+ SubSourceFree@Base 6.1.20030421
+ SubSourceNew@Base 6.1.20030421
+ SubSourceSetAsnRead@Base 6.1.20030421
+ SubSourceSetAsnWrite@Base 6.1.20030421
+ SubSourceSetFree@Base 6.1.20030421
+ SubSourceSetMatch@Base 6.1.20050605
+ SubSourceText@Base 6.1.20081116
+ SubmitAsnLoad@Base 6.1.20030421
+ SubmitBlockAsnRead@Base 6.1.20030421
+ SubmitBlockAsnWrite@Base 6.1.20030421
+ SubmitBlockFree@Base 6.1.20030421
+ SubmitBlockLabel@Base 6.1.20030421
+ SubmitBlockMatch@Base 6.1.20050605
+ SubmitBlockNew@Base 6.1.20030421
+ SummarizeAECRAction@Base 6.1.20100808
+ SummarizeAddDescriptorListAction@Base 6.1.20120620
+ SummarizeApplyTableAction@Base 6.1.20120620
+ SummarizeAuthorFixAction@Base 6.1.20110713
+ SummarizeAutodefAction@Base 6.1.20100808
+ SummarizeConstraint@Base 6.1.20100808
+ SummarizeConstraintSet@Base 6.1.20100808
+ SummarizeCreateTSAIDsAction@Base 6.1.20120620
+ SummarizeExistingText@Base 6.1.20100808
+ SummarizeFeatQual@Base 6.1.20090301
+ SummarizeFeatureStrandedness@Base 6.1.20110713
+ SummarizeFieldType@Base 6.1.20080302
+ SummarizeFixCapsAction@Base 6.1.20110713
+ SummarizeFixFormatAction@Base 6.1.20110713
+ SummarizeFixPubCapsAction@Base 6.1.20100808
+ SummarizeFixSetsAction@Base 6.1.20120620
+ SummarizeFixType@Base 6.1.20110713
+ SummarizeMacroAction@Base 6.1.20120620
+ SummarizeMolinfoBlockAction@Base 6.1.20110713
+ SummarizeParseAction@Base 6.1.20100808
+ SummarizeParseDst@Base 6.1.20100808
+ SummarizeParseSrc@Base 6.1.20100808
+ SummarizePerformAutofixAction@Base 6.1.20120620
+ SummarizePropagateSequenceTechnology@Base 6.1.20120620
+ SummarizeRemoveDescriptorAction@Base 6.1.20100808
+ SummarizeRemoveDuplicateFeaturesAction@Base 6.1.20110713
+ SummarizeRemoveSequencesAction@Base 6.1.20120620
+ SummarizeReplaceFunc@Base 6.1.20110713
+ SummarizeReplaceRule@Base 6.1.20110713
+ SummarizeRnaType@Base 6.1.20081116
+ SummarizeSearchFunc@Base 6.1.20110713
+ SummarizeSortFieldsAction@Base 6.1.20110713
+ SummarizeSourceQual@Base 6.1.20080302
+ SummarizeStringConstraint@Base 6.1.20110713
+ SummarizeStringConstraintEx@Base 6.1.20120620
+ SummarizeSuspectRule@Base 6.1.20110713
+ SummarizeSuspectRuleEx@Base 6.1.20120620
+ SummarizeTextPortion@Base 6.1.20100808
+ SummarizeTextTransform@Base 6.1.20110713
+ SummarizeUpdateSequencesAction@Base 6.1.20120620
+ SummarizeWordSubstitution@Base 6.1.20110713
+ SuspectRuleAsnRead@Base 6.1.20110713
+ SuspectRuleAsnWrite@Base 6.1.20110713
+ SuspectRuleFree@Base 6.1.20110713
+ SuspectRuleNew@Base 6.1.20110713
+ SuspectRuleSetAsnRead@Base 6.1.20110713
+ SuspectRuleSetAsnWrite@Base 6.1.20110713
+ SuspectRuleSetFree@Base 6.1.20110713
+ SwapActionAsnRead@Base 6.1.20080302
+ SwapActionAsnWrite@Base 6.1.20080302
+ SwapActionFree@Base 6.1.20080302
+ SwapActionNew@Base 6.1.20080302
+ T3DataAsnRead@Base 6.1.20041020
+ T3DataAsnWrite@Base 6.1.20041020
+ T3DataFree@Base 6.1.20041020
+ T3DataNew@Base 6.1.20041020
+ T3ErrorAsnRead@Base 6.1.20041020
+ T3ErrorAsnWrite@Base 6.1.20041020
+ T3ErrorFree@Base 6.1.20041020
+ T3ErrorNew@Base 6.1.20041020
+ T3RefreshFlagsAsnRead@Base 6.1.20041020
+ T3RefreshFlagsAsnWrite@Base 6.1.20041020
+ T3RefreshFlagsFree@Base 6.1.20041020
+ T3RefreshFlagsNew@Base 6.1.20041020
+ T3ReplyAsnRead@Base 6.1.20041020
+ T3ReplyAsnWrite@Base 6.1.20041020
+ T3ReplyFree@Base 6.1.20041020
+ T3RequestAsnRead@Base 6.1.20041020
+ T3RequestAsnWrite@Base 6.1.20041020
+ T3RequestFree@Base 6.1.20041020
+ T3StatusFlagsAsnRead@Base 6.1.20041020
+ T3StatusFlagsAsnWrite@Base 6.1.20041020
+ T3StatusFlagsFree@Base 6.1.20041020
+ T3StatusFlagsNew@Base 6.1.20041020
+ TSeqAsnRead@Base 6.1.20030421
+ TSeqAsnWrite@Base 6.1.20030421
+ TSeqFree@Base 6.1.20030421
+ TSeqNew@Base 6.1.20030421
+ TSeqSetAsnRead@Base 6.1.20030421
+ TSeqSetAsnWrite@Base 6.1.20030421
+ TSeqSetFree@Base 6.1.20030421
+ TabColumnConfigCopy@Base 6.1.20080302
+ TabColumnConfigFree@Base 6.1.20080302
+ TabColumnConfigListCopy@Base 6.1.20080302
+ TabColumnConfigListFree@Base 6.1.20080302
+ TabColumnConfigNew@Base 6.1.20080302
+ TabColumnConfigReset@Base 6.1.20110713
+ TabToColumn@Base 6.1.20030421
+ TableMatchAsnRead@Base 6.1.20120620
+ TableMatchAsnWrite@Base 6.1.20120620
+ TableMatchFree@Base 6.1.20120620
+ TableMatchNew@Base 6.1.20120620
+ TableMatchTypeAsnRead@Base 6.1.20120620
+ TableMatchTypeAsnWrite@Base 6.1.20120620
+ TableMatchTypeFree@Base 6.1.20120620
+ TableMatchTypeFromMatchType@Base 6.1.20120620
+ TagFromKey@Base 6.1.20030421
+ Tax3AsynchronousQuery@Base 6.1.20041020
+ Tax3CheckQueue@Base 6.1.20041020
+ Tax3MergeSourceDescr@Base 6.1.20041020
+ Tax3OpenConnection@Base 6.1.20041020
+ Tax3ReadReply@Base 6.1.20041020
+ Tax3SynchronousQuery@Base 6.1.20041020
+ Tax3WaitForReply@Base 6.1.20041020
+ TaxElementAsnRead@Base 6.1.20030421
+ TaxElementAsnWrite@Base 6.1.20030421
+ TaxElementFree@Base 6.1.20030421
+ TaxElementNew@Base 6.1.20030421
+ TaxElementSetAsnRead@Base 6.1.20030421
+ TaxElementSetAsnWrite@Base 6.1.20030421
+ TaxElementSetFree@Base 6.1.20030421
+ TaxFixItemFree@Base 6.1.20090301
+ TaxFixItemListFree@Base 6.1.20090301
+ TaxFixItemNew@Base 6.1.20090301
+ TaxNameFromCommon@Base 6.1.20030421
+ Taxon3CheckOrgInSeqEntry@Base 6.1.20070822
+ Taxon3GetOrg@Base 6.1.20041020
+ Taxon3GetOrgRefByName@Base 6.1.20041020
+ Taxon3GetOrgRefList@Base 6.1.20041020
+ Taxon3GetSpecificHostFixesInSeqEntry@Base 6.1.20070822
+ Taxon3GetTaxFixList@Base 6.1.20090301
+ Taxon3GetTaxIdByName@Base 6.1.20041020
+ Taxon3GetTaxIdByOrgRef@Base 6.1.20041020
+ Taxon3ReplaceOrgInSeqEntry@Base 6.1.20041020
+ Taxon3ReplaceOrgInSeqEntryEx@Base 6.1.20100808
+ Taxon3ReplyAsnRead@Base 6.1.20041020
+ Taxon3ReplyAsnWrite@Base 6.1.20041020
+ Taxon3ReplyFree@Base 6.1.20041020
+ Taxon3ReplyNew@Base 6.1.20041020
+ Taxon3RequestAsnRead@Base 6.1.20041020
+ Taxon3RequestAsnWrite@Base 6.1.20041020
+ Taxon3RequestFree@Base 6.1.20041020
+ Taxon3RequestNew@Base 6.1.20041020
+ Taxon3ValidateSpecificHostsInSeqEntry@Base 6.1.20081116
+ TechFromTechName@Base 6.1.20120620
+ TechFromTechniqueType@Base 6.1.20080302
+ TechNameFromTech@Base 6.1.20080302
+ TeenyBlock@Base 6.1.20030421
+ TestFeatOverlap@Base 6.1.20030421
+ TestFindBestQualCombo@Base 6.1.20081116
+ TestLatLonForCountry@Base 6.1.20070822
+ TextAlignBufFind@Base 6.1.20030421
+ TextAnnotIdAsnRead@Base 6.1.20081116
+ TextAnnotIdAsnWrite@Base 6.1.20081116
+ TextAnnotIdFree@Base 6.1.20081116
+ TextAnnotIdNew@Base 6.1.20081116
+ TextFsaAdd@Base 6.1.20030421
+ TextFsaFree@Base 6.1.20030421
+ TextFsaGetStats@Base 6.1.20070822
+ TextFsaNew@Base 6.1.20030421
+ TextFsaNext@Base 6.1.20030421
+ TextMarkerAsnRead@Base 6.1.20100808
+ TextMarkerAsnWrite@Base 6.1.20100808
+ TextMarkerFree@Base 6.1.20100808
+ TextPortionAsnRead@Base 6.1.20080302
+ TextPortionAsnWrite@Base 6.1.20080302
+ TextPortionFree@Base 6.1.20080302
+ TextPortionNew@Base 6.1.20080302
+ TextSave@Base 6.1.20030421
+ TextSeqIdAsnRead@Base 6.1.20030421
+ TextSeqIdAsnWrite@Base 6.1.20030421
+ TextSeqIdFree@Base 6.1.20030421
+ TextSeqIdNew@Base 6.1.20030421
+ TextTransformAsnRead@Base 6.1.20110713
+ TextTransformAsnWrite@Base 6.1.20110713
+ TextTransformFree@Base 6.1.20110713
+ TextTransformSetAsnRead@Base 6.1.20110713
+ TextTransformSetAsnWrite@Base 6.1.20110713
+ TextTransformSetFree@Base 6.1.20110713
+ TilingPosFromSeqPos@Base 6.1.20081116
+ TitleAsnRead@Base 6.1.20030421
+ TitleAsnWrite@Base 6.1.20030421
+ TitleFree@Base 6.1.20030421
+ TitleMatch@Base 6.1.20030421
+ TitleMsg2AsnRead@Base 6.1.20070822
+ TitleMsg2AsnWrite@Base 6.1.20070822
+ TitleMsg2Free@Base 6.1.20070822
+ TitleMsg2New@Base 6.1.20070822
+ TitleMsgList2AsnRead@Base 6.1.20070822
+ TitleMsgList2AsnWrite@Base 6.1.20070822
+ TitleMsgList2Free@Base 6.1.20070822
+ TitleMsgList2New@Base 6.1.20070822
+ TokenizeTRnaString@Base 6.1.20030421
+ TooManyInferenceAccessions@Base 6.1.20110713
+ TopologyFromTopologyType@Base 6.1.20080302
+ TopologyNameFromTopology@Base 6.1.20080302
+ TraceArchiveGapStringFromACESequence@Base 6.1.20081116
+ TransTableFree@Base 6.1.20030421
+ TransTableFreeAll@Base 6.1.20030421
+ TransTableNew@Base 6.1.20030421
+ TransTableProcessBioseq@Base 6.1.20030421
+ TransTableTranslateCdRegion@Base 6.1.20030421
+ TransTableTranslateCdRegionEx@Base 6.1.20040505
+ TransTableTranslateSeqLoc@Base 6.1.20030421
+ TranslateCdRegion@Base 6.1.20030421
+ TranslationConstraintAsnRead@Base 6.1.20110713
+ TranslationConstraintAsnWrite@Base 6.1.20110713
+ TranslationConstraintFree@Base 6.1.20110713
+ TranslationConstraintNew@Base 6.1.20110713
+ TranslationFastaStream@Base 6.1.20090301
+ TranslationFastaStreamEx@Base 6.1.20120620
+ TrimLocInSegment@Base 6.1.20030421
+ TrimNsFromNucsInSeqEntry@Base 6.1.20160908
+ TrimPrimerSeqJunkInSeqEntry@Base 6.1.20100808
+ TrimQualityScores@Base 6.1.20060301
+ TrimSeqGraph@Base 6.1.20060301
+ TrimSpacesAndJunkFromEnds@Base 6.1.20030421
+ TrimSpacesAndSemicolons@Base 6.1.20030421
+ TrimStopsFromCompleteCodingRegions@Base 6.1.20100808
+ TruncateAuthorMiddleInitials@Base 6.1.20110713
+ TwoStringHashFree@Base 6.1.20110713
+ TxGetQueryIdFromSeqAlign@Base 6.1.20030421
+ TxGetSubjectIdFromSeqAlign@Base 6.1.20030421
+ TxinitAsnRead@Base 6.1.20030421
+ TxinitAsnWrite@Base 6.1.20030421
+ TxinitFree@Base 6.1.20030421
+ TxinitNew@Base 6.1.20030421
+ TypeMaterialIsValid@Base 6.1.20160908
+ UABuildDescriptor2@Base 6.1.20030421
+ UABuildDescriptor@Base 6.1.20030421
+ UABuildDescriptorForBlockEditor@Base 6.1.20030421
+ UAMgrDelUAMsg@Base 6.1.20030421
+ UAMgrGetNextUAbit@Base 6.1.20030421
+ UAMgrIntUAMsg@Base 6.1.20030421
+ UAMgrUAMsgGetInfo@Base 6.1.20030421
+ UDV_BigDecodeIdxFeat@Base 6.1.20030421
+ UDV_BigEncodeIdxFeat@Base 6.1.20030421
+ UDV_ComputeBspCoordRangeinPGP@Base 6.1.20030421
+ UDV_ConvertFeatContext@Base 6.1.20030421
+ UDV_CreateOneFeatureIndex@Base 6.1.20030421
+ UDV_CreateParaGList@Base 6.1.20030421
+ UDV_DecodeIdxFeat@Base 6.1.20030421
+ UDV_EncodeIdxFeat@Base 6.1.20030421
+ UDV_FreeListParaG@Base 6.1.20030421
+ UDV_GetBspRangeinPGPList@Base 6.1.20030421
+ UDV_GetStrandinPGP@Base 6.1.20030421
+ UDV_GetStrandinPGPList@Base 6.1.20030421
+ UDV_IsTranslationNeeded@Base 6.1.20030421
+ UDV_MsaTxtDispFree@Base 6.1.20030421
+ UDV_MsaTxtDispNew@Base 6.1.20030421
+ UDV_ParaGFTableFeatures@Base 6.1.20030421
+ UDV_PopParaGFeaturesEx@Base 6.1.20030421
+ UDV_PopulateParaGFeatures@Base 6.1.20030421
+ UDV_ReadBspDataForViewer@Base 6.1.20030421
+ UDV_Read_Sequence@Base 6.1.20030421
+ UDV_Read_SequenceEx@Base 6.1.20030421
+ UDV_RevertBioSeqCoord@Base 6.1.20030421
+ UniqueIntValNode@Base 6.1.20050429
+ UniqueLocalId@Base 6.1.20030421
+ UniquePtrValNode@Base 6.1.20120620
+ UniquePubs@Base 6.1.20030421
+ UniqueStringValNodeCI@Base 6.1.20090719
+ UniqueStringValNodeCS@Base 6.1.20090719
+ UniqueValNode@Base 6.1.20030421
+ UniqueVnpByPCRSetSeq@Base 6.1.20070822
+ UnitTestSeqLocCompare@Base 6.1.20100808
+ UnlockFarComponents@Base 6.1.20030421
+ UpdateAceFileIds@Base 6.1.20081116
+ UpdateContigIds@Base 6.1.20090301
+ UpdateLocalId@Base 6.1.20030421
+ UpdateProteinTitle@Base 6.1.20090719
+ UpdateReplacedECNumbers@Base 6.1.20120620
+ UpdateReplacedECNumbersEx@Base 6.1.20120620
+ UpdateReplacedEcNumbersActionAsnRead@Base 6.1.20160908
+ UpdateReplacedEcNumbersActionAsnWrite@Base 6.1.20160908
+ UpdateReplacedEcNumbersActionFree@Base 6.1.20160908
+ UpdateReplacedEcNumbersActionNew@Base 6.1.20160908
+ UpdateSequencesActionAsnRead@Base 6.1.20120620
+ UpdateSequencesActionAsnWrite@Base 6.1.20120620
+ UpdateSequencesActionFree@Base 6.1.20120620
+ UpdateSequencesActionNew@Base 6.1.20120620
+ UpdateTitle@Base 6.1.20030421
+ UrlEncodeString@Base 6.1.20120620
+ UseGIforLocus@Base 6.1.20030421
+ UseLocalAsnloadDataAndErrMsg@Base 6.1.20030421
+ UseOrgModifier@Base 6.1.20080302
+ UseSubSrcModifier@Base 6.1.20120620
+ UserFieldAsnRead@Base 6.1.20030421
+ UserFieldAsnWrite@Base 6.1.20030421
+ UserFieldFree@Base 6.1.20030421
+ UserFieldNew@Base 6.1.20030421
+ UserFieldSort@Base 6.1.20120620
+ UserFormatAsnRead@Base 6.1.20030421
+ UserFormatAsnWrite@Base 6.1.20030421
+ UserFormatFree@Base 6.1.20030421
+ UserFormatNew@Base 6.1.20030421
+ UserObjectAsnRead@Base 6.1.20030421
+ UserObjectAsnWrite@Base 6.1.20030421
+ UserObjectFree@Base 6.1.20030421
+ UserObjectNew@Base 6.1.20030421
+ ValNodeAddPointerToEnd@Base 6.1.20100808
+ ValNodeAddPointerToFront@Base 6.1.20100808
+ ValNodeCopyPtr@Base 6.1.20081116
+ ValNodeCopyStrToHead@Base 6.1.20040204
+ ValNodeDbtagMatch@Base 6.1.20120620
+ ValNodeDupIntList@Base 6.1.20100808
+ ValNodeDupStringList@Base 6.1.20080302
+ ValNodeFind@Base 6.1.20030421
+ ValNodeFreeType@Base 6.1.20030421
+ ValNodeLinkToEnd@Base 6.1.20110713
+ ValNodeReverse@Base 6.1.20081116
+ ValNodeSeqIdCopy@Base 6.1.20110713
+ ValNodeSeqIdFree@Base 6.1.20110713
+ ValNodeSeqIdListCopy@Base 6.1.20110713
+ ValNodeSeqIdListDup@Base 6.1.20030421
+ ValNodeSeqIdListFree@Base 6.1.20110713
+ ValNodeSeqIdListToSeqIdList@Base 6.1.20110713
+ ValNodeSeqIdMatch@Base 6.1.20110713
+ ValNodeSeqIdName@Base 6.1.20110713
+ ValNodeSortBlock@Base 6.1.20160908
+ ValNodeStringListMatch@Base 6.1.20120620
+ ValidAminoAcid@Base 6.1.20030421
+ ValidErr@Base 6.1.20030421
+ ValidStructClear@Base 6.1.20030421
+ ValidStructFree@Base 6.1.20030421
+ ValidStructNew@Base 6.1.20030421
+ ValidateAAImpFeat@Base 6.1.20030421
+ ValidateACEFileAgainstSeqEntry@Base 6.1.20081116
+ ValidateAccession@Base 6.1.20030421
+ ValidateAccn@Base 6.1.20030421
+ ValidateAccnDotVer@Base 6.1.20050429
+ ValidateAceFileIds@Base 6.1.20081116
+ ValidateECnumber@Base 6.1.20120620
+ ValidateEntrez2InfoPtr@Base 6.1.20030421
+ ValidateEntrez2InfoPtrEx@Base 6.1.20050429
+ ValidateEntrez2InfoPtrExEx@Base 6.1.20110713
+ ValidateEntrez2InfoPtrExExEx@Base 6.1.20120620
+ ValidateFeatureFieldColumnNames@Base 6.1.20080302
+ ValidateInferenceQualifier@Base 6.1.20060301
+ ValidateLocus@Base 6.1.20030421
+ ValidateNAImpFeat@Base 6.1.20030421
+ ValidatePub@Base 6.1.20030421
+ ValidateSeqAlign@Base 6.1.20030421
+ ValidateSeqAlignFromData@Base 6.1.20030421
+ ValidateSeqAlignInSeqEntry@Base 6.1.20030421
+ ValidateSeqAlignWithinValidator@Base 6.1.20030421
+ ValidateSeqEntry@Base 6.1.20030421
+ ValidateSeqFeat@Base 6.1.20030421
+ ValidateSeqID@Base 6.1.20030421
+ ValidateSeqLoc@Base 6.1.20030421
+ ValidateTabTableValues@Base 6.1.20080302
+ Validate_ParFlat_GBFeat@Base 6.1.20050828
+ VarRefDataAsnRead@Base 6.1.20100808
+ VarRefDataAsnWrite@Base 6.1.20100808
+ VarRefDataFree@Base 6.1.20100808
+ VarRefDataSetAsnRead@Base 6.1.20100808
+ VarRefDataSetAsnWrite@Base 6.1.20100808
+ VarRefDataSetFree@Base 6.1.20100808
+ VarRefDataSetNew@Base 6.1.20100808
+ VariantPropertiesAsnRead@Base 6.1.20100808
+ VariantPropertiesAsnWrite@Base 6.1.20100808
+ VariantPropertiesFree@Base 6.1.20100808
+ VariantPropertiesNew@Base 6.1.20100808
+ VariationInstAsnRead@Base 6.1.20100808
+ VariationInstAsnWrite@Base 6.1.20100808
+ VariationInstFree@Base 6.1.20100808
+ VariationInstNew@Base 6.1.20100808
+ VariationRefAsnRead@Base 6.1.20100808
+ VariationRefAsnWrite@Base 6.1.20100808
+ VariationRefFree@Base 6.1.20100808
+ VariationRefNew@Base 6.1.20100808
+ VecScreenAsynchronousRequest@Base 6.1.20030421
+ VecScreenCheckQueue@Base 6.1.20030421
+ VecScreenOpenConnection@Base 6.1.20030421
+ VecScreenWaitForReply@Base 6.1.20030421
+ ViewMgr_Add@Base 6.1.20030421
+ ViewMgr_AddTransform@Base 6.1.20030421
+ ViewMgr_Attach@Base 6.1.20030421
+ ViewMgr_ClearTrans@Base 6.1.20030421
+ ViewMgr_Delete@Base 6.1.20030421
+ ViewMgr_FreeInfo@Base 6.1.20030421
+ ViewMgr_GetBegin@Base 6.1.20030421
+ ViewMgr_GetBeginIndexed@Base 6.1.20030421
+ ViewMgr_GetRow@Base 6.1.20030421
+ ViewMgr_GetTarget@Base 6.1.20030421
+ ViewMgr_IsIBM@Base 6.1.20030421
+ ViewMgr_IsNeat@Base 6.1.20030421
+ ViewMgr_MakeMultiple@Base 6.1.20030421
+ ViewMgr_New@Base 6.1.20030421
+ ViewMgr_RegisterFunc@Base 6.1.20030421
+ ViewMgr_RemoveSA@Base 6.1.20030421
+ ViewMgr_SetBegin@Base 6.1.20030421
+ ViewMgr_SetHidden@Base 6.1.20030421
+ ViewMgr_SetRow@Base 6.1.20030421
+ ViewMgr_TRow2VRow@Base 6.1.20030421
+ ViewMgr_Update2@Base 6.1.20030421
+ ViewMgr_Update@Base 6.1.20030421
+ ViewMgr_VRow2TRow@Base 6.1.20030421
+ VisitAlignmentsInSep@Base 6.1.20030421
+ VisitAlignmentsInSet@Base 6.1.20030421
+ VisitAlignmentsOnBsp@Base 6.1.20030421
+ VisitAlignmentsOnSap@Base 6.1.20030421
+ VisitAlignmentsOnSep@Base 6.1.20030421
+ VisitAlignmentsOnSet@Base 6.1.20030421
+ VisitAllUserObjectsInUop@Base 6.1.20110713
+ VisitAnnotsInSep@Base 6.1.20030421
+ VisitAnnotsInSet@Base 6.1.20030421
+ VisitAnnotsOnBsp@Base 6.1.20030421
+ VisitAnnotsOnSep@Base 6.1.20030421
+ VisitAnnotsOnSet@Base 6.1.20030421
+ VisitAuthorsInPub@Base 6.1.20081116
+ VisitBioSourcesInSep@Base 6.1.20030421
+ VisitBioSourcesInSet@Base 6.1.20030421
+ VisitBioSourcesOnBsp@Base 6.1.20030421
+ VisitBioSourcesOnSep@Base 6.1.20030421
+ VisitBioSourcesOnSet@Base 6.1.20030421
+ VisitBioseqsInSep@Base 6.1.20030421
+ VisitBioseqsInSet@Base 6.1.20030421
+ VisitDescriptorsInSep@Base 6.1.20030421
+ VisitDescriptorsInSet@Base 6.1.20030421
+ VisitDescriptorsOnBsp@Base 6.1.20030421
+ VisitDescriptorsOnSep@Base 6.1.20030421
+ VisitDescriptorsOnSet@Base 6.1.20030421
+ VisitElementsInSep@Base 6.1.20030421
+ VisitFeaturesInSep@Base 6.1.20030421
+ VisitFeaturesInSet@Base 6.1.20030421
+ VisitFeaturesOnBsp@Base 6.1.20030421
+ VisitFeaturesOnSap@Base 6.1.20030421
+ VisitFeaturesOnSep@Base 6.1.20030421
+ VisitFeaturesOnSet@Base 6.1.20030421
+ VisitGenProdSetFeatures@Base 6.1.20080302
+ VisitGraphsInSep@Base 6.1.20030421
+ VisitGraphsInSet@Base 6.1.20030421
+ VisitGraphsOnBsp@Base 6.1.20030421
+ VisitGraphsOnSap@Base 6.1.20030421
+ VisitGraphsOnSep@Base 6.1.20030421
+ VisitGraphsOnSet@Base 6.1.20030421
+ VisitPubdescsInSep@Base 6.1.20030421
+ VisitPubdescsInSet@Base 6.1.20030421
+ VisitPubdescsOnBsp@Base 6.1.20030421
+ VisitPubdescsOnSep@Base 6.1.20030421
+ VisitPubdescsOnSet@Base 6.1.20030421
+ VisitSeqIdsInBioseq@Base 6.1.20050828
+ VisitSeqIdsInSeqAlign@Base 6.1.20031028
+ VisitSeqIdsInSeqAnnot@Base 6.1.20031028
+ VisitSeqIdsInSeqFeat@Base 6.1.20031028
+ VisitSeqIdsInSeqGraph@Base 6.1.20031028
+ VisitSeqIdsInSeqLoc@Base 6.1.20030421
+ VisitSequencesInSep@Base 6.1.20030421
+ VisitSequencesInSet@Base 6.1.20030421
+ VisitSetsInSep@Base 6.1.20030421
+ VisitSetsInSet@Base 6.1.20030421
+ VisitUserFieldsInUfp@Base 6.1.20030421
+ VisitUserFieldsInUop@Base 6.1.20030421
+ VisitUserObjectsInUop@Base 6.1.20030421
+ VnpHeapSort@Base 6.1.20030421
+ VoucherInstitutionIsValid@Base 6.1.20081116
+ WHICH_db_accession@Base 6.1.20030421
+ WaterClosestToLatLon@Base 6.1.20110713
+ WaterContainsLatLon@Base 6.1.20110713
+ WaterDataScaleIs@Base 6.1.20110713
+ WaterExtremesOverlap@Base 6.1.20110713
+ WaterIsInLatLonList@Base 6.1.20110713
+ WaterIsNearLatLon@Base 6.1.20110713
+ WholeIntervalFromSeqId@Base 6.1.20120620
+ WordSubstitutionAsnRead@Base 6.1.20110713
+ WordSubstitutionAsnWrite@Base 6.1.20110713
+ WordSubstitutionFree@Base 6.1.20110713
+ WordSubstitutionNew@Base 6.1.20110713
+ WordSubstitutionSetAsnRead@Base 6.1.20110713
+ WordSubstitutionSetAsnWrite@Base 6.1.20110713
+ WordSubstitutionSetFree@Base 6.1.20110713
+ WriteACEFile@Base 6.1.20081116
+ WriteAsnDiscReport@Base 6.1.20080302
+ WriteAsnWithReplacedDescriptors@Base 6.1.20100808
+ WriteBarcodeDiscrepancies@Base 6.1.20070822
+ WriteBarcodeFailureReport@Base 6.1.20100808
+ WriteBarcodeTagTable@Base 6.1.20070822
+ WriteBarcodeTestCompliance@Base 6.1.20070822
+ WriteBarcodeTestComplianceEx@Base 6.1.20100808
+ WriteBarcodeTestComprehensive@Base 6.1.20080302
+ WriteContigQualScores@Base 6.1.20090301
+ WriteDiscrepancy@Base 6.1.20070822
+ WriteDiscrepancyEx@Base 6.1.20070822
+ WriteFASTAFromAceFile@Base 6.1.20081116
+ WriteFASTAFromContig@Base 6.1.20090301
+ WriteGlobalDiscrepancyReport@Base 6.1.20081116
+ WriteGlobalDiscrepancyReportEx@Base 6.1.20160908
+ WriteKinAllModel@Base 6.1.20030421
+ WritePCRSet@Base 6.1.20070822
+ WritePDBAllModel@Base 6.1.20030421
+ WritePDBRemarks@Base 6.1.20030421
+ WriteStructSummary@Base 6.1.20030421
+ WriteTabTableToFile@Base 6.1.20100808
+ WriteTraceArchiveRead@Base 6.1.20081116
+ WriteTraceAssemblyFromAceFile@Base 6.1.20081116
+ WriteTraceAssemblyFromContig@Base 6.1.20090301
+ WriteTraceAssemblyHeader@Base 6.1.20090301
+ WriteTraceAssemblyTrailer@Base 6.1.20090301
+ XrefTypeAsnRead@Base 6.1.20110713
+ XrefTypeAsnWrite@Base 6.1.20110713
+ XrefTypeFree@Base 6.1.20110713
+ XrefsMatch@Base 6.1.20081116
+ XtraTermsAsnRead@Base 6.1.20050429
+ XtraTermsAsnWrite@Base 6.1.20050429
+ XtraTermsFree@Base 6.1.20050429
+ XtraTermsNew@Base 6.1.20050429
+ aaFeatLoc_to_dnaFeatLoc@Base 6.1.20030421
+ aaLoc_to_dnaLoc@Base 6.1.20030421
+ aaSeqAlign_to_dnaSeqAlign@Base 6.1.20030421
+ aaSeqAnnot_to_dnaSeqAnnotFunc@Base 6.1.20030421
+ aa_to_codon@Base 6.1.20030421
+ aa_to_dnaloc@Base 6.1.20030421
+ alignode_has_alignments@Base 6.1.20030421
+ am_guess_numrows@Base 6.1.20030421
+ am_print_sa_index@Base 6.1.20030421
+ am_print_seqalign_indexes@Base 6.1.20030421
+ annot_is_user_defined@Base 6.1.20030421
+ asn2embl_setup@Base 6.1.20030421
+ asn2ep_setup@Base 6.1.20030421
+ asn2ff_cleanup@Base 6.1.20030421
+ asn2ff_flags@Base 6.1.20030421
+ asn2ff_print@Base 6.1.20030421
+ asn2ff_print_bs@Base 6.1.20030421
+ asn2ff_print_to_mem@Base 6.1.20030421
+ asn2ff_set_output@Base 6.1.20030421
+ asn2ff_setup@Base 6.1.20030421
+ asn2gb_PrintDate@Base 6.1.20040204
+ asn2gb_setup@Base 6.1.20030421
+ asn2gnbk_block_label@Base 6.1.20061015
+ asn2gnbk_cleanup@Base 6.1.20030421
+ asn2gnbk_dbxref@Base 6.1.20030421
+ asn2gnbk_format@Base 6.1.20030421
+ asn2gnbk_setup@Base 6.1.20030421
+ asn2gnbk_source_quals@Base 6.1.20040204
+ asn2gp_setup@Base 6.1.20030421
+ asn2gr_setup@Base 6.1.20030421
+ asn2hp_setup@Base 6.1.20030421
+ asn2pr_setup@Base 6.1.20030421
+ bb_sort@Base 6.1.20030421
+ binary_search_by_chunk@Base 6.1.20030421
+ binary_search_on_uint2_list@Base 6.1.20030421
+ binary_search_on_uint4_list@Base 6.1.20030421
+ binary_search_segment_array@Base 6.1.20030421
+ blk_PrintSABP@Base 6.1.20030421
+ bondList@Base 6.1.20040204
+ buf2array@Base 6.1.20030421
+ build_seqalign_fromstart@Base 6.1.20030421
+ calculate_ruler@Base 6.1.20030421
+ cds_gap_comment@Base 6.1.20080302
+ cds_to_pept@Base 6.1.20030421
+ char_to_insert@Base 6.1.20030421
+ checkCDSselect_forprotein@Base 6.1.20030421
+ checkLinkoutType@Base 6.1.20030421
+ checkOMss_for_itemtype@Base 6.1.20030421
+ check_landmark@Base 6.1.20030421
+ check_match@Base 6.1.20030421
+ check_range@Base 6.1.20030421
+ check_syn@Base 6.1.20030421
+ checkselectsequinfeature_for_editor@Base 6.1.20030421
+ checkseqlocfeature_for_editor@Base 6.1.20030421
+ checkssp_for_editor@Base 6.1.20030421
+ chkloc@Base 6.1.20030421
+ ck_cyto_type@Base 6.1.20030421
+ ck_seqfeat_extra@Base 6.1.20030421
+ clean_annot_for_anp@Base 6.1.20030421
+ cleanup_pub@Base 6.1.20030421
+ collect_anpnode_with_option@Base 6.1.20030421
+ collect_master_align_node@Base 6.1.20030421
+ collect_repeats_and_align@Base 6.1.20030421
+ compare_string@Base 6.1.20030421
+ complement_FlatLoc@Base 6.1.20030421
+ complement_string@Base 6.1.20030421
+ convert_gdata_to_featnode@Base 6.1.20030421
+ current_orgmod_subtype_alist@Base 6.1.20070822
+ current_subsource_subtype_alist@Base 6.1.20070822
+ dashedstring@Base 6.1.20030421
+ data_collect_arrange@Base 6.1.20030421
+ dbtag@Base 6.1.20030421
+ del_ssp_fromid@Base 6.1.20030421
+ delete_qual@Base 6.1.20030421
+ delete_rsite@Base 6.1.20030421
+ discReportBadProteinIdFmt@Base 6.1.20080302
+ discReportDuplicateLocusTagFmt@Base 6.1.20080302
+ discReportDuplicateProteinIDFmt@Base 6.1.20080302
+ discReportDuplicateTranscriptIdFmt@Base 6.1.20080302
+ discReportInconsistentLocusTagPrefixFmt@Base 6.1.20080302
+ discReportInconsistentProteinIDPrefixFmt@Base 6.1.20080302
+ discReportMissingLocusTags@Base 6.1.20080302
+ discReportMissingProteinIDFmt@Base 6.1.20080302
+ discReportMissingTranscriptIDFmt@Base 6.1.20080302
+ discReportOneDuplicateLocusTagFmt@Base 6.1.20080302
+ discReportOneDuplicateProteinIDFmt@Base 6.1.20080302
+ discReportOneDuplicateTranscriptIdFmt@Base 6.1.20080302
+ disc_cnt@Base 6.1.20120620
+ disc_fatal@Base 6.1.20120620
+ discontinued_orgmod_subtype_alist@Base 6.1.20070822
+ discontinued_subsource_subtype_alist@Base 6.1.20070822
+ discouraged_orgmod_subtype_alist@Base 6.1.20070822
+ discouraged_subsource_subtype_alist@Base 6.1.20070822
+ display_ParaG_content@Base 6.1.20030421
+ dnaLoc_to_aaLoc@Base 6.1.20030421
+ do_FlatLoc@Base 6.1.20030421
+ do_Nlm_gbparse_error@Base 6.1.20030421
+ do_loc_errors@Base 6.1.20030421
+ do_no_loc_errors@Base 6.1.20030421
+ empty_citgen@Base 6.1.20080302
+ emptystring@Base 6.1.20030421
+ expand_seq_loc@Base 6.1.20030421
+ extra_disc_cnt@Base 6.1.20120620
+ extra_disc_fatal@Base 6.1.20120620
+ extract_lollipop_feature@Base 6.1.20030421
+ extract_node@Base 6.1.20030421
+ extract_node_list@Base 6.1.20030421
+ extractor_feature_labels@Base 6.1.20110713
+ fasta_lib_sep@Base 6.1.20030421
+ fdlobjAsnLoad@Base 6.1.20030421
+ feature_table_header_format@Base 6.1.20061015
+ ff_AddChar@Base 6.1.20030421
+ ff_AddInteger@Base 6.1.20030421
+ ff_AddString@Base 6.1.20030421
+ ff_AddStringWithTildes@Base 6.1.20030421
+ ff_EndPrint@Base 6.1.20030421
+ ff_MergeString@Base 6.1.20030421
+ ff_RecalculateLinks@Base 6.1.20030421
+ ff_StartPrint@Base 6.1.20030421
+ ff_fflush@Base 6.1.20031028
+ ff_fprintf@Base 6.1.20031028
+ ff_print_string@Base 6.1.20030421
+ ff_print_string_mem@Base 6.1.20030421
+ figure_map_seqid@Base 6.1.20030421
+ find_best_align@Base 6.1.20030421
+ find_big_bioseq@Base 6.1.20030421
+ find_f_pos@Base 6.1.20030421
+ find_flanking_anchor_pos@Base 6.1.20030421
+ find_group_pos@Base 6.1.20030421
+ find_insert_ypos@Base 6.1.20030421
+ find_item@Base 6.1.20030421
+ find_matching_position@Base 6.1.20030421
+ find_nth_align@Base 6.1.20030421
+ find_score_in_align@Base 6.1.20030421
+ find_sip@Base 6.1.20030421
+ find_synonym@Base 6.1.20030421
+ find_this_position_by_anchor@Base 6.1.20030421
+ fini_www@Base 6.1.20030421
+ fix_pages@Base 6.1.20030421
+ flat2asn_delete_accession_user_string@Base 6.1.20030421
+ flat2asn_delete_feature_user_string@Base 6.1.20030421
+ flat2asn_delete_locus_user_string@Base 6.1.20030421
+ flat2asn_init_user_string@Base 6.1.20030421
+ flat2asn_install_accession_user_string@Base 6.1.20030421
+ flat2asn_install_feature_user_string@Base 6.1.20030421
+ flat2asn_install_locus_user_string@Base 6.1.20030421
+ format_article@Base 6.1.20030421
+ format_book@Base 6.1.20030421
+ format_bookarticle@Base 6.1.20030421
+ format_jourarticle@Base 6.1.20030421
+ free_buff@Base 6.1.20030421
+ free_cvp_list@Base 6.1.20030421
+ free_default_matrix@Base 6.1.20030421
+ free_enzyme_list@Base 6.1.20030421
+ free_slp_list@Base 6.1.20030421
+ fuzz_loc@Base 6.1.20030421
+ gather_align_data@Base 6.1.20030421
+ gb_id_make@Base 6.1.20030421
+ general_id_make@Base 6.1.20030421
+ getBioseqNumbering@Base 6.1.20030421
+ getBlastDefLineForSeqId@Base 6.1.20030421
+ getCDSselect@Base 6.1.20030421
+ getOMselect_for_itemtype@Base 6.1.20030421
+ get_Bioseq_type@Base 6.1.20030421
+ get_FISH_align@Base 6.1.20030421
+ get_align_annot_qual@Base 6.1.20030421
+ get_align_ends@Base 6.1.20030421
+ get_align_id@Base 6.1.20030421
+ get_align_len_in_overlap@Base 6.1.20030421
+ get_align_strand@Base 6.1.20030421
+ get_alignment_type@Base 6.1.20030421
+ get_anchor_coordinates@Base 6.1.20030421
+ get_band_name@Base 6.1.20030421
+ get_band_type@Base 6.1.20030421
+ get_bioseq_itemID@Base 6.1.20030421
+ get_boundary@Base 6.1.20030421
+ get_bsp_align@Base 6.1.20030421
+ get_bsp_feat@Base 6.1.20030421
+ get_clone_type@Base 6.1.20030421
+ get_equiv_align@Base 6.1.20030421
+ get_feat_fromid@Base 6.1.20030421
+ get_feat_id@Base 6.1.20030421
+ get_gene_syn@Base 6.1.20030421
+ get_kludge_factor@Base 6.1.20030421
+ get_location_for_query@Base 6.1.20030421
+ get_master@Base 6.1.20030421
+ get_node_num@Base 6.1.20030421
+ get_pnt_val@Base 6.1.20030421
+ get_pos_from_salp@Base 6.1.20030421
+ get_priority_order@Base 6.1.20030421
+ get_prot_feats@Base 6.1.20030421
+ get_pubs@Base 6.1.20030421
+ get_r_strand@Base 6.1.20030421
+ get_seg_num@Base 6.1.20030421
+ get_seglevels@Base 6.1.20030421
+ get_sep_align@Base 6.1.20030421
+ get_seq_name@Base 6.1.20030421
+ get_seqids_with_alignment@Base 6.1.20030421
+ get_sip_comment@Base 6.1.20030421
+ get_synonym@Base 6.1.20030421
+ get_vnp_num@Base 6.1.20030421
+ get_www@Base 6.1.20030421
+ getfirst_sep@Base 6.1.20030421
+ getgapsfromstring@Base 6.1.20030421
+ getminpos_fromOMselect@Base 6.1.20030421
+ goFieldType@Base 6.1.20040204
+ goQualType@Base 6.1.20040204
+ group_FlatLoc@Base 6.1.20030421
+ head_tail_ff@Base 6.1.20030421
+ head_www@Base 6.1.20030421
+ include_ssp@Base 6.1.20030421
+ init_buff@Base 6.1.20030421
+ init_buff_ex@Base 6.1.20030421
+ init_www@Base 6.1.20030421
+ insert_new_rsite@Base 6.1.20030421
+ insertchar@Base 6.1.20030421
+ insertchar_atcaret@Base 6.1.20030421
+ is_annot_for_hist_alignment@Base 6.1.20030421
+ is_dim1seqalign@Base 6.1.20030421
+ is_dim2seqalign@Base 6.1.20030421
+ is_fasta_seqalign@Base 6.1.20030421
+ is_feature_to_buffer@Base 6.1.20030421
+ is_label_match@Base 6.1.20030421
+ is_loc_overlap@Base 6.1.20030421
+ is_lod_score_annot@Base 6.1.20030421
+ is_map_segment@Base 6.1.20030421
+ is_real_id@Base 6.1.20030421
+ is_salp_in_sap@Base 6.1.20030421
+ is_sameId@Base 6.1.20030421
+ is_samepos@Base 6.1.20030421
+ is_sameses@Base 6.1.20030421
+ is_samess_ses@Base 6.1.20030421
+ is_samessp@Base 6.1.20030421
+ is_selectedbyID@Base 6.1.20030421
+ is_sequenced@Base 6.1.20030421
+ is_seqvisible@Base 6.1.20030421
+ jybitnum@Base 6.1.20030421
+ kAllowModAtEndOfTaxname@Base 6.1.20160908
+ kAltSpliceFlag@Base 6.1.20160908
+ kAutoDefOptions@Base 6.1.20160908
+ kCDSVariant@Base 6.1.20090301
+ kCommentFeat@Base 6.1.20160908
+ kCompleteGenome@Base 6.1.20160908
+ kCompleteSequence@Base 6.1.20160908
+ kDelete@Base 6.1.20160908
+ kDoNotApplyToAff@Base 6.1.20160908
+ kDoNotApplyToCf@Base 6.1.20160908
+ kDoNotApplyToNr@Base 6.1.20160908
+ kDoNotApplyToSp@Base 6.1.20160908
+ kFeatureListType@Base 6.1.20160908
+ kGeneClusterOppStrand@Base 6.1.20160908
+ kHIVRule@Base 6.1.20160908
+ kIncludeCountryText@Base 6.1.20160908
+ kKeep3UTRs@Base 6.1.20160908
+ kKeep5UTRs@Base 6.1.20160908
+ kKeepAfterSemicolon@Base 6.1.20160908
+ kKeepExons@Base 6.1.20160908
+ kKeepIntrons@Base 6.1.20160908
+ kKeepLTRs@Base 6.1.20160908
+ kKeepMobileElement@Base 6.1.20160908
+ kKeepNoncodingProductFeat@Base 6.1.20160908
+ kKeepPrecursorRNA@Base 6.1.20160908
+ kKeepPromoters@Base 6.1.20160908
+ kKeepRepeatRegion@Base 6.1.20160908
+ kKeepncRNA@Base 6.1.20160908
+ kKeepuOrf@Base 6.1.20160908
+ kLeaveParenthetical@Base 6.1.20160908
+ kListAllFeatures@Base 6.1.20160908
+ kMaxMods@Base 6.1.20160908
+ kMiscFeatRule@Base 6.1.20160908
+ kModifierList@Base 6.1.20160908
+ kNoncodingProductFeat@Base 6.1.20160908
+ kNuclearCopyFlag@Base 6.1.20160908
+ kNumSevChangeRules@Base 6.1.20110713
+ kNumSuppressionRules@Base 6.1.20110713
+ kNumWGSOrganelles@Base 6.1.20081116
+ kOrgMods@Base 6.1.20160908
+ kOverlappingCDSNeedsNoteFmt@Base 6.1.20081116
+ kOverlappingCDSNoteText@Base 6.1.20081116
+ kPartialGenome@Base 6.1.20160908
+ kPartialSequence@Base 6.1.20160908
+ kPreferClone@Base 6.1.20160908
+ kPreferIsolate@Base 6.1.20160908
+ kProductFlag@Base 6.1.20160908
+ kSequence@Base 6.1.20160908
+ kSpecifyNuclearProduct@Base 6.1.20160908
+ kSubSources@Base 6.1.20160908
+ kSubmitterUpdateText@Base 6.1.20120620
+ kSuppressAllele@Base 6.1.20160908
+ kSuppressFeatureAltSplice@Base 6.1.20160908
+ kSuppressLocusTags@Base 6.1.20160908
+ kSuppressMobileElementSubfeatures@Base 6.1.20160908
+ kSuppressedFeatures@Base 6.1.20160908
+ kTaxnameAfterBinomialString@Base 6.1.20100808
+ kUseFakePromoters@Base 6.1.20160908
+ kUseLabels@Base 6.1.20160908
+ kUseNcRNAComment@Base 6.1.20160908
+ kWantBoth@Base 6.1.20160908
+ k_NumQuantityWords@Base 6.1.20100808
+ k_NumSpecialPubFieldWords@Base 6.1.20100808
+ kmRNAVariant@Base 6.1.20090301
+ label_feature@Base 6.1.20030421
+ latlon_onedegree@Base 6.1.20110713
+ legalDbXrefs@Base 6.1.20040204
+ legalRefSeqDbXrefs@Base 6.1.20040204
+ legalSrcDbXrefs@Base 6.1.20090301
+ link_loc@Base 6.1.20030421
+ load_default_matrix@Base 6.1.20030421
+ load_gdata_marks@Base 6.1.20030421
+ load_seq_data@Base 6.1.20030421
+ loc_offset@Base 6.1.20030421
+ local_id_make@Base 6.1.20030421
+ locate_in_seqalign@Base 6.1.20030421
+ lr_offset_in_slp@Base 6.1.20030421
+ mRNAEvidenceComment@Base 6.1.20030421
+ m_id_match@Base 6.1.20030421
+ make_Bioseq_list@Base 6.1.20030421
+ make_bogo_product@Base 6.1.20030421
+ make_cds_paragraph@Base 6.1.20030421
+ make_empty@Base 6.1.20030421
+ make_enzyme_list@Base 6.1.20030421
+ make_ext_feat@Base 6.1.20030421
+ make_fake_cds@Base 6.1.20030421
+ make_gene_data@Base 6.1.20030421
+ make_master@Base 6.1.20030421
+ make_range@Base 6.1.20030421
+ make_scale_bar_str@Base 6.1.20030421
+ make_seqentry_for_seqentry@Base 6.1.20040505
+ map_one_location@Base 6.1.20030421
+ map_unit_label@Base 6.1.20030421
+ matching_seqid@Base 6.1.20030421
+ merge_two_align@Base 6.1.20030421
+ multseqalign_from_pairseqalign@Base 6.1.20030421
+ multseqalign_to_pairseqalign@Base 6.1.20030421
+ ncrnaClassList@Base 6.1.20080302
+ new_seledstruct@Base 6.1.20030421
+ new_seledstruct_fromseqloc@Base 6.1.20030421
+ next_notemptyline@Base 6.1.20030421
+ nomial_keywords@Base 6.1.20080302
+ not_empty_string@Base 6.1.20030421
+ num_bad_misc_comment_phrases@Base 6.1.20090719
+ num_cds_product_find@Base 6.1.20100808
+ num_ignore_similar_product_words@Base 6.1.20070822
+ num_nomial_keywords@Base 6.1.20080302
+ num_similar_product_words@Base 6.1.20070822
+ num_suspect_phrases@Base 6.1.20070822
+ num_suspect_product_terms@Base 6.1.20100808
+ num_suspect_rna_product_names@Base 6.1.20090301
+ num_suspect_rrna_product_names@Base 6.1.20090719
+ num_suspicious_note_phrases@Base 6.1.20081116
+ objalignlocAsnLoad@Base 6.1.20030421
+ objent2AsnLoad@Base 6.1.20030421
+ objentgeneAsnLoad@Base 6.1.20050429
+ objgbseqAsnLoad@Base 6.1.20030421
+ objinsdseqAsnLoad@Base 6.1.20040505
+ objmacroAsnLoad@Base 6.1.20080302
+ objmdrsAsnLoad@Base 6.1.20030421
+ objmimAsnLoad@Base 6.1.20030421
+ objmla2AsnLoad@Base 6.1.20070822
+ objmmdb1AsnLoad@Base 6.1.20030421
+ objmmdb2AsnLoad@Base 6.1.20030421
+ objmmdb3AsnLoad@Base 6.1.20030421
+ objprojAsnLoad@Base 6.1.20030421
+ objpubmeAsnLoad@Base 6.1.20030421
+ objscorematAsnLoad@Base 6.1.20070822
+ objtableAsnLoad@Base 6.1.20080302
+ objtax3AsnLoad@Base 6.1.20041020
+ objtseqAsnLoad@Base 6.1.20030421
+ objvalidAsnLoad@Base 6.1.20090719
+ orgModToSourceIdx@Base 6.1.20040204
+ orgmod_aliases@Base 6.1.20070822
+ orgmod_subtype@Base 6.1.20030421
+ overlapp_ssp@Base 6.1.20030421
+ overlapp_startssp@Base 6.1.20030421
+ precede_ssp@Base 6.1.20030421
+ print_label@Base 6.1.20030421
+ print_label_to_buffer@Base 6.1.20030421
+ print_label_to_buffer_all@Base 6.1.20030421
+ print_label_to_buffer_all_ex@Base 6.1.20030421
+ print_protein_for_cds@Base 6.1.20030421
+ productInterval_to_locationIntervals@Base 6.1.20030421
+ productLoc_to_locationLoc@Base 6.1.20030421
+ purge_string@Base 6.1.20030421
+ query_number_glb@Base 6.1.20030421
+ qvalue_extract@Base 6.1.20030421
+ rRNACountFeaturesAndFindDups@Base 6.1.20070822
+ read_buffer_fromalignnode@Base 6.1.20030421
+ readbuff_fromseqalign@Base 6.1.20030421
+ recombinationClassList@Base 6.1.20170106
+ regulatoryClassList@Base 6.1.20160908
+ remove_annot@Base 6.1.20030421
+ remove_feat@Base 6.1.20030421
+ remove_node@Base 6.1.20030421
+ replace_bytestore_data@Base 6.1.20030421
+ reverse_string@Base 6.1.20030421
+ s_AddPeriodToEnd@Base 6.1.20040204
+ s_AuthorFixActionNames@Base 6.1.20110713
+ s_OtherGetValue@Base 6.1.20030421
+ s_QuantityWords@Base 6.1.20100808
+ s_RemovePeriodFromEnd@Base 6.1.20040204
+ s_SpecialPubFieldWords@Base 6.1.20100808
+ s_tRNAGeneFromProduct@Base 6.1.20090301
+ s_witch@Base 6.1.20030421
+ secStrText@Base 6.1.20040204
+ select_overlap_loc@Base 6.1.20030421
+ seqid_name@Base 6.1.20030421
+ seqid_to_string@Base 6.1.20030421
+ seqloc2fuzzloc@Base 6.1.20030421
+ ses_to_ss@Base 6.1.20030421
+ sesp_to_slp@Base 6.1.20030421
+ set_flags@Base 6.1.20030421
+ set_option_for_collect_align@Base 6.1.20030421
+ set_seqnot_visible@Base 6.1.20030421
+ set_seqvisible@Base 6.1.20030421
+ setposition_toses@Base 6.1.20030421
+ setposition_tossp@Base 6.1.20030421
+ showfastagap_fromalign@Base 6.1.20030421
+ siteList@Base 6.1.20040204
+ slp_list_len@Base 6.1.20030421
+ sort_align_by_score@Base 6.1.20030421
+ spec_wd_cnt@Base 6.1.20160908
+ spec_words@Base 6.1.20160908
+ ss_to_ses@Base 6.1.20030421
+ start_new_stack@Base 6.1.20030421
+ stringhasnochar@Base 6.1.20030421
+ stringhasnocharplus@Base 6.1.20030421
+ subSourceToSourceIdx@Base 6.1.20040204
+ subsource_aliases@Base 6.1.20070822
+ subtype@Base 6.1.20030421
+ succeed_ssp@Base 6.1.20030421
+ swap@Base 6.1.20030421
+ tRNACountFeaturesAndFindDups@Base 6.1.20070822
+ tRNAFindBadLength@Base 6.1.20070822
+ tail_www@Base 6.1.20030421
+ tie_next@Base 6.1.20030421
+ tie_qual@Base 6.1.20030421
+ tloc_offset@Base 6.1.20030421
+ to_lower@Base 6.1.20030421
+ trnaMatchFree@Base 6.1.20160908
+ trnaMatchNew@Base 6.1.20160908
+ tx_fprintf@Base 6.1.20031028
+ update_seq_loc@Base 6.1.20030421
+ use_multiple_dimension@Base 6.1.20030421
+ water_onedegree@Base 6.1.20110713
+ write_out_put@Base 6.1.20030421
+ www_PrintComment@Base 6.1.20030421
+ www_accession@Base 6.1.20030421
+ www_coded_by@Base 6.1.20030421
+ www_db_xref@Base 6.1.20030421
+ www_dbsource@Base 6.1.20030421
+ www_extra_acc@Base 6.1.20030421
+ www_featkey@Base 6.1.20030421
+ www_featloc@Base 6.1.20030421
+ www_gcode@Base 6.1.20030421
+ www_genpept_gi@Base 6.1.20030421
+ www_map@Base 6.1.20030421
+ www_muid@Base 6.1.20030421
+ www_note_gi@Base 6.1.20030421
+ www_organism@Base 6.1.20030421
+ www_protein_id@Base 6.1.20030421
+ www_source@Base 6.1.20030421
+ www_taxid@Base 6.1.20030421
+ www_xref@Base 6.1.20030421
+ www_xref_button@Base 6.1.20030421
+ x_ParFlat_GBFeat@Base 6.1.20030421
+ x_ParFlat_GBQual_names@Base 6.1.20030421
+libncbitool.so.6 libncbi6 #MINVER#
+ A@Base 6.1.20030421
+ AA20alpha@Base 6.1.20030421
+ ACT_BuildProfile@Base 6.1.20030421
+ ACT_CalcScore@Base 6.1.20030421
+ ACT_CleanUpAlignments@Base 6.1.20030421
+ ACT_CompareProfileConfidence@Base 6.1.20030421
+ ACT_EstimateConfidence@Base 6.1.20030421
+ ACT_FindCpG@Base 6.1.20030421
+ ACT_FindPeakScores@Base 6.1.20030421
+ ACT_FindPiece@Base 6.1.20030421
+ ACT_GetNthSeqRangeInSASet@Base 6.1.20030421
+ ACT_GetResidue@Base 6.1.20030421
+ ACT_MakeProfileFromSA@Base 6.1.20030421
+ ACT_PlaceByScore@Base 6.1.20030421
+ ACT_ProfileFree@Base 6.1.20030421
+ ACT_ProfileNew@Base 6.1.20030421
+ ACT_ProfileSetFree@Base 6.1.20030421
+ ACT_RemoveInconsistentAlnsFromSet@Base 6.1.20050429
+ ACT_ScoreProfile@Base 6.1.20030421
+ ACT_SortAndTruncate@Base 6.1.20030421
+ ACT_SortProfilesByConfidence@Base 6.1.20030421
+ ALIGN@Base 6.1.20030421
+ AStringIgnoreSpaceCmp@Base 6.1.20030421
+ AcknowledgeBlastQuery@Base 6.1.20030421
+ AddReplaceQual@Base 6.1.20030421
+ AddSeqLocToCodonTable@Base 6.1.20030421
+ AddToList@Base 6.1.20030421
+ AdjustAllTheoreticalCoordinates@Base 6.1.20030421
+ AdjustOffsetsInBLASTHitList@Base 6.1.20030421
+ AdjustTheoreticalCoordinates@Base 6.1.20030421
+ AlignmRNA2genomic@Base 6.1.20030421
+ AlnMgr2TruncateSAP@Base 6.1.20030421
+ AlphaCopy@Base 6.1.20030421
+ AlphaFree@Base 6.1.20030421
+ AluFeat@Base 6.1.20030421
+ AnnotateRegionsFromCDD@Base 6.1.20030421
+ B2SPssmCleanUpSearch@Base 6.1.20030421
+ B2SPssmMultipleQueries@Base 6.1.20030421
+ B2SPssmOnTheFly@Base 6.1.20030421
+ B2SPssmOnTheFlyByLoc@Base 6.1.20030421
+ B2SPssmSetupSearch@Base 6.1.20030421
+ B@Base 6.1.20030421
+ BAND_LOCAL_ALIGN@Base 6.1.20030421
+ BLASTAddBlastDBTitleToSeqAnnot@Base 6.1.20030421
+ BLASTAddBlastDBTitleToSeqAnnotEx@Base 6.1.20030421
+ BLASTCalculateSearchSpace@Base 6.1.20030421
+ BLASTCheckHSPInclusion@Base 6.1.20051206
+ BLASTFileFunc@Base 6.1.20030421
+ BLASTFilterOverlapRegions@Base 6.1.20030421
+ BLASTGetDatabaseTitleFromSeqAnnot@Base 6.1.20030421
+ BLASTHSPSegmentFromSeqAlign@Base 6.1.20030421
+ BLASTHspToStdSeg@Base 6.1.20030421
+ BLASTOptionDelete@Base 6.1.20030421
+ BLASTOptionNew@Base 6.1.20030421
+ BLASTOptionNewEx@Base 6.1.20030421
+ BLASTOptionSetGapParams@Base 6.1.20030421
+ BLASTOptionValidate@Base 6.1.20030421
+ BLASTOptionValidateEx@Base 6.1.20030421
+ BLASTPerform2PassSearch@Base 6.1.20030421
+ BLASTPerformFinalSearch@Base 6.1.20030421
+ BLASTPerformSearch@Base 6.1.20030421
+ BLASTPerformSearchWithReadDb@Base 6.1.20030421
+ BLASTPostSearchLogic@Base 6.1.20030421
+ BLASTResultFreeHsp@Base 6.1.20030421
+ BLASTResultHitlistFree@Base 6.1.20030421
+ BLASTResultHitlistFreeEx@Base 6.1.20030421
+ BLASTResultHitlistNew@Base 6.1.20030421
+ BLASTResultHspScoreCmp@Base 6.1.20050429
+ BLASTResultsStructDelete@Base 6.1.20030421
+ BLASTResultsStructNew@Base 6.1.20030421
+ BLASTSetUpSearch@Base 6.1.20030421
+ BLASTSetUpSearchByLoc@Base 6.1.20030421
+ BLASTSetUpSearchByLocWithReadDb@Base 6.1.20030421
+ BLASTSetUpSearchByLocWithReadDbEx@Base 6.1.20030421
+ BLASTSetUpSearchInternalByLoc@Base 6.1.20030421
+ BLASTSetUpSearchWithReadDb@Base 6.1.20030421
+ BLASTSetUpSearchWithReadDbEx@Base 6.1.20030421
+ BLASTSetUpSearchWithReadDbInternal@Base 6.1.20030421
+ BLASTSetUpSearchWithReadDbInternalEx@Base 6.1.20030421
+ BLASTSetUpSearchWithReadDbInternalMult@Base 6.1.20030421
+ BLASTSubjectInfoDestruct@Base 6.1.20030421
+ BLASTSubjectInfoNew@Base 6.1.20030421
+ BLASTUpdateSeqIdInSeqInt@Base 6.1.20030421
+ BLAST_ExtendWordDestruct@Base 6.1.20030421
+ BLAST_ExtendWordNew@Base 6.1.20030421
+ BLAST_ExtendWordParamsNew@Base 6.1.20030421
+ BLAST_HSPFree@Base 6.1.20040204
+ BLAST_MatrixDestruct@Base 6.1.20030421
+ BLAST_MatrixFetch@Base 6.1.20030421
+ BLAST_MatrixFill@Base 6.1.20030421
+ BLAST_ScoreBlkDestruct@Base 6.1.20030421
+ BLAST_ScoreBlkNew@Base 6.1.20030421
+ BLAST_Wizard@Base 6.1.20030421
+ BLAST_WizardOptionsBlkDone@Base 6.1.20030421
+ BLAST_WizardOptionsBlkInit@Base 6.1.20030421
+ BLAST_WizardOptionsMaskInit@Base 6.1.20030421
+ BLAST_WordFinderDestruct@Base 6.1.20030421
+ BLAST_WordFinderNew@Base 6.1.20030421
+ BSComparison@Base 6.1.20030421
+ BSComparisonEx@Base 6.1.20030421
+ BUCKETS@Base 6.1.20030421
+ BXMLBuildOneIteration@Base 6.1.20030421
+ BXMLBuildOneQueryIteration@Base 6.1.20030421
+ BXMLBuildStatistics@Base 6.1.20030421
+ BXMLCreateBlastOutputHead@Base 6.1.20030421
+ BXMLGetHspFromSeqAlign@Base 6.1.20030421
+ BXMLGetSeqLineForDenseDiag@Base 6.1.20030421
+ BXMLGetSeqLineForDenseSeg@Base 6.1.20030421
+ BXMLGetSeqLineForStdSeg@Base 6.1.20030421
+ BXMLGetSeqLines@Base 6.1.20030421
+ BXMLPrintMultiQueryOutput@Base 6.1.20030421
+ BXMLPrintOutput@Base 6.1.20030421
+ BXMLSeqAlignToHits@Base 6.1.20030421
+ BiasScoreBioseq@Base 6.1.20030421
+ BinarySearchInt4@Base 6.1.20030421
+ BioSourceCommon@Base 6.1.20030421
+ BioSourceMerge@Base 6.1.20030421
+ BioSourceToGeneticCode@Base 6.1.20030421
+ BioseqBlastEngine@Base 6.1.20030421
+ BioseqBlastEngineByLoc@Base 6.1.20030421
+ BioseqBlastEngineByLocEx@Base 6.1.20030421
+ BioseqBlastEngineByLocWithCallback@Base 6.1.20030421
+ BioseqBlastEngineByLocWithCallbackMult@Base 6.1.20030421
+ BioseqBlastEngineCore@Base 6.1.20030421
+ BioseqBlastEngineEx@Base 6.1.20030421
+ BioseqBlastEngineWithCallback@Base 6.1.20030421
+ BioseqBlastEngineWithCallbackMult@Base 6.1.20030421
+ BioseqDust@Base 6.1.20030421
+ BioseqDustEx@Base 6.1.20070822
+ BioseqDustWrap@Base 6.1.20030421
+ BioseqHitRangeEngine@Base 6.1.20030421
+ BioseqHitRangeEngineByLoc@Base 6.1.20030421
+ BioseqHitRangeEngineCore@Base 6.1.20030421
+ BioseqMegaBlastEngine@Base 6.1.20030421
+ BioseqMegaBlastEngineByLoc@Base 6.1.20030421
+ BioseqMegaBlastEngineCore@Base 6.1.20030421
+ BioseqSeg@Base 6.1.20030421
+ BioseqSegAa@Base 6.1.20030421
+ BioseqSegEx@Base 6.1.20030421
+ BioseqSegNa@Base 6.1.20030421
+ BlastAdjustDbNumbers@Base 6.1.20030421
+ BlastAllWordDestruct@Base 6.1.20030421
+ BlastAllWordNew@Base 6.1.20030421
+ BlastBandAlignFromBlastSeqAlign@Base 6.1.20030421
+ BlastBioseqFilter@Base 6.1.20030421
+ BlastBioseqFilterEx@Base 6.1.20030421
+ BlastClusterHitsFromSeqAlign@Base 6.1.20030421
+ BlastComputeLengthAdjustment@Base 6.1.20040505
+ BlastConstructErrorMessage@Base 6.1.20030421
+ BlastConstructFilterString@Base 6.1.20030421
+ BlastConvertDNASeqLoc@Base 6.1.20030421
+ BlastConvertProteinSeqLoc@Base 6.1.20030421
+ BlastCreateQueryDNAP@Base 6.1.20030421
+ BlastCreateVirtualOIDList@Base 6.1.20030421
+ BlastCutoffs@Base 6.1.20030421
+ BlastDeleteFakeBioseq@Base 6.1.20030421
+ BlastDeleteHeap@Base 6.1.20030421
+ BlastDeleteUserErrorString@Base 6.1.20030421
+ BlastDestroyErrorMessage@Base 6.1.20030421
+ BlastDuplicateMultQueries@Base 6.1.20030421
+ BlastErrorChainDestroy@Base 6.1.20030421
+ BlastErrorPrint@Base 6.1.20030421
+ BlastErrorPrintExtra@Base 6.1.20030421
+ BlastErrorToString@Base 6.1.20050429
+ BlastExtendWordExit@Base 6.1.20030421
+ BlastFillQueryOffsets@Base 6.1.20030421
+ BlastFindWords@Base 6.1.20030421
+ BlastFreeHeap@Base 6.1.20030421
+ BlastFreeQueryDNAP@Base 6.1.20030421
+ BlastGapDecayDivisor@Base 6.1.20040505
+ BlastGetAllowedGis@Base 6.1.20030421
+ BlastGetDbChunk@Base 6.1.20030421
+ BlastGetFirstAndLastContext@Base 6.1.20030421
+ BlastGetGapAlgnTbck@Base 6.1.20030421
+ BlastGetGapAlgnTbckWithReaddb@Base 6.1.20030421
+ BlastGetGappedScore@Base 6.1.20030421
+ BlastGetGappedScoreWithReaddb@Base 6.1.20030421
+ BlastGetLetterIndex@Base 6.1.20030421
+ BlastGetNonSumStatsEvalue@Base 6.1.20030421
+ BlastGetNumIdentical@Base 6.1.20030421
+ BlastGetPhiReference@Base 6.1.20030421
+ BlastGetProgramName@Base 6.1.20030421
+ BlastGetProgramNumber@Base 6.1.20030421
+ BlastGetReference@Base 6.1.20030421
+ BlastGetReleaseDate@Base 6.1.20030421
+ BlastGetSequenceFromBioseq@Base 6.1.20030421
+ BlastGetStdAlphabet@Base 6.1.20030421
+ BlastGetSubjectId@Base 6.1.20030421
+ BlastGetSubjectIdEx@Base 6.1.20030421
+ BlastGetTypes@Base 6.1.20030421
+ BlastGetVersionNumber@Base 6.1.20030421
+ BlastGetVirtualOIDList@Base 6.1.20030421
+ BlastGiListDestruct@Base 6.1.20030421
+ BlastGiListNew@Base 6.1.20030421
+ BlastHSPGetNumIdentical@Base 6.1.20030421
+ BlastHitListDestruct@Base 6.1.20030421
+ BlastHitListNew@Base 6.1.20030421
+ BlastHitListPurge@Base 6.1.20030421
+ BlastHitRangeDestruct@Base 6.1.20030421
+ BlastHitRangeNew@Base 6.1.20030421
+ BlastInsertList2Heap@Base 6.1.20030421
+ BlastKarlinBlkCalc@Base 6.1.20030421
+ BlastKarlinBlkCreate@Base 6.1.20030421
+ BlastKarlinBlkDestruct@Base 6.1.20030421
+ BlastKarlinBlkGappedCalc@Base 6.1.20030421
+ BlastKarlinBlkGappedCalcEx@Base 6.1.20030421
+ BlastKarlinBlkNuclGappedCalc@Base 6.1.20051206
+ BlastKarlinBlkStandardCalc@Base 6.1.20030421
+ BlastKarlinBlkStandardCalcEx@Base 6.1.20030421
+ BlastKarlinEtoP@Base 6.1.20030421
+ BlastKarlinEtoS@Base 6.1.20030421
+ BlastKarlinEtoS_simple@Base 6.1.20030421
+ BlastKarlinGetDefaultMatrixValues@Base 6.1.20030421
+ BlastKarlinGetMatrixValues@Base 6.1.20030421
+ BlastKarlinGetMatrixValuesEx2@Base 6.1.20030421
+ BlastKarlinGetMatrixValuesEx@Base 6.1.20030421
+ BlastKarlinGetNuclAlphaBeta@Base 6.1.20051206
+ BlastKarlinLHtoK@Base 6.1.20030421
+ BlastKarlinLambdaNR@Base 6.1.20030421
+ BlastKarlinPtoE@Base 6.1.20030421
+ BlastKarlinReportAllowedValues@Base 6.1.20030421
+ BlastKarlinStoE@Base 6.1.20030421
+ BlastKarlinStoE_simple@Base 6.1.20030421
+ BlastKarlinStoLen@Base 6.1.20030421
+ BlastKarlinStoP@Base 6.1.20030421
+ BlastKarlinStoP_simple@Base 6.1.20030421
+ BlastKarlinkGapBlkFill@Base 6.1.20030421
+ BlastLCaseMaskTheResidues@Base 6.1.20030421
+ BlastLargeGapSumE@Base 6.1.20030421
+ BlastLinkHsps@Base 6.1.20030421
+ BlastMakeCopyQueryDNAP@Base 6.1.20030421
+ BlastMakeFakeBioseq@Base 6.1.20030421
+ BlastMakeFakeBspConcat@Base 6.1.20030421
+ BlastMakeMultQueries@Base 6.1.20030421
+ BlastMakeTempProteinBioseq@Base 6.1.20030421
+ BlastMaskTheResidues@Base 6.1.20030421
+ BlastMatrixRescaleDestruct@Base 6.1.20030421
+ BlastMatrixRescaleNew@Base 6.1.20030421
+ BlastMatrixToTxMatrix@Base 6.1.20030421
+ BlastMultQueriesDestruct@Base 6.1.20051206
+ BlastNTGetGappedScore@Base 6.1.20030421
+ BlastNTPreliminaryGappedScore@Base 6.1.20030421
+ BlastNewFindWords@Base 6.1.20030421
+ BlastNewFindWordsEx@Base 6.1.20030421
+ BlastNewFindWords_Old@Base 6.1.20030421
+ BlastNtFindWords@Base 6.1.20030421
+ BlastNtSaveCurrentHsp@Base 6.1.20030421
+ BlastNtSaveCurrentHspGapped@Base 6.1.20030421
+ BlastNtWordExtend@Base 6.1.20030421
+ BlastNtWordUngappedExtend@Base 6.1.20030421
+ BlastOtherReturnsFree@Base 6.1.20030421
+ BlastOtherReturnsPrepare@Base 6.1.20030421
+ BlastOutputAsnRead@Base 6.1.20030421
+ BlastOutputAsnWrite@Base 6.1.20030421
+ BlastOutputFree@Base 6.1.20030421
+ BlastOutputNew@Base 6.1.20030421
+ BlastPSIMaxScoreGet@Base 6.1.20030421
+ BlastParseInputString@Base 6.1.20030421
+ BlastPopulateAllWordArrays@Base 6.1.20030421
+ BlastPreliminaryGappedScore@Base 6.1.20030421
+ BlastPrintAlignInfo@Base 6.1.20030421
+ BlastPrintFilterWarning@Base 6.1.20030421
+ BlastPrintPhiReference@Base 6.1.20030421
+ BlastPrintReference@Base 6.1.20030421
+ BlastPrintTabularResults@Base 6.1.20031028
+ BlastPrintTabulatedResults@Base 6.1.20030421
+ BlastPrintTabulatedResultsEx@Base 6.1.20030421
+ BlastPrintVersionInfo@Base 6.1.20030421
+ BlastPrintVersionInfoEx@Base 6.1.20030421
+ BlastProcessGiLists@Base 6.1.20030421
+ BlastPruneHitsFromSeqAlign@Base 6.1.20030421
+ BlastPruneSapStructDestruct@Base 6.1.20030421
+ BlastPruneSeqAlignByEvalueRange@Base 6.1.20030421
+ BlastPruneSeqAlignByGiList@Base 6.1.20030421
+ BlastPruneSeqAlignBySortedGiList@Base 6.1.20050429
+ BlastQuerySequenceSetUp@Base 6.1.20030421
+ BlastReapHitlistByEvalue@Base 6.1.20030421
+ BlastRepresentativeResidues@Base 6.1.20030421
+ BlastResCompDestruct@Base 6.1.20030421
+ BlastResCompNew@Base 6.1.20030421
+ BlastResCompStr@Base 6.1.20030421
+ BlastResFreqClr@Base 6.1.20030421
+ BlastResFreqDestruct@Base 6.1.20030421
+ BlastResFreqFree@Base 6.1.20030421
+ BlastResFreqNew@Base 6.1.20030421
+ BlastResFreqNormalize@Base 6.1.20030421
+ BlastResFreqResComp@Base 6.1.20030421
+ BlastResFreqStdComp@Base 6.1.20030421
+ BlastResFreqString@Base 6.1.20030421
+ BlastSaveCurrentHitlist@Base 6.1.20030421
+ BlastSaveCurrentHsp@Base 6.1.20030421
+ BlastSaveCurrentHspGapped@Base 6.1.20030421
+ BlastScaleMatrix@Base 6.1.20030421
+ BlastScoreBlkFill@Base 6.1.20030421
+ BlastScoreBlkMatCreateEx@Base 6.1.20030421
+ BlastScoreBlkMatFill@Base 6.1.20030421
+ BlastScoreBlkMatRead@Base 6.1.20030421
+ BlastScoreBlkMaxScoreSet@Base 6.1.20030421
+ BlastScoreFreqDestruct@Base 6.1.20030421
+ BlastScoreFreqNew@Base 6.1.20030421
+ BlastScoreSetAmbigRes@Base 6.1.20030421
+ BlastSearchBlkDestruct@Base 6.1.20030421
+ BlastSearchBlkDuplicate@Base 6.1.20030421
+ BlastSearchBlkNew@Base 6.1.20030421
+ BlastSearchBlkNewExtra@Base 6.1.20030421
+ BlastSeqLocFillDoubleInt@Base 6.1.20030421
+ BlastSeqLocFillDoubleIntEx@Base 6.1.20030421
+ BlastSeqLocFillDoubleIntRev@Base 6.1.20030421
+ BlastSeqLocFilter@Base 6.1.20030421
+ BlastSeqLocFilterEx@Base 6.1.20030421
+ BlastSequenceAddSequence@Base 6.1.20030421
+ BlastSequenceBlkDestruct@Base 6.1.20030421
+ BlastSequencesOnTheFly@Base 6.1.20030421
+ BlastSequencesOnTheFlyByLoc@Base 6.1.20030421
+ BlastSequencesOnTheFlyEx@Base 6.1.20030421
+ BlastSetUserErrorString@Base 6.1.20030421
+ BlastSingleQueryResultSize@Base 6.1.20051206
+ BlastSmallGapSumE@Base 6.1.20030421
+ BlastStartAwakeThread@Base 6.1.20030421
+ BlastStopAwakeThread@Base 6.1.20030421
+ BlastSumP@Base 6.1.20030421
+ BlastThrInfoFree@Base 6.1.20030421
+ BlastThrInfoNew@Base 6.1.20030421
+ BlastTickProc@Base 6.1.20030421
+ BlastTimeFillStructure@Base 6.1.20030421
+ BlastTranslateUnambiguousSequence@Base 6.1.20030421
+ BlastTwoSequences@Base 6.1.20030421
+ BlastTwoSequencesByLoc@Base 6.1.20030421
+ BlastTwoSequencesByLocEx@Base 6.1.20030421
+ BlastTwoSequencesByLocWithCallback@Base 6.1.20030421
+ BlastTwoSequencesEx@Base 6.1.20030421
+ BlastTwoSequencesWithCallback@Base 6.1.20030421
+ BlastUnevenGapSumE@Base 6.1.20030421
+ BposComputation@Base 6.1.20030421
+ CAdjustmentGetReference@Base 6.1.20050605
+ CAdjustmentPrintReference@Base 6.1.20050605
+ CBStatisticsGetReference@Base 6.1.20050605
+ CBStatisticsPrintReference@Base 6.1.20050605
+ CC_ExtendSeqAlign@Base 6.1.20030421
+ CSIM@Base 6.1.20030421
+ CatenateProfile@Base 6.1.20030421
+ CdCheck@Base 6.1.20030421
+ CdCheckEx@Base 6.1.20110713
+ CddHitDestruct@Base 6.1.20030421
+ CddHitNew@Base 6.1.20030421
+ ChangeCitSub@Base 6.1.20030421
+ ChangeGlobalBandMatrix@Base 6.1.20030421
+ ChangeReplaceToQual@Base 6.1.20030421
+ ChangeTreeScale@Base 6.1.20030421
+ Change_Loc_Strand@Base 6.1.20030421
+ CheckBS@Base 6.1.20030421
+ CheckCitSubNew@Base 6.1.20030421
+ CheckLocWhole@Base 6.1.20030421
+ CheckMaps@Base 6.1.20030421
+ CheckOverlap@Base 6.1.20030421
+ CheckQuals@Base 6.1.20030421
+ CheckQualsWithComm@Base 6.1.20030421
+ CheckSegDescrChoice@Base 6.1.20030421
+ CheckStartForGappedAlignment@Base 6.1.20030421
+ ChkNucProt@Base 6.1.20030421
+ ChkSegset@Base 6.1.20030421
+ CkOrg@Base 6.1.20030421
+ CleanNewList@Base 6.1.20030421
+ CleanPattern@Base 6.1.20030421
+ CleanUpPseudoProducts@Base 6.1.20030421
+ CleanUpSeqDescrChoice@Base 6.1.20030421
+ CleanupEmptyFeatCallback@Base 6.1.20030421
+ CleanupGenbankCallback@Base 6.1.20030421
+ ClearBatchSuggestFrames@Base 6.1.20030421
+ ClearBatchSuggestNucleotide@Base 6.1.20030421
+ ClearNonMetOrfs@Base 6.1.20030421
+ ClearSeqRec@Base 6.1.20030421
+ CmpOrgById@Base 6.1.20030421
+ CmpPub@Base 6.1.20030421
+ CodonTableFromSeqLoc@Base 6.1.20030421
+ ComPatDup@Base 6.1.20030421
+ ComPatFree@Base 6.1.20030421
+ ComPatNew@Base 6.1.20030421
+ ComProfDup@Base 6.1.20030421
+ ComProfDupThis@Base 6.1.20030421
+ ComProfFree@Base 6.1.20030421
+ ComProfLink@Base 6.1.20030421
+ ComProfNew@Base 6.1.20030421
+ CombineBSFeat@Base 6.1.20030421
+ CommonIndexDestruct@Base 6.1.20030421
+ CommonIndexInit@Base 6.1.20030421
+ CommonIndexResultDestruct@Base 6.1.20030421
+ CompilePattern@Base 6.1.20030421
+ ConKovCDSGlobalNtFreqs@Base 6.1.20030421
+ ConKovCDSNtFreqs@Base 6.1.20030421
+ ConKovTrainCDS@Base 6.1.20030421
+ ConcatSeqLoc@Base 6.1.20040505
+ Confide@Base 6.1.20030421
+ ConfigureDbChunkSize@Base 6.1.20050605
+ Conform@Base 6.1.20030421
+ ConformSeqEntry@Base 6.1.20030421
+ ConsortSeqEntry@Base 6.1.20030421
+ ContextToFrame@Base 6.1.20030421
+ ConvertEditScript@Base 6.1.20030421
+ ConvertEtoPseudoS@Base 6.1.20030421
+ ConvertFullLenPubFeatToDesc@Base 6.1.20030421
+ ConvertFullLenSourceFeatToDesc@Base 6.1.20030421
+ ConvertPartDescToFeat@Base 6.1.20110713
+ ConvertPseudoStoE@Base 6.1.20030421
+ ConvertPtoPseudoS@Base 6.1.20030421
+ ConvertSegSetToDeltaSeq@Base 6.1.20110713
+ ConvertSegSetToDeltaSeqEx@Base 6.1.20160908
+ CopyResultHspToHSP@Base 6.1.20041020
+ CorrectSourceFeat@Base 6.1.20030421
+ CountNodes@Base 6.1.20030421
+ CountNodesOnLevel@Base 6.1.20030421
+ CountSourceFeat@Base 6.1.20030421
+ CposComputation@Base 6.1.20030421
+ CreatBandStruct@Base 6.1.20030421
+ CreateEditScript@Base 6.1.20030421
+ DBName@Base 6.1.20030421
+ DBShift@Base 6.1.20030421
+ DB_Subset@Base 6.1.20030421
+ DBisProt@Base 6.1.20030421
+ DOT_AttachSeqAnnotToSeqEntry@Base 6.1.20030421
+ DOT_BuildHitList@Base 6.1.20030421
+ DOT_CreateAndStore@Base 6.1.20030421
+ DOT_CreateAndStorebyLoc@Base 6.1.20030421
+ DOT_DNAScoringMatrix@Base 6.1.20030421
+ DOT_FreeHitsArray@Base 6.1.20030421
+ DOT_FreeMainInfo@Base 6.1.20030421
+ DOT_FreeMainInfoPtrEx@Base 6.1.20030421
+ DOT_GetSeqs@Base 6.1.20030421
+ DOT_InitMainInfo@Base 6.1.20030421
+ DOT_NewHistNode@Base 6.1.20030421
+ DOT_SPI_FindBestAlnByDotPlot@Base 6.1.20030421
+ DefaultPSimPam@Base 6.1.20030421
+ DefaultSimPam@Base 6.1.20030421
+ DefineToFrame@Base 6.1.20030421
+ DelFeatFromList@Base 6.1.20030421
+ DeletePubs@Base 6.1.20030421
+ DivideSeqAligns@Base 6.1.20030421
+ DumpBlastDB@Base 6.1.20050429
+ DumpHashTable@Base 6.1.20030421
+ DumpOneSequence@Base 6.1.20050828
+ DustBioseq@Base 6.1.20030421
+ DustDataFree@Base 6.1.20030421
+ DustDataNew@Base 6.1.20030421
+ DustFilter@Base 6.1.20030421
+ DustForGraph@Base 6.1.20030421
+ DustGraph@Base 6.1.20030421
+ DustRegionFree@Base 6.1.20030421
+ DustRegionNew@Base 6.1.20030421
+ DustSegs@Base 6.1.20070822
+ DustSeq@Base 6.1.20030421
+ DustSeqLoc@Base 6.1.20030421
+ DustSeqPort@Base 6.1.20030421
+ EmbedFragLengthInfo@Base 6.1.20030421
+ EmbedMolecularWeightInfo@Base 6.1.20030421
+ EndOfSig@Base 6.1.20030421
+ EntryChangeGBSource@Base 6.1.20030421
+ EntryChangeImpFeat@Base 6.1.20030421
+ EntryChangeImpFeatToProt@Base 6.1.20030421
+ EntryCheckGBBlock@Base 6.1.20030421
+ EntryMergeDupBioSources@Base 6.1.20030421
+ EpiDatFree@Base 6.1.20030421
+ EpiDatNew@Base 6.1.20030421
+ ErrorDescString@Base 6.1.20030421
+ ExploreTree@Base 6.1.20030421
+ ExploreTreeLevel@Base 6.1.20030421
+ ExploreTreeNumber@Base 6.1.20030421
+ ExploreUnrootedTree@Base 6.1.20030421
+ ExploreUnrootedTreeNumber@Base 6.1.20030421
+ ExtendGeneFeatIfOnMRNA@Base 6.1.20030421
+ ExtendSeqAlign@Base 6.1.20030421
+ ExtendedSeqEntryCleanup@Base 6.1.20160908
+ ExtractSourceFeatList@Base 6.1.20030421
+ FCMDAccListFree@Base 6.1.20030421
+ FDBAddBioseq@Base 6.1.20030421
+ FDBAddLinksInformation@Base 6.1.20030421
+ FDBAddMembershipInformation@Base 6.1.20030421
+ FDBAddPig@Base 6.1.20030421
+ FDBAddSeqEntry@Base 6.1.20030421
+ FDBAddSequence2@Base 6.1.20030421
+ FDBAddSequence@Base 6.1.20030421
+ FDBBlastDefLineSetBit@Base 6.1.20061015
+ FDBCleanUp@Base 6.1.20030421
+ FDBCleanUpInProgress@Base 6.1.20060507
+ FDBCleanUpRecursively@Base 6.1.20030421
+ FDBDestroyLinksTable@Base 6.1.20030421
+ FDBDestroyMembershipsTable@Base 6.1.20030421
+ FDBDumpDeflineAsn@Base 6.1.20061015
+ FDBFillIndexTables@Base 6.1.20061015
+ FDBGetDefAsnFromBioseq@Base 6.1.20041020
+ FDBLoadLinksTable@Base 6.1.20030421
+ FDBLoadMembershipsTable@Base 6.1.20030421
+ FDBOptionsFree@Base 6.1.20030421
+ FDBOptionsNew@Base 6.1.20030421
+ FDBPigTableFree@Base 6.1.20030421
+ FDBPigTableNew@Base 6.1.20030421
+ FDBTaxidDeflineTableFree@Base 6.1.20050828
+ FDBTaxidDeflineTableNew@Base 6.1.20050828
+ FDBTaxidDeflineTableSearchGi@Base 6.1.20050828
+ FDBTaxidDeflineTableSearchSeqid@Base 6.1.20050828
+ FDB_SEDataInfoFree@Base 6.1.20030421
+ FDB_SEDataInfoNew@Base 6.1.20030421
+ FDFGetAccessionFromSeqIdChain@Base 6.1.20030421
+ FDLCreateAsnDF@Base 6.1.20030421
+ FDReadDeflineAsn@Base 6.1.20030421
+ FD_ConstructMultivolumeDBList@Base 6.1.20030421
+ FD_CreateAliasFile@Base 6.1.20030421
+ FD_CreateAliasFileEx@Base 6.1.20030421
+ FD_MakeAliasFile@Base 6.1.20030421
+ FastaCheckDna@Base 6.1.20030421
+ FastaTitle@Base 6.1.20030421
+ FastaToBlastDB@Base 6.1.20030421
+ Fastacmd_ParseLocations@Base 6.1.20060507
+ Fastacmd_Search@Base 6.1.20030421
+ Fastacmd_Search_ex@Base 6.1.20030421
+ FilterBioseq@Base 6.1.20030421
+ FilterCC@Base 6.1.20030421
+ FilterCCVS@Base 6.1.20030421
+ FilterDatFree@Base 6.1.20030421
+ FilterDatNew@Base 6.1.20030421
+ FilterEpi@Base 6.1.20030421
+ FilterEpiBioseq@Base 6.1.20030421
+ FilterFilter@Base 6.1.20030421
+ FilterSeqLoc@Base 6.1.20030421
+ FilterSeqPort@Base 6.1.20030421
+ FilterSigSeq@Base 6.1.20030421
+ FilterWithSeg@Base 6.1.20030421
+ FindBlastDBFile@Base 6.1.20030421
+ FindDBbyGI@Base 6.1.20030421
+ FindHumanRepeats@Base 6.1.20030421
+ FindOldLineage@Base 6.1.20030421
+ FindOrg@Base 6.1.20030421
+ FindPivotNode@Base 6.1.20030421
+ FindSimilarBiasOrfs@Base 6.1.20030421
+ FiniSTSSearch@Base 6.1.20030421
+ FixNucProtSet@Base 6.1.20030421
+ FlatSafeSize@Base 6.1.20030421
+ FormatBlastParameters@Base 6.1.20030421
+ FormatDBClose@Base 6.1.20030421
+ FormatDBInit@Base 6.1.20030421
+ FrameToDefine@Base 6.1.20030421
+ FreeCDDAligns@Base 6.1.20031028
+ FreeCDDRegions@Base 6.1.20030421
+ FreeCodonTable@Base 6.1.20030421
+ FreqFree@Base 6.1.20030421
+ FreqNew@Base 6.1.20030421
+ GI2OID@Base 6.1.20030421
+ GIs2OIDs@Base 6.1.20030421
+ GXECollectDataForSeqalign@Base 6.1.20030421
+ GapAlignBlkDelete@Base 6.1.20030421
+ GapAlignBlkNew@Base 6.1.20030421
+ GapXDropStateDestroy@Base 6.1.20030421
+ GapXEditBlockDelete@Base 6.1.20030421
+ GapXEditBlockNew@Base 6.1.20030421
+ GapXEditBlockToSeqAlign@Base 6.1.20030421
+ GapXEditScriptDelete@Base 6.1.20030421
+ GapXEditScriptNew@Base 6.1.20030421
+ GatherCDSFree@Base 6.1.20030421
+ GatherCDSNew@Base 6.1.20030421
+ GetAccList@Base 6.1.20030421
+ GetAlignExtremes@Base 6.1.20030421
+ GetAltList@Base 6.1.20030421
+ GetDbSubjRatio@Base 6.1.20030421
+ GetDeepestLevel@Base 6.1.20030421
+ GetDeepestLevelBranch@Base 6.1.20030421
+ GetDescr@Base 6.1.20030421
+ GetGcodeFromBioseq@Base 6.1.20080302
+ GetGisFromFile@Base 6.1.20030421
+ GetLevelLeftNode@Base 6.1.20030421
+ GetMBTemplateType@Base 6.1.20030421
+ GetMaximumTreeXcoord@Base 6.1.20030421
+ GetMaximumTreeYcoord@Base 6.1.20030421
+ GetMinimumTreeXcoord@Base 6.1.20030421
+ GetMinimumTreeYcoord@Base 6.1.20030421
+ GetMultBiosource@Base 6.1.20030421
+ GetNumSpacers@Base 6.1.20030421
+ GetOrfList@Base 6.1.20030421
+ GetPrivatTranslationTable@Base 6.1.20030421
+ GetQueryNum@Base 6.1.20030421
+ GetRidOfEmptyFeatsDescCallback@Base 6.1.20030421
+ GetScoreSetFromBlastResultHsp@Base 6.1.20030421
+ GetSeqAlignForResultHitList@Base 6.1.20030421
+ GetSequenceWithDenseSeg@Base 6.1.20030421
+ GetStartForGappedAlignment@Base 6.1.20030421
+ GetTheSeqAlignID@Base 6.1.20030421
+ GetTranslation@Base 6.1.20030421
+ GetWidestLevelLeftNode@Base 6.1.20030421
+ Get_Genetic_Code@Base 6.1.20030421
+ GlobalBandByLoc@Base 6.1.20030421
+ GlobalBandStructCreate@Base 6.1.20030421
+ GlobalBandStructDelete@Base 6.1.20030421
+ GlobalBandToEditBlock@Base 6.1.20030421
+ GlobalBandToSeqAlign@Base 6.1.20030421
+ GpipeSeqEntryCleanup@Base 6.1.20090719
+ GreedyAlignMemAlloc@Base 6.1.20030421
+ GreedyAlignMemFree@Base 6.1.20030421
+ HackSeqLocId@Base 6.1.20030421
+ HeadNode@Base 6.1.20030421
+ HitAsnRead@Base 6.1.20030421
+ HitAsnWrite@Base 6.1.20030421
+ HitFree@Base 6.1.20030421
+ HitNew@Base 6.1.20030421
+ HitRangeToSeqLoc@Base 6.1.20030421
+ HspArrayPurge@Base 6.1.20030421
+ HspAsnRead@Base 6.1.20030421
+ HspAsnWrite@Base 6.1.20030421
+ HspFree@Base 6.1.20030421
+ HspNew@Base 6.1.20030421
+ IE@Base 6.1.20030421
+ IMPALAPrintHelp@Base 6.1.20030421
+ IMPALAPrintReference@Base 6.1.20030421
+ IMPALAfillResidueProbability@Base 6.1.20030421
+ IMPALAfillSfp@Base 6.1.20030421
+ IMPALAfindUngappedLambda@Base 6.1.20030421
+ IO@Base 6.1.20030421
+ IR@Base 6.1.20030421
+ ISAMCountLines@Base 6.1.20030421
+ ISAMCreateDatabase@Base 6.1.20030421
+ ISAMGetIdxOption@Base 6.1.20030421
+ ISAMMakeIndex@Base 6.1.20030421
+ ISAMNumTerms@Base 6.1.20030421
+ ISAMObjectFree@Base 6.1.20030421
+ ISAMObjectNew@Base 6.1.20030421
+ ISAMSearchTerm@Base 6.1.20030421
+ ISAMSetCheckForNonUnique@Base 6.1.20030421
+ ISAMSetDataSorted@Base 6.1.20061015
+ ISAMSetUpCAInfo@Base 6.1.20030421
+ ISAMUninitSearch@Base 6.1.20030421
+ ISAMUpdateDatabase@Base 6.1.20030421
+ ImpFeatToCdregion@Base 6.1.20030421
+ InitHashTable@Base 6.1.20030421
+ InitHitLists@Base 6.1.20030421
+ InitSTSSearch@Base 6.1.20030421
+ InitSTSSearch_r@Base 6.1.20030421
+ InitSuggest@Base 6.1.20030421
+ Int4ListAdd@Base 6.1.20031028
+ Int4ListBSearch@Base 6.1.20031028
+ Int4ListConcat@Base 6.1.20031028
+ Int4ListFree@Base 6.1.20031028
+ Int4ListIntersect@Base 6.1.20031028
+ Int4ListMakeUnique@Base 6.1.20031028
+ Int4ListNew@Base 6.1.20031028
+ Int4ListNewEx@Base 6.1.20031028
+ Int4ListReadFromFile@Base 6.1.20031028
+ Int4ListResize@Base 6.1.20031028
+ IntProfileMatchBioseq@Base 6.1.20030421
+ IntegerProfile@Base 6.1.20030421
+ InvertPattern@Base 6.1.20030421
+ InvertProfile@Base 6.1.20030421
+ IsProsite@Base 6.1.20030421
+ IsPubContentBad@Base 6.1.20070822
+ IsStringEmpty@Base 6.1.20030421
+ IterationAsnRead@Base 6.1.20030421
+ IterationAsnWrite@Base 6.1.20030421
+ IterationFree@Base 6.1.20030421
+ IterationNew@Base 6.1.20030421
+ K@Base 6.1.20030421
+ L@Base 6.1.20030421
+ LastNode@Base 6.1.20030421
+ LoadNewEnds@Base 6.1.20030421
+ LocalBandStructCreate@Base 6.1.20030421
+ LocalBandStructDelete@Base 6.1.20030421
+ LocalBandToEditBlock@Base 6.1.20030421
+ LocalBandToSeqAlign@Base 6.1.20030421
+ Look_for_stop@Base 6.1.20030421
+ MBToGapXEditScript@Base 6.1.20030421
+ MBXmlClose@Base 6.1.20030421
+ MOT_FindKozak@Base 6.1.20030421
+ MOT_FindPolyA@Base 6.1.20030421
+ MOT_FindRepeats@Base 6.1.20030421
+ MOT_FindSignalPeptide@Base 6.1.20030421
+ MOT_MotifSearch@Base 6.1.20030421
+ MQ_CheckLists@Base 6.1.20040204
+ MQ_UpdateResultLists@Base 6.1.20030421
+ MakeBlastScore@Base 6.1.20030421
+ MakeDiscontiguousAlignments@Base 6.1.20060301
+ MapsToGenref@Base 6.1.20030421
+ MashNew@Base 6.1.20030421
+ MaskSeqLocFromSeqAlign@Base 6.1.20030421
+ MatchSa2Sl@Base 6.1.20030421
+ Max_val@Base 6.1.20030421
+ MegaBlastAffineGreedyAlign@Base 6.1.20030421
+ MegaBlastBuildLookupTable@Base 6.1.20030421
+ MegaBlastExtendHit@Base 6.1.20030421
+ MegaBlastFillHspGapInfo@Base 6.1.20030421
+ MegaBlastGapInfoToSeqAlign@Base 6.1.20030421
+ MegaBlastGappedAlign@Base 6.1.20030421
+ MegaBlastGetFirstAndLastContext@Base 6.1.20030421
+ MegaBlastGetHspPercentIdentity@Base 6.1.20030421
+ MegaBlastGetNumIdentical@Base 6.1.20030421
+ MegaBlastGreedyAlign@Base 6.1.20030421
+ MegaBlastLookupTableDestruct@Base 6.1.20030421
+ MegaBlastLookupTableDup@Base 6.1.20030421
+ MegaBlastMaskTheResidues@Base 6.1.20030421
+ MegaBlastNtWordExtend@Base 6.1.20030421
+ MegaBlastPackAlignmentsByQuery@Base 6.1.20030421
+ MegaBlastParameterBlkNew@Base 6.1.20030421
+ MegaBlastPrintAlignInfo@Base 6.1.20030421
+ MegaBlastPrintReference@Base 6.1.20030421
+ MegaBlastReevaluateWithAmbiguities@Base 6.1.20030421
+ MegaBlastSaveCurrentHitlist@Base 6.1.20030421
+ MegaBlastSequenceAddSequence@Base 6.1.20030421
+ MegaBlastSetUpSearchInternalByLoc@Base 6.1.20030421
+ MegaBlastSetUpSearchWithReadDbInternal@Base 6.1.20030421
+ MegaBlastWordFinder@Base 6.1.20030421
+ MegaBlastWordFinderDeallocate@Base 6.1.20030421
+ MergeAdjacentAnnotsCallback@Base 6.1.20030421
+ MergeBSinDescr@Base 6.1.20030421
+ MergeCodonTables@Base 6.1.20030421
+ Min_val@Base 6.1.20030421
+ ModToBiosource@Base 6.1.20030421
+ ModToMolInfo@Base 6.1.20030421
+ MoveCdsGBQualProductToName@Base 6.1.20030421
+ MoveFeatGBQualsToFields@Base 6.1.20030421
+ MoveFeatsFromPartsSet@Base 6.1.20060301
+ MoveNPPubs@Base 6.1.20030421
+ MovePopPhyMutPubs@Base 6.1.20030421
+ MoveProtGBQualProductToName@Base 6.1.20030421
+ MoveRnaGBQualProductToName@Base 6.1.20030421
+ MoveSegmPubs@Base 6.1.20030421
+ MoveSetPubs@Base 6.1.20030421
+ MyBioseqSeg@Base 6.1.20030421
+ NA4alpha@Base 6.1.20030421
+ NIL1@Base 6.1.20030421
+ NIL@Base 6.1.20030421
+ NISAMFindKey@Base 6.1.20030421
+ NISAMFindKeys@Base 6.1.20030421
+ NISAMSearch@Base 6.1.20030421
+ NISAMSearchList@Base 6.1.20030421
+ NewCodonTable@Base 6.1.20030421
+ NewLineage@Base 6.1.20030421
+ NewPubs@Base 6.1.20030421
+ NlmCloseMFILE@Base 6.1.20030421
+ NlmOpenMFILE@Base 6.1.20030421
+ NlmReadMFILE@Base 6.1.20030421
+ NlmSeekInMFILE@Base 6.1.20030421
+ NlmTellMFILE@Base 6.1.20030421
+ NoBiosourceOrTaxonId@Base 6.1.20030421
+ NormalizePeriodsOnInitials@Base 6.1.20030421
+ NormalizeSegSeqMolInfo@Base 6.1.20030421
+ OIDListFree@Base 6.1.20030421
+ OOFBlastHSPGetNumIdentical@Base 6.1.20031028
+ OOFGapXEditBlockToSeqAlign@Base 6.1.20030421
+ OOFTracebackToGapXEditBlock@Base 6.1.20030421
+ OutLocation@Base 6.1.20030421
+ OutProteinID@Base 6.1.20030421
+ PGPOutTextMessages@Base 6.1.20030421
+ PSIMatrixFrequencyRatiosFree@Base 6.1.20041020
+ PSIMatrixFrequencyRatiosNew@Base 6.1.20041020
+ PSIXmlClose@Base 6.1.20030421
+ PSIXmlInit@Base 6.1.20030421
+ PSIXmlReset@Base 6.1.20040505
+ PSUGapOptionsCreate@Base 6.1.20030421
+ PSUGapOptionsDelete@Base 6.1.20030421
+ PalindromeCheck@Base 6.1.20030421
+ ParametersAsnRead@Base 6.1.20030421
+ ParametersAsnWrite@Base 6.1.20030421
+ ParametersFree@Base 6.1.20030421
+ ParametersNew@Base 6.1.20030421
+ ParseDBConfigFile@Base 6.1.20030421
+ PatternMatch@Base 6.1.20030421
+ PatternMatchBioseq@Base 6.1.20030421
+ PccDatFree@Base 6.1.20030421
+ PccDatNew@Base 6.1.20030421
+ PerformGappedAlignment@Base 6.1.20030421
+ PerformGappedAlignmentWithTraceback@Base 6.1.20030421
+ PerformGreedyAlignmentWithTraceback@Base 6.1.20040204
+ PerformNtGappedAlignment@Base 6.1.20030421
+ PredictCC@Base 6.1.20030421
+ PredictCCBioseq@Base 6.1.20030421
+ PredictCCSeqLoc@Base 6.1.20030421
+ PredictCCSeqPort@Base 6.1.20030421
+ PredictEpi@Base 6.1.20030421
+ PredictEpiBioseq@Base 6.1.20030421
+ PredictEpiSeqLoc@Base 6.1.20030421
+ PredictEpiSeqPort@Base 6.1.20030421
+ PrintAllowedValuesMessage@Base 6.1.20030421
+ PrintDbInformation@Base 6.1.20030421
+ PrintDbInformationBasic@Base 6.1.20030421
+ PrintDbInformationBasicEx@Base 6.1.20051206
+ PrintDbInformationWithRID@Base 6.1.20030421
+ PrintDbReport@Base 6.1.20030421
+ PrintKAParameters@Base 6.1.20030421
+ PrintKAParametersExtra@Base 6.1.20030421
+ PrintMaskedSequence@Base 6.1.20030421
+ PrintMatrixMessage@Base 6.1.20030421
+ PrintTabularOutputHeader@Base 6.1.20030421
+ PrintTildeSepLines@Base 6.1.20030421
+ ProcessData@Base 6.1.20030421
+ ProfLenMax@Base 6.1.20030421
+ ProfScoreMax@Base 6.1.20030421
+ ProfileMatch@Base 6.1.20030421
+ ProfileMatchBioseq@Base 6.1.20030421
+ PrositeToGBPattern@Base 6.1.20030421
+ R@Base 6.1.20030421
+ RDBGetTaxNames@Base 6.1.20030421
+ RDBTaxInfoClose@Base 6.1.20030421
+ RDBTaxInfoInit@Base 6.1.20030421
+ RPSBgetCddHits@Base 6.1.20030421
+ RPSBlastSearch@Base 6.1.20030421
+ RPSBlastSearchEx@Base 6.1.20030421
+ RPSBlastSearchLight@Base 6.1.20030421
+ RPSBlastSearchMT@Base 6.1.20030421
+ RPSCalcEValue@Base 6.1.20030421
+ RPSClose@Base 6.1.20030421
+ RPSGetSequence@Base 6.1.20030421
+ RPSInfoAttach@Base 6.1.20030421
+ RPSInfoDetach@Base 6.1.20030421
+ RPSInit@Base 6.1.20030421
+ RPSInitEx@Base 6.1.20030421
+ RPSUpdateDbSize@Base 6.1.20030421
+ RPSequenceFree@Base 6.1.20030421
+ ReadDBBioseqFetchDisable@Base 6.1.20030421
+ ReadDBBioseqFetchEnable@Base 6.1.20030421
+ ReadDBBioseqSetDbGeneticCode@Base 6.1.20030421
+ ReadDBCloseMHdrAndSeqFiles@Base 6.1.20030421
+ ReadDBGetDb@Base 6.1.20030421
+ ReadDBGetDbId@Base 6.1.20030421
+ ReadFilterData@Base 6.1.20030421
+ ReadOIDList@Base 6.1.20030421
+ ReadPattern@Base 6.1.20030421
+ ReadPatternNames@Base 6.1.20030421
+ ReadPccData@Base 6.1.20030421
+ ReadProfile@Base 6.1.20030421
+ ReadPrositePattern@Base 6.1.20030421
+ ReadRENPattern@Base 6.1.20030421
+ RealBlastGetGappedAlignmentTraceback@Base 6.1.20030421
+ ReassembleSeqAlignFromPSeqAlignInfo@Base 6.1.20030421
+ RedoAlignmentCore@Base 6.1.20030421
+ ReevaluateScoreWithAmbiguities@Base 6.1.20040204
+ Region@Base 6.1.20030421
+ RemoveBioSourceOnPopSet@Base 6.1.20030421
+ RemoveDuplicateCDDs@Base 6.1.20030421
+ RemoveInternalOrfs@Base 6.1.20030421
+ RemoveMolInfoOnPopSet@Base 6.1.20110713
+ ResToInt@Base 6.1.20030421
+ ResultIndex1@Base 6.1.20040204
+ ResultIndex@Base 6.1.20030421
+ ReverseBioseqFeatureStrands@Base 6.1.20041020
+ RootTree@Base 6.1.20030421
+ S@Base 6.1.20030421
+ SEMI_G_ALIGN@Base 6.1.20030421
+ SIM2@Base 6.1.20030421
+ SIM2ALN@Base 6.1.20030421
+ SIM2ENDS@Base 6.1.20030421
+ SIM3ALN@Base 6.1.20030421
+ SIM3ALN_choice@Base 6.1.20030421
+ SIM3ALN_heuristic@Base 6.1.20030421
+ SIM4ALN_choice@Base 6.1.20030421
+ SISAMFindAllData@Base 6.1.20030421
+ SISAMSearch@Base 6.1.20030421
+ SI_RecordFree@Base 6.1.20061015
+ SI_RecordNew@Base 6.1.20061015
+ SORTAddTempName@Base 6.1.20030421
+ SORTCheckOrderS@Base 6.1.20030421
+ SORTFiles@Base 6.1.20030421
+ SORTGetKeyHead@Base 6.1.20030421
+ SORTInsertKey@Base 6.1.20030421
+ SORTMergeFiles@Base 6.1.20030421
+ SORTObjectFree@Base 6.1.20030421
+ SORTObjectNew@Base 6.1.20030421
+ SORTSetLineLength@Base 6.1.20030421
+ SORTSetPrefix@Base 6.1.20030421
+ SORTSetReverse@Base 6.1.20030421
+ SORTSetTab@Base 6.1.20030421
+ SORTSetUnique@Base 6.1.20030421
+ SPI_AlignmRNAToGenomic@Base 6.1.20030421
+ SPI_AlnSinglemRNAToGen@Base 6.1.20030421
+ SPI_AlnSinglemRNAToPieces@Base 6.1.20030421
+ SPI_GetProteinFrommRNA@Base 6.1.20030421
+ SPI_MakeMultipleAlignment@Base 6.1.20030421
+ SPI_OptionsFree@Base 6.1.20030421
+ SPI_OptionsNew@Base 6.1.20030421
+ SPI_PrintMultipleAlignment@Base 6.1.20030421
+ SPI_RegionListFree@Base 6.1.20030421
+ SPI_RemoveInconsistentAlnsFromSet@Base 6.1.20030421
+ SPI_bsinfoFreeList@Base 6.1.20030421
+ SPI_flip_sa_list@Base 6.1.20030421
+ SPI_is_acceptor@Base 6.1.20030421
+ SPI_is_donor@Base 6.1.20030421
+ SPI_mRNAFree@Base 6.1.20030421
+ SQN_ExtendAlnAlg@Base 6.1.20030421
+ STSDataFree@Base 6.1.20030421
+ STSGetOrgTable@Base 6.1.20030421
+ STSGetOrganismIndex@Base 6.1.20030421
+ STSGetOrganismName@Base 6.1.20030421
+ STSSearch@Base 6.1.20030421
+ STSSearch_r@Base 6.1.20030421
+ SUM_THRESHOLD@Base 6.1.20070822
+ SaveRepeats@Base 6.1.20030421
+ ScanDIFile@Base 6.1.20030421
+ Script_free@Base 6.1.20030421
+ SeedPruneHitsFromSeedReturn@Base 6.1.20030421
+ SegFree@Base 6.1.20030421
+ SegParamsCheck@Base 6.1.20030421
+ SegParamsFree@Base 6.1.20030421
+ SegParamsNewAa@Base 6.1.20030421
+ SegParamsNewNa@Base 6.1.20030421
+ SegSeq@Base 6.1.20030421
+ SegSeqNullToVirtual@Base 6.1.20110713
+ SegsToSeqLoc@Base 6.1.20030421
+ SeqAlignReverseOrder@Base 6.1.20030421
+ SeqAlignSetGlobalFromLocal@Base 6.1.20030421
+ SeqAlignSwapSeqs@Base 6.1.20030421
+ SeqAlignToHits@Base 6.1.20030421
+ SeqAlignToPSeqAlignInfo@Base 6.1.20030421
+ SeqEntryMoveDbxrefs@Base 6.1.20030421
+ SeqEntryPubsAsn4@Base 6.1.20030421
+ SeqEntryPubsAsn4Ex@Base 6.1.20100808
+ SeqEntryToAsn3@Base 6.1.20030421
+ SeqEntryToAsn3Ex@Base 6.1.20030421
+ SeqEntrysToBLAST@Base 6.1.20030421
+ SeqFeatExtract@Base 6.1.20030421
+ SeqFeatExtractList@Base 6.1.20030421
+ SeqFree@Base 6.1.20030421
+ SeqId2OrdinalId@Base 6.1.20030421
+ SeqLocDup@Base 6.1.20030421
+ SeqLocDupAll@Base 6.1.20030421
+ SeqLocDust@Base 6.1.20030421
+ SeqLocDustEx@Base 6.1.20070822
+ SeqLocLink@Base 6.1.20030421
+ SeqLocListToSeqAlign@Base 6.1.20030421
+ SeqLocMatch@Base 6.1.20030421
+ SeqLocSeg@Base 6.1.20030421
+ SeqLocTotalLen@Base 6.1.20030421
+ SeqNew@Base 6.1.20030421
+ SeqlocSegAa@Base 6.1.20030421
+ SeqlocSegsToSeqLoc@Base 6.1.20030421
+ SeriousSeqAnnotCleanup@Base 6.1.20100808
+ SeriousSeqEntryCleanup@Base 6.1.20030421
+ SeriousSeqEntryCleanupBulk@Base 6.1.20030421
+ SetAllCoordinates@Base 6.1.20030421
+ SetAllLeftRightRootedTreeNeighbors@Base 6.1.20030421
+ SetAllLevelNodes@Base 6.1.20030421
+ SetAllNumberNodes@Base 6.1.20030421
+ SetAllPivotNodes@Base 6.1.20030421
+ SetAllTheoreticalCoordinates@Base 6.1.20030421
+ SetBatchSuggestFrames@Base 6.1.20030421
+ SetBatchSuggestNucleotide@Base 6.1.20030421
+ SetGlobaltOptions@Base 6.1.20030421
+ SetLeftRightRootedTreeNeighbors@Base 6.1.20030421
+ SetLevelNode@Base 6.1.20030421
+ SetLowUpFromBlast@Base 6.1.20030421
+ SetNumberNode@Base 6.1.20030421
+ SetPivotNode@Base 6.1.20030421
+ SetTheoreticalCoordinates@Base 6.1.20030421
+ ShiftTree@Base 6.1.20030421
+ ShortenString@Base 6.1.20030421
+ SimpleAutoDef@Base 6.1.20110713
+ SimpleIntervalToGapXEditBlock@Base 6.1.20030421
+ SortAlignByLocation@Base 6.1.20030421
+ SortByLocOrfs@Base 6.1.20030421
+ SortCFArray@Base 6.1.20030421
+ SortEndsList@Base 6.1.20030421
+ SortHPArray@Base 6.1.20030421
+ SourceFeatExtract@Base 6.1.20030421
+ Sqn_GlobalAlign2Seq@Base 6.1.20030421
+ Sqn_GlobalAlign2SeqEx@Base 6.1.20050429
+ SrchSegChoice@Base 6.1.20030421
+ SrchSegSeqMol@Base 6.1.20030421
+ StatisticsAsnRead@Base 6.1.20030421
+ StatisticsAsnWrite@Base 6.1.20030421
+ StatisticsFree@Base 6.1.20030421
+ StatisticsNew@Base 6.1.20030421
+ StrStripSpaces@Base 6.1.20030421
+ StringExtCmp@Base 6.1.20030421
+ StringIgnoreSpaceCmp@Base 6.1.20030421
+ StringNStr@Base 6.1.20030421
+ StripAllSpace@Base 6.1.20030421
+ StripBSfromParts@Base 6.1.20030421
+ StripBSfromTop@Base 6.1.20030421
+ StripMaps@Base 6.1.20030421
+ StripOld@Base 6.1.20030421
+ StripProtXref@Base 6.1.20030421
+ StripTitleFromProtsInNucProts@Base 6.1.20030421
+ StsResultFree@Base 6.1.20030421
+ StsResultNew@Base 6.1.20030421
+ SuggestClientService@Base 6.1.20030421
+ SuggestCodingRegion@Base 6.1.20030421
+ SuggestCodingRegionEx@Base 6.1.20090719
+ SumBlastGetGappedAlignmentEx@Base 6.1.20030421
+ SumBlastGetGappedAlignmentTraceback@Base 6.1.20030421
+ TestTree@Base 6.1.20030421
+ ToAsn4@Base 6.1.20030421
+ TooShort@Base 6.1.20030421
+ Total_len@Base 6.1.20030421
+ TracebackToGapXEditBlock@Base 6.1.20030421
+ TreeCenterNode@Base 6.1.20030421
+ TreeNodeFree@Base 6.1.20030421
+ TreeNodeFreeBranch@Base 6.1.20030421
+ TreeNodeFreeTree@Base 6.1.20030421
+ TreeNodeNew@Base 6.1.20030421
+ TruncateAlignment@Base 6.1.20060301
+ TxDfDbInfoDestruct@Base 6.1.20030421
+ TxDfDbInfoNew@Base 6.1.20030421
+ TxMatrixDestruct@Base 6.1.20030421
+ URK_SeqAlignSortByLength@Base 6.1.20030421
+ URK_SeqAlignSortByMolWt@Base 6.1.20030421
+ URK_SeqAlignSortByScore@Base 6.1.20030421
+ URK_SeqAlignSortByStart@Base 6.1.20030421
+ UnSetPivotNodes@Base 6.1.20030421
+ UniqueOrfs@Base 6.1.20030421
+ UnrootTree@Base 6.1.20030421
+ VSBlastOptionNew@Base 6.1.20030421
+ VSCombineSeqLoc@Base 6.1.20030421
+ VSGetLabels@Base 6.1.20030421
+ VSMakeCombinedSeqLoc@Base 6.1.20030421
+ VSMakeSeqLoc@Base 6.1.20030421
+ VSOptionsFree@Base 6.1.20030421
+ VSOptionsNew@Base 6.1.20030421
+ VSPrintListFromSeqLocs@Base 6.1.20030421
+ VSPrintListIdLine@Base 6.1.20030421
+ VSPrintOverviewFromSeqLocs@Base 6.1.20030421
+ VSScreenSequence@Base 6.1.20030421
+ VSScreenSequenceByLoc@Base 6.1.20030421
+ W@Base 6.1.20030421
+ WholeFeatFree@Base 6.1.20030421
+ WholeFeatNew@Base 6.1.20030421
+ WposComputation@Base 6.1.20030421
+ Xfrag_print@Base 6.1.20030421
+ ZeroNodes@Base 6.1.20030421
+ act_get_eval@Base 6.1.20050429
+ addScoresToSeqAlign@Base 6.1.20030421
+ addSuffixToName@Base 6.1.20030421
+ add_string_to_buffer@Base 6.1.20041020
+ add_string_to_bufferEx@Base 6.1.20041020
+ align@Base 6.1.20030421
+ align_of_pattern@Base 6.1.20030421
+ allocatePosFreqs@Base 6.1.20030421
+ avl_List@Base 6.1.20030421
+ avl_counter1@Base 6.1.20030421
+ avl_counter2@Base 6.1.20030421
+ avl_hist@Base 6.1.20030421
+ avl_hitlist@Base 6.1.20030421
+ bb@Base 6.1.20030421
+ bbld_table@Base 6.1.20030421
+ bdiag_prev@Base 6.1.20030421
+ best_score@Base 6.1.20030421
+ bfound@Base 6.1.20030421
+ bit_engine_arr@Base 6.1.20030421
+ bit_engine_firstbit@Base 6.1.20030421
+ bit_engine_numofbits@Base 6.1.20030421
+ blastMergeFilterLocs@Base 6.1.20030421
+ blast_set_parameters@Base 6.1.20030421
+ blastna_to_ncbi4na@Base 6.1.20030421
+ blastool_fprintf@Base 6.1.20031028
+ bli_c@Base 6.1.20030421
+ bli_d@Base 6.1.20030421
+ blink@Base 6.1.20030421
+ bls@Base 6.1.20030421
+ break_blast_job@Base 6.1.20030421
+ bri@Base 6.1.20030421
+ bscan@Base 6.1.20030421
+ bscan_init@Base 6.1.20030421
+ bucket@Base 6.1.20030421
+ bxmlobjAsnLoad@Base 6.1.20030421
+ calign@Base 6.1.20030421
+ check_GIBB@Base 6.1.20030421
+ check_strand_mol@Base 6.1.20030421
+ check_whole@Base 6.1.20030421
+ ckalloc@Base 6.1.20030421
+ ckopen@Base 6.1.20030421
+ class_print@Base 6.1.20030421
+ clean_all_internal_repeats@Base 6.1.20030421
+ clean_empty_seqalign@Base 6.1.20030421
+ closewin@Base 6.1.20030421
+ codes_initialised@Base 6.1.20030421
+ col_code@Base 6.1.20030421
+ col_int@Base 6.1.20030421
+ combine_with_long_mismatches@Base 6.1.20030421
+ compactSearchDestruct@Base 6.1.20030421
+ compactSearchNew@Base 6.1.20030421
+ compare_quals@Base 6.1.20030421
+ compon@Base 6.1.20030421
+ convertProgramToFlag@Base 6.1.20030421
+ convertSeqAlignListToValNodeList@Base 6.1.20030421
+ convertValNodeListToSeqAlignList@Base 6.1.20030421
+ copyPosFreqs@Base 6.1.20030421
+ copySearchItems@Base 6.1.20030421
+ copy_m_stk_entry@Base 6.1.20030421
+ copy_qvalue@Base 6.1.20030421
+ cotl_win@Base 6.1.20030421
+ cotr_merge@Base 6.1.20030421
+ cotr_win@Base 6.1.20030421
+ cotupdate_active@Base 6.1.20030421
+ count_join@Base 6.1.20030421
+ createFakeProtein@Base 6.1.20030421
+ curS@Base 6.1.20030421
+ cur_end1@Base 6.1.20030421
+ cur_end@Base 6.1.20030421
+ cur_key@Base 6.1.20030421
+ cut@Base 6.1.20030421
+ db_cur_key@Base 6.1.20030421
+ db_delete@Base 6.1.20030421
+ db_delete_next@Base 6.1.20030421
+ db_freeList@Base 6.1.20030421
+ db_init@Base 6.1.20030421
+ db_insert@Base 6.1.20030421
+ db_insert_next@Base 6.1.20030421
+ db_key_next@Base 6.1.20030421
+ db_lsearch@Base 6.1.20030421
+ db_lsearch_next@Base 6.1.20030421
+ db_newList@Base 6.1.20030421
+ db_next@Base 6.1.20030421
+ db_next_key@Base 6.1.20030421
+ db_next_val@Base 6.1.20030421
+ db_prev_key@Base 6.1.20030421
+ db_prev_val@Base 6.1.20030421
+ db_randomLevel@Base 6.1.20030421
+ db_reset_pos@Base 6.1.20030421
+ db_rsearch@Base 6.1.20030421
+ db_rsearch_next@Base 6.1.20030421
+ db_snext@Base 6.1.20030421
+ db_sreset_pos@Base 6.1.20030421
+ db_update_node@Base 6.1.20030421
+ dblist_NIL_free@Base 6.1.20030421
+ decre@Base 6.1.20030421
+ decrementsv@Base 6.1.20030421
+ delete_by_key@Base 6.1.20030421
+ delete_next@Base 6.1.20030421
+ deleted_frags@Base 6.1.20030421
+ diag@Base 6.1.20030421
+ diag_flag@Base 6.1.20030421
+ diag_prev@Base 6.1.20030421
+ disjoint@Base 6.1.20030421
+ dna_len@Base 6.1.20030421
+ dna_seq@Base 6.1.20030421
+ do_the_blast_run@Base 6.1.20030421
+ eValueFit@Base 6.1.20030421
+ ecol@Base 6.1.20030421
+ edit_script_append@Base 6.1.20030421
+ edit_script_del@Base 6.1.20030421
+ edit_script_free@Base 6.1.20030421
+ edit_script_ins@Base 6.1.20030421
+ edit_script_new@Base 6.1.20030421
+ edit_script_rep@Base 6.1.20030421
+ edit_script_reverse_inplace@Base 6.1.20030421
+ encoding@Base 6.1.20030421
+ end_col@Base 6.1.20030421
+ end_row@Base 6.1.20030421
+ ensure_consistent_set@Base 6.1.20030421
+ enterS@Base 6.1.20030421
+ enter_endcol@Base 6.1.20030421
+ enter_endrow@Base 6.1.20030421
+ enton@Base 6.1.20030421
+ entropy@Base 6.1.20030421
+ erow@Base 6.1.20030421
+ err_message_mutex@Base 6.1.20030421
+ evalue_compare_hits@Base 6.1.20030421
+ ex_col@Base 6.1.20030421
+ ex_row@Base 6.1.20030421
+ ex_table@Base 6.1.20030421
+ fOldMsgHook@Base 6.1.20030421
+ falign@Base 6.1.20030421
+ fatal@Base 6.1.20030421
+ fatalf@Base 6.1.20030421
+ fbld_table@Base 6.1.20030421
+ feat_join@Base 6.1.20030421
+ ffound@Base 6.1.20030421
+ fillCandLambda@Base 6.1.20030421
+ filter_blast_query@Base 6.1.20030421
+ filter_repeats@Base 6.1.20030421
+ filter_repeats_for_bigloc@Base 6.1.20030421
+ findS@Base 6.1.20030421
+ find_best_set@Base 6.1.20030421
+ find_hits@Base 6.1.20030421
+ find_id@Base 6.1.20030421
+ findhi@Base 6.1.20030421
+ findlo@Base 6.1.20030421
+ findmaxS@Base 6.1.20030421
+ fix_overlaps_by_splice_sites@Base 6.1.20030421
+ fix_single_mismatches@Base 6.1.20030421
+ fix_single_unassigned@Base 6.1.20030421
+ found@Base 6.1.20030421
+ frag_print@Base 6.1.20030421
+ frame_compare_hsp_m1@Base 6.1.20030421
+ frame_compare_hsp_m2@Base 6.1.20030421
+ frame_compare_hsp_m3@Base 6.1.20030421
+ frame_compare_hsp_p1@Base 6.1.20030421
+ frame_compare_hsp_p2@Base 6.1.20030421
+ frame_compare_hsp_p3@Base 6.1.20030421
+ freeList@Base 6.1.20030421
+ free_align_list@Base 6.1.20030421
+ free_all@Base 6.1.20030421
+ free_alu_list@Base 6.1.20030421
+ free_mb_space@Base 6.1.20030421
+ free_table@Base 6.1.20030421
+ fscan@Base 6.1.20030421
+ fscan_init@Base 6.1.20030421
+ gap_cost@Base 6.1.20030421
+ gband_l3gap@Base 6.1.20030421
+ gband_linear@Base 6.1.20030421
+ gband_linear_gap@Base 6.1.20030421
+ gband_linear_qgap@Base 6.1.20030421
+ gband_q3gap@Base 6.1.20030421
+ gband_quadratic@Base 6.1.20030421
+ getAlphaBeta@Base 6.1.20030421
+ getCkptFreqMatrix@Base 6.1.20030421
+ getCkptNumber@Base 6.1.20030421
+ getFastaStyleTitle@Base 6.1.20030421
+ getRes@Base 6.1.20030421
+ getSplicePos@Base 6.1.20030421
+ get_a_pat@Base 6.1.20030421
+ get_align_score@Base 6.1.20030421
+ get_hits@Base 6.1.20030421
+ get_mb_space@Base 6.1.20030421
+ get_organism@Base 6.1.20030421
+ get_output_name@Base 6.1.20030421
+ get_qvalue@Base 6.1.20030421
+ get_score_value@Base 6.1.20030421
+ get_top_K@Base 6.1.20030421
+ get_top_K_alignment@Base 6.1.20030421
+ getprob@Base 6.1.20030421
+ global@Base 6.1.20030421
+ global_setup@Base 6.1.20030421
+ idb_freeList@Base 6.1.20030421
+ idb_key_next@Base 6.1.20030421
+ idb_newList@Base 6.1.20030421
+ idb_reset_pos@Base 6.1.20030421
+ impalaKarlinLambdaNR@Base 6.1.20030421
+ impalaMakeFileNames@Base 6.1.20030421
+ impalaReadCheckpoint@Base 6.1.20030421
+ impalaScaling@Base 6.1.20030421
+ incre@Base 6.1.20030421
+ incrementsv@Base 6.1.20030421
+ index_proc@Base 6.1.20030421
+ init@Base 6.1.20030421
+ initProbs@Base 6.1.20030421
+ init_order@Base 6.1.20030421
+ init_pattern@Base 6.1.20030421
+ insertS@Base 6.1.20030421
+ insert_hit@Base 6.1.20030421
+ insert_next@Base 6.1.20030421
+ intersect@Base 6.1.20030421
+ intlist@Base 6.1.20030421
+ isCommonIndex@Base 6.1.20030421
+ is_CONTIG@Base 6.1.20030421
+ is_EST_HUMAN@Base 6.1.20030421
+ is_EST_MOUSE@Base 6.1.20030421
+ is_EST_OTHERS@Base 6.1.20030421
+ is_MONTH@Base 6.1.20030421
+ is_PDB@Base 6.1.20030421
+ is_REFSEQ@Base 6.1.20050828
+ is_REFSEQ_GENOMIC@Base 6.1.20061015
+ is_REFSEQ_RNA@Base 6.1.20060507
+ is_SWISSPROT@Base 6.1.20030421
+ is_acceptor@Base 6.1.20030421
+ is_donor@Base 6.1.20030421
+ kFDBMaxNumVolumes@Base 6.1.20060507
+ kTaxidDeflineSearch_NotFound@Base 6.1.20050828
+ l_merge@Base 6.1.20030421
+ lactive_ext@Base 6.1.20030421
+ lastS@Base 6.1.20030421
+ laststr@Base 6.1.20030421
+ len1@Base 6.1.20030421
+ len2@Base 6.1.20030421
+ li_c@Base 6.1.20030421
+ li_d@Base 6.1.20030421
+ link_align@Base 6.1.20030421
+ link_blast_sap@Base 6.1.20030421
+ list_NIL_free@Base 6.1.20030421
+ ll1@Base 6.1.20030421
+ ll@Base 6.1.20030421
+ lnass@Base 6.1.20030421
+ lnfac@Base 6.1.20030421
+ lnperm@Base 6.1.20030421
+ load_align_to_interval@Base 6.1.20030421
+ load_dust_bsp@Base 6.1.20030421
+ load_options_to_buffer@Base 6.1.20030421
+ local@Base 6.1.20030421
+ lookup_add@Base 6.1.20030421
+ lookup_add_index@Base 6.1.20030421
+ lookup_destruct@Base 6.1.20030421
+ lookup_find_init@Base 6.1.20030421
+ lookup_new@Base 6.1.20030421
+ lookup_position_aux_destruct@Base 6.1.20030421
+ lower@Base 6.1.20030421
+ m_stk@Base 6.1.20030421
+ m_top@Base 6.1.20030421
+ make_align@Base 6.1.20030421
+ make_dust_bsp@Base 6.1.20030421
+ make_mod_lt@Base 6.1.20030421
+ make_repeat_lib@Base 6.1.20030421
+ make_sim_seq@Base 6.1.20030421
+ malign1@Base 6.1.20030421
+ malign@Base 6.1.20030421
+ mask@Base 6.1.20030421
+ mask_with_repeat_feature@Base 6.1.20030421
+ mb_lookup_position_aux_destruct@Base 6.1.20030421
+ mb_make_mod_lt@Base 6.1.20030421
+ merge_blast_result@Base 6.1.20030421
+ merge_two_list@Base 6.1.20030421
+ mergesegs@Base 6.1.20030421
+ mid1@Base 6.1.20030421
+ mid2@Base 6.1.20030421
+ minS@Base 6.1.20030421
+ minscoreS@Base 6.1.20030421
+ move_cds@Base 6.1.20030421
+ move_cds_ex@Base 6.1.20030421
+ mw@Base 6.1.20030421
+ ncbi4na_to_blastna@Base 6.1.20030421
+ newList@Base 6.1.20030421
+ new_info@Base 6.1.20030421
+ new_mb_space@Base 6.1.20030421
+ next@Base 6.1.20030421
+ next_key@Base 6.1.20030421
+ next_val@Base 6.1.20030421
+ number_frags@Base 6.1.20030421
+ offset1@Base 6.1.20030421
+ offset@Base 6.1.20030421
+ old_i_end@Base 6.1.20030421
+ old_i_start@Base 6.1.20030421
+ old_j_end@Base 6.1.20030421
+ old_j_start@Base 6.1.20030421
+ openwin@Base 6.1.20030421
+ otl_merge@Base 6.1.20030421
+ otl_survive@Base 6.1.20030421
+ otr_survive@Base 6.1.20030421
+ outputPosMatrix@Base 6.1.20030421
+ output_frags@Base 6.1.20030421
+ output_hits@Base 6.1.20030421
+ parse_blast_options@Base 6.1.20030421
+ pat_output@Base 6.1.20030421
+ pbf@Base 6.1.20030421
+ pbo@Base 6.1.20030421
+ per_mergesegs@Base 6.1.20030421
+ pf_set@Base 6.1.20030421
+ pff@Base 6.1.20030421
+ pfo@Base 6.1.20030421
+ posAllocateMemory@Base 6.1.20030421
+ posCancel@Base 6.1.20030421
+ posCheckWeights@Base 6.1.20030421
+ posCheckpointFreeMemory@Base 6.1.20030421
+ posCleanup@Base 6.1.20030421
+ posComputeExtents@Base 6.1.20030421
+ posComputePseudoFreqs@Base 6.1.20030421
+ posComputeSequenceWeights@Base 6.1.20030421
+ posConvergenceTest@Base 6.1.20030421
+ posDemographics@Base 6.1.20040616
+ posFreeInformation@Base 6.1.20030421
+ posFreqsToMatrix@Base 6.1.20030421
+ posInitializeInformation@Base 6.1.20030421
+ posPrintInformation@Base 6.1.20030421
+ posPurgeMatches@Base 6.1.20030421
+ posReadCheckpoint@Base 6.1.20030421
+ posScaling@Base 6.1.20030421
+ posTakeCheckpoint@Base 6.1.20030421
+ posTakeScoremat@Base 6.1.20041020
+ pos_diag@Base 6.1.20030421
+ power@Base 6.1.20030421
+ prepare_align_data@Base 6.1.20030421
+ printS@Base 6.1.20030421
+ pro_len@Base 6.1.20030421
+ pro_quicksort_hits@Base 6.1.20030421
+ process_sep@Base 6.1.20030421
+ prt_FASTA_file@Base 6.1.20030421
+ pt_lscore@Base 6.1.20030421
+ putScoresInSeqAlign@Base 6.1.20030421
+ query_end_compare_hsp@Base 6.1.20030421
+ query_offset_compare_hsp@Base 6.1.20030421
+ quicksort_hits@Base 6.1.20030421
+ r_add_point@Base 6.1.20030421
+ r_merge@Base 6.1.20030421
+ r_survive@Base 6.1.20030421
+ ractive_ext@Base 6.1.20030421
+ randomBits@Base 6.1.20030421
+ randomLevel@Base 6.1.20030421
+ randomsLeft@Base 6.1.20030421
+ rcbld_table@Base 6.1.20030421
+ rcblink@Base 6.1.20030421
+ rcbls@Base 6.1.20030421
+ rcbucket@Base 6.1.20030421
+ rccol_int@Base 6.1.20030421
+ rcdiag@Base 6.1.20030421
+ rcdiag_flag@Base 6.1.20030421
+ rcfound@Base 6.1.20030421
+ rcfree@Base 6.1.20030421
+ rcintersect@Base 6.1.20030421
+ rclocal@Base 6.1.20030421
+ rcpos_diag@Base 6.1.20030421
+ rcpt_lscore@Base 6.1.20030421
+ rcr_add_point@Base 6.1.20030421
+ rcr_merge@Base 6.1.20030421
+ rcupdate_active@Base 6.1.20030421
+ readdb_MakeGiFileBinary@Base 6.1.20030421
+ readdb_acc2fasta@Base 6.1.20030421
+ readdb_acc2fastaEx@Base 6.1.20030421
+ readdb_ambchar_present@Base 6.1.20030421
+ readdb_attach@Base 6.1.20030421
+ readdb_check_oid@Base 6.1.20081116
+ readdb_compare@Base 6.1.20030421
+ readdb_compare_basic@Base 6.1.20031028
+ readdb_copy@Base 6.1.20030421
+ readdb_destruct@Base 6.1.20030421
+ readdb_destruct_element@Base 6.1.20030421
+ readdb_get_ambchar@Base 6.1.20030421
+ readdb_get_asn1_defline@Base 6.1.20030421
+ readdb_get_bioseq@Base 6.1.20030421
+ readdb_get_bioseq_ex@Base 6.1.20030421
+ readdb_get_date@Base 6.1.20030421
+ readdb_get_dblen@Base 6.1.20030421
+ readdb_get_defline@Base 6.1.20030421
+ readdb_get_descriptor@Base 6.1.20030421
+ readdb_get_filebits@Base 6.1.20030421
+ readdb_get_filename@Base 6.1.20030421
+ readdb_get_formatdb_version@Base 6.1.20030421
+ readdb_get_full_filename@Base 6.1.20080302
+ readdb_get_header@Base 6.1.20030421
+ readdb_get_header_ex@Base 6.1.20030421
+ readdb_get_maxlen@Base 6.1.20030421
+ readdb_get_num_entries@Base 6.1.20030421
+ readdb_get_num_entries_total@Base 6.1.20030421
+ readdb_get_num_entries_total_real@Base 6.1.20030421
+ readdb_get_pig@Base 6.1.20030421
+ readdb_get_sequence@Base 6.1.20030421
+ readdb_get_sequence_ex@Base 6.1.20030421
+ readdb_get_sequence_length@Base 6.1.20030421
+ readdb_get_sequence_length_approx@Base 6.1.20040505
+ readdb_get_sequence_number@Base 6.1.20030421
+ readdb_get_stats_numbers@Base 6.1.20070822
+ readdb_get_taxnames@Base 6.1.20030421
+ readdb_get_taxonomy_names@Base 6.1.20030421
+ readdb_get_title@Base 6.1.20030421
+ readdb_get_totals@Base 6.1.20030421
+ readdb_get_totals_ex2@Base 6.1.20030421
+ readdb_get_totals_ex3@Base 6.1.20040505
+ readdb_get_totals_ex@Base 6.1.20030421
+ readdb_gi2seq@Base 6.1.20030421
+ readdb_is_prot@Base 6.1.20030421
+ readdb_madvise_block@Base 6.1.20030421
+ readdb_madvise_enable@Base 6.1.20030421
+ readdb_madvise_sync_mode@Base 6.1.20030421
+ readdb_madvise_type@Base 6.1.20030421
+ readdb_new@Base 6.1.20030421
+ readdb_new_ex2@Base 6.1.20030421
+ readdb_new_ex@Base 6.1.20030421
+ readdb_parse_db_names@Base 6.1.20030421
+ readdb_pig2oid@Base 6.1.20030421
+ readdb_preload@Base 6.1.20030421
+ readdb_seqid2fasta@Base 6.1.20030421
+ readdb_sequence_hash@Base 6.1.20060507
+ readdb_validate@Base 6.1.20060301
+ recom_setup@Base 6.1.20030421
+ recompute@Base 6.1.20030421
+ refresh_mb_space@Base 6.1.20030421
+ remove_OrgMod@Base 6.1.20030421
+ remove_descr@Base 6.1.20030421
+ remove_qual@Base 6.1.20030421
+ remove_redundant_intervals@Base 6.1.20030421
+ remove_subtype@Base 6.1.20030421
+ remove_xref@Base 6.1.20030421
+ replaceS@Base 6.1.20030421
+ reset_pos@Base 6.1.20030421
+ resolve@Base 6.1.20030421
+ restore_blast_id@Base 6.1.20030421
+ rev_seq@Base 6.1.20030421
+ reverse_seq@Base 6.1.20030421
+ rffound@Base 6.1.20030421
+ rfscan@Base 6.1.20030421
+ ri@Base 6.1.20030421
+ rotl_win@Base 6.1.20030421
+ rotr_merge@Base 6.1.20030421
+ rotr_win@Base 6.1.20030421
+ rotupdate_active@Base 6.1.20030421
+ row_code@Base 6.1.20030421
+ rr@Base 6.1.20030421
+ rsearch@Base 6.1.20030421
+ rsearch_next@Base 6.1.20030421
+ save_SeqAnnot@Base 6.1.20030421
+ sb1@Base 6.1.20030421
+ sb2@Base 6.1.20030421
+ scan@Base 6.1.20030421
+ scan_to_break@Base 6.1.20030421
+ score_compare_hsps@Base 6.1.20030421
+ se1@Base 6.1.20030421
+ se2@Base 6.1.20030421
+ search_pat@Base 6.1.20030421
+ seedEngineCore@Base 6.1.20030421
+ seed_free_all@Base 6.1.20030421
+ seq1@Base 6.1.20030421
+ seq2@Base 6.1.20030421
+ seq_loc_compare@Base 6.1.20030421
+ seq_phase@Base 6.1.20030421
+ seqent@Base 6.1.20030421
+ set_class@Base 6.1.20030421
+ setup@Base 6.1.20030421
+ shiftwin1@Base 6.1.20030421
+ sim_for_blast@Base 6.1.20030421
+ sizeS@Base 6.1.20030421
+ slp_callback@Base 6.1.20030421
+ snext@Base 6.1.20030421
+ sort_align_list@Base 6.1.20030421
+ split_target_seq@Base 6.1.20030421
+ sreset_pos@Base 6.1.20030421
+ stateon@Base 6.1.20030421
+ storeOneMatch@Base 6.1.20030421
+ strsame@Base 6.1.20030421
+ suggestError@Base 6.1.20030421
+ suggestOut@Base 6.1.20030421
+ suggestRec@Base 6.1.20030421
+ syn_area@Base 6.1.20030421
+ table_init@Base 6.1.20030421
+ tailor@Base 6.1.20030421
+ tie_feat@Base 6.1.20030421
+ tie_next_OrgMod@Base 6.1.20030421
+ tie_next_biosource@Base 6.1.20030421
+ tie_next_cbp@Base 6.1.20030421
+ tie_next_mol@Base 6.1.20030421
+ tie_next_subtype@Base 6.1.20030421
+ time_out_boolean@Base 6.1.20030421
+ topo_win@Base 6.1.20030421
+ toporg@Base 6.1.20030421
+ total_frags@Base 6.1.20030421
+ trcfound@Base 6.1.20030421
+ trcscan@Base 6.1.20030421
+ trim@Base 6.1.20030421
+ true_multiple@Base 6.1.20030421
+ true_qual@Base 6.1.20030421
+ tt1@Base 6.1.20030421
+ tt@Base 6.1.20030421
+ type@Base 6.1.20030421
+ ufreeList@Base 6.1.20030421
+ uinsert@Base 6.1.20030421
+ unewList@Base 6.1.20030421
+ unpack_dna_seq@Base 6.1.20030421
+ updateLambdaK@Base 6.1.20030421
+ update_active@Base 6.1.20030421
+ update_node@Base 6.1.20030421
+ upper@Base 6.1.20030421
+ urkFilterSeq@Base 6.1.20030421
+ usearch@Base 6.1.20030421
+ used_frag@Base 6.1.20030421
+ vx@Base 6.1.20030421
+ weight@Base 6.1.20030421
+ write_asn_output@Base 6.1.20030421
+ write_sim_output@Base 6.1.20030421
+ z_ALIGN@Base 6.1.20030421
+libncbitxc2.so.6 libncbi6 #MINVER#
+ CheckTaxId@Base 6.1.20030421
+ CloseTaxDB@Base 6.1.20030421
+ FDBTaxCallback@Base 6.1.20030421
+ GetSuperKingdom@Base 6.1.20030421
+ GetTaxserverOrg@Base 6.1.20030421
+ InitTaxDB@Base 6.1.20030421
+ RDTaxLookupClose@Base 6.1.20030421
+ RDTaxLookupInit@Base 6.1.20030421
+ RDTaxLookupReset@Base 6.1.20030421
+ TXBGetDefLine@Base 6.1.20030421
+ TXBHtmlReport@Base 6.1.20030421
+ TaxArchFini@Base 6.1.20030421
+ TaxArchInit@Base 6.1.20030421
+ TaxMergeBSinDescr@Base 6.1.20030421
+ Taxon1DataAsnRead@Base 6.1.20030421
+ Taxon1DataAsnWrite@Base 6.1.20030421
+ Taxon1DataFree@Base 6.1.20030421
+ Taxon1DataNew@Base 6.1.20030421
+ Taxon1ErrorAsnRead@Base 6.1.20030421
+ Taxon1ErrorAsnWrite@Base 6.1.20030421
+ Taxon1ErrorFree@Base 6.1.20030421
+ Taxon1ErrorNew@Base 6.1.20030421
+ Taxon1InfoAsnRead@Base 6.1.20030421
+ Taxon1InfoAsnWrite@Base 6.1.20030421
+ Taxon1InfoFree@Base 6.1.20030421
+ Taxon1InfoNew@Base 6.1.20030421
+ Taxon1NameAsnRead@Base 6.1.20030421
+ Taxon1NameAsnWrite@Base 6.1.20030421
+ Taxon1NameFree@Base 6.1.20030421
+ Taxon1NameNew@Base 6.1.20030421
+ Taxon1ReqAsnRead@Base 6.1.20030421
+ Taxon1ReqAsnWrite@Base 6.1.20030421
+ Taxon1ReqFree@Base 6.1.20030421
+ Taxon1RespAsnRead@Base 6.1.20030421
+ Taxon1RespAsnWrite@Base 6.1.20030421
+ Taxon1RespFree@Base 6.1.20030421
+ Taxon2DataAsnRead@Base 6.1.20030421
+ Taxon2DataAsnWrite@Base 6.1.20030421
+ Taxon2DataFree@Base 6.1.20030421
+ Taxon2DataNew@Base 6.1.20030421
+ check_org_ref@Base 6.1.20030421
+ get_embl_code@Base 6.1.20030421
+ get_gcode@Base 6.1.20030421
+ get_gcode_from_lineage@Base 6.1.20030421
+ get_lineage@Base 6.1.20030421
+ get_tax_division@Base 6.1.20030421
+ get_tax_org@Base 6.1.20030421
+ objtax1AsnLoad@Base 6.1.20030421
+ replace_org@Base 6.1.20030421
+ replace_org_err@Base 6.1.20030421
+ tax1_findAllTaxIdByName@Base 6.1.20030421
+ tax1_findTaxIdByName@Base 6.1.20030421
+ tax1_fini@Base 6.1.20030421
+ tax1_getAllNames@Base 6.1.20030421
+ tax1_getAllTaxIdByName@Base 6.1.20030421
+ tax1_getChildren@Base 6.1.20030421
+ tax1_getGCName@Base 6.1.20030421
+ tax1_getGenus@Base 6.1.20030421
+ tax1_getOrgRef@Base 6.1.20030421
+ tax1_getParent@Base 6.1.20030421
+ tax1_getTaxId4GI@Base 6.1.20030421
+ tax1_getTaxId4Str@Base 6.1.20030421
+ tax1_getTaxIdByName@Base 6.1.20030421
+ tax1_getTaxIdByOrgRef@Base 6.1.20030421
+ tax1_getbyid@Base 6.1.20030421
+ tax1_init@Base 6.1.20030421
+ tax1_inited@Base 6.1.20030421
+ tax1_isAlive@Base 6.1.20030421
+ tax1_join@Base 6.1.20030421
+ tax1_lookup@Base 6.1.20030421
+ tax1_setSynonyms@Base 6.1.20030421
+ tax1e_getTaxId@Base 6.1.20030421
+ tax1e_getTaxName@Base 6.1.20030421
+ tax1e_getTaxTreePtr@Base 6.1.20030421
+ tax1e_invokeChildren@Base 6.1.20030421
+ tax1e_invokeNode@Base 6.1.20030421
+ tax1e_maxTaxId@Base 6.1.20030421
+ tax1e_needUpdate@Base 6.1.20030421
+ tax1e_toNode@Base 6.1.20030421
+ tax1m_getBlastName@Base 6.1.20030421
+ tax1m_getOrgRef@Base 6.1.20030421
+ tax1m_getbyid@Base 6.1.20030421
+ tax1m_lookup@Base 6.1.20030421
+ tax_SSget@Base 6.1.20030421
+ tax_addDivision@Base 6.1.20030421
+ tax_addGC@Base 6.1.20030421
+ tax_addNameClass@Base 6.1.20030421
+ tax_addRank@Base 6.1.20030421
+ tax_dumpDivisions@Base 6.1.20030421
+ tax_dumpGCs@Base 6.1.20030421
+ tax_dumpNameClasses@Base 6.1.20030421
+ tax_dumpRanks@Base 6.1.20030421
+ tax_findByName@Base 6.1.20030421
+ tax_getBaseTime@Base 6.1.20030421
+ tax_getClass_cde@Base 6.1.20030421
+ tax_getDesignator@Base 6.1.20030421
+ tax_getDivision@Base 6.1.20030421
+ tax_getDivisionId@Base 6.1.20030421
+ tax_getGCId@Base 6.1.20030421
+ tax_getGCName@Base 6.1.20030421
+ tax_getIdByName@Base 6.1.20030421
+ tax_getNameClass@Base 6.1.20030421
+ tax_getOrgNames@Base 6.1.20030421
+ tax_getRank@Base 6.1.20030421
+ tax_getRankId@Base 6.1.20030421
+ tax_getTaxId4GI@Base 6.1.20030421
+ tax_getTime@Base 6.1.20030421
+ tax_init@Base 6.1.20030421
+ tax_prntTime@Base 6.1.20030421
+ tax_ptree_addChildren@Base 6.1.20030421
+ tax_ptree_addNode@Base 6.1.20030421
+ tax_ptree_addSubtree@Base 6.1.20030421
+ tax_ptree_new@Base 6.1.20030421
+ tax_ptree_toTaxId@Base 6.1.20030421
+ tax_uniqueName@Base 6.1.20030421
+ taxname_match@Base 6.1.20030421
+ taxname_replace@Base 6.1.20030421
+ txc_close@Base 6.1.20030421
+ txc_connect2Server@Base 6.1.20030421
+ txc_findByOrg@Base 6.1.20030421
+ txc_getChildren@Base 6.1.20030421
+ txc_getLineage@Base 6.1.20030421
+ txc_getTaxIdByOrgRef@Base 6.1.20030421
+ txc_loadDivisions@Base 6.1.20030421
+ txc_loadGCs@Base 6.1.20030421
+ txc_loadNameClasses@Base 6.1.20030421
+ txc_loadRanks@Base 6.1.20030421
+libnetblast.so.6 libncbi6 #MINVER#
+ BLASTGetUidsFromQuery@Base 6.1.20030421
+ Blast3GetDbinfo@Base 6.1.20030421
+ Blast3GetMotd@Base 6.1.20030421
+ BlastBioseq@Base 6.1.20030421
+ BlastBioseqNet@Base 6.1.20030421
+ BlastBioseqNetCore@Base 6.1.20030421
+ BlastBioseqNetReturnParts@Base 6.1.20030421
+ BlastDbinfoAsnRead@Base 6.1.20030421
+ BlastDbinfoAsnWrite@Base 6.1.20030421
+ BlastDbinfoFree@Base 6.1.20030421
+ BlastDbinfoGetAsnRead@Base 6.1.20030421
+ BlastDbinfoGetAsnWrite@Base 6.1.20030421
+ BlastDbinfoGetFree@Base 6.1.20030421
+ BlastDbinfoGetNew@Base 6.1.20030421
+ BlastDbinfoNew@Base 6.1.20030421
+ BlastDeflineAsnRead@Base 6.1.20030421
+ BlastDeflineAsnWrite@Base 6.1.20030421
+ BlastDeflineFree@Base 6.1.20030421
+ BlastDeflineNew@Base 6.1.20030421
+ BlastErrorAsnRead@Base 6.1.20030421
+ BlastErrorAsnWrite@Base 6.1.20030421
+ BlastErrorFree@Base 6.1.20030421
+ BlastErrorNew@Base 6.1.20030421
+ BlastFini@Base 6.1.20030421
+ BlastGetBioseq@Base 6.1.20030421
+ BlastGetDbInfo@Base 6.1.20030421
+ BlastGetKaParams@Base 6.1.20030421
+ BlastGetMaskedLoc@Base 6.1.20030421
+ BlastGetParameterBuffer@Base 6.1.20030421
+ BlastInit@Base 6.1.20030421
+ BlastKABlkAsnRead@Base 6.1.20030421
+ BlastKABlkAsnWrite@Base 6.1.20030421
+ BlastKABlkFree@Base 6.1.20030421
+ BlastKABlkNew@Base 6.1.20030421
+ BlastMaskAsnRead@Base 6.1.20030421
+ BlastMaskAsnWrite@Base 6.1.20030421
+ BlastMaskFree@Base 6.1.20030421
+ BlastMaskNew@Base 6.1.20030421
+ BlastMatrixAsnRead@Base 6.1.20030421
+ BlastMatrixAsnWrite@Base 6.1.20030421
+ BlastMatrixFree@Base 6.1.20030421
+ BlastMatrixNew@Base 6.1.20030421
+ BlastMatrixToBlastNetMatrix@Base 6.1.20030421
+ BlastNet3BlockDestruct@Base 6.1.20030421
+ BlastNet3BlockNew@Base 6.1.20030421
+ BlastNetBioseqFetchDisable@Base 6.1.20030421
+ BlastNetBioseqFetchEnable@Base 6.1.20030421
+ BlastNetMatrixToBlastMatrix@Base 6.1.20030421
+ BlastOptionsToParameters@Base 6.1.20030421
+ BlastParametersAsnRead@Base 6.1.20030421
+ BlastParametersAsnWrite@Base 6.1.20030421
+ BlastParametersFree@Base 6.1.20030421
+ BlastParametersNew@Base 6.1.20030421
+ BlastPartsAsnRead@Base 6.1.20030421
+ BlastPartsAsnWrite@Base 6.1.20030421
+ BlastPartsFree@Base 6.1.20030421
+ BlastPartsNew@Base 6.1.20030421
+ BlastPhialignAsnRead@Base 6.1.20030421
+ BlastPhialignAsnWrite@Base 6.1.20030421
+ BlastPhialignFree@Base 6.1.20030421
+ BlastPhialignNew@Base 6.1.20030421
+ BlastProgressAsnRead@Base 6.1.20030421
+ BlastProgressAsnWrite@Base 6.1.20030421
+ BlastProgressFree@Base 6.1.20030421
+ BlastProgressNew@Base 6.1.20030421
+ BlastQueuedAsnRead@Base 6.1.20030421
+ BlastQueuedAsnWrite@Base 6.1.20030421
+ BlastQueuedFree@Base 6.1.20030421
+ BlastQueuedNew@Base 6.1.20030421
+ BlastRequestAsnRead@Base 6.1.20030421
+ BlastRequestAsnWrite@Base 6.1.20030421
+ BlastRequestDbInfo@Base 6.1.20030421
+ BlastRequestFree@Base 6.1.20030421
+ BlastResponseAsnRead@Base 6.1.20030421
+ BlastResponseAsnWrite@Base 6.1.20030421
+ BlastResponseFree@Base 6.1.20030421
+ BlastSearchAsnRead@Base 6.1.20030421
+ BlastSearchAsnWrite@Base 6.1.20030421
+ BlastSearchFree@Base 6.1.20030421
+ BlastSearchNew@Base 6.1.20030421
+ BlastSeqIdAsnRead@Base 6.1.20030421
+ BlastSeqIdAsnWrite@Base 6.1.20030421
+ BlastSeqIdFree@Base 6.1.20030421
+ BlastSeqIdNew@Base 6.1.20030421
+ BlastSeqLocNet@Base 6.1.20030421
+ BlastSeqLocNetCore@Base 6.1.20030421
+ BlastSequenceAsnRead@Base 6.1.20030421
+ BlastSequenceAsnWrite@Base 6.1.20030421
+ BlastSequenceFree@Base 6.1.20030421
+ BlastSequenceNew@Base 6.1.20030421
+ BlastVersionAsnRead@Base 6.1.20030421
+ BlastVersionAsnWrite@Base 6.1.20030421
+ BlastVersionFree@Base 6.1.20030421
+ BlastVersionNew@Base 6.1.20030421
+ GetResponsePtr@Base 6.1.20030421
+ MegaBlastHitAsnRead@Base 6.1.20030421
+ MegaBlastHitAsnWrite@Base 6.1.20030421
+ MegaBlastHitFree@Base 6.1.20030421
+ MegaBlastHitNew@Base 6.1.20030421
+ MegaBlastResultsAsnRead@Base 6.1.20030421
+ MegaBlastResultsAsnWrite@Base 6.1.20030421
+ MegaBlastResultsFree@Base 6.1.20030421
+ MegaBlastResultsNew@Base 6.1.20030421
+ MegaBlastSeqLocNetCore@Base 6.1.20030421
+ NetBlastGetMatrix@Base 6.1.20030421
+ NetDbinfo2TxDbinfo@Base 6.1.20030421
+ QueryIsProteinFromType@Base 6.1.20030421
+ SeedBioseqNetCore@Base 6.1.20030421
+ SubmitRequest@Base 6.1.20030421
+ TraditionalBlastReport@Base 6.1.20030421
+ TraditionalBlastReportExtra@Base 6.1.20030421
+ TraditionalBlastReportLoc@Base 6.1.20030421
+ TraditionalBlastReportLocExtra@Base 6.1.20030421
+ dispatcher_lock@Base 6.1.20030421
+ objblst3AsnLoad@Base 6.1.20030421
+ parametersToOptions@Base 6.1.20030421
+libnetcli.so.6 libncbi6 #MINVER#
+ NI_EndServices@Base 6.1.20030421
+ NI_GenericGetService@Base 6.1.20030421
+ NI_GenericInit@Base 6.1.20030421
+ NI_GetEnvParam@Base 6.1.20030421
+ NI_GetEnvParamEx@Base 6.1.20030421
+ NI_IsInterfaceSupported@Base 6.1.20030421
+ NI_ServiceDisconnect@Base 6.1.20030421
+ NI_SetAddress@Base 6.1.20030421
+ NI_SetDispatcher@Base 6.1.20030421
+ NI_SetInterface@Base 6.1.20030421
+ g_NII_Debug@Base 6.1.20030421
+ g_NII_Service@Base 6.1.20030421
+ x_ni_errlist@Base 6.1.20030421
+ x_ni_errno@Base 6.1.20030421
+ x_ni_errtext@Base 6.1.20030421
+ x_ni_platform@Base 6.1.20030421
+libvibgif.so.6 libncbi6 #MINVER#
+ AddOval@Base 6.1.20030421
+ BLACK_COLOR@Base 6.1.20030421
+ BLUE_COLOR@Base 6.1.20030421
+ CYAN_COLOR@Base 6.1.20030421
+ GREEN_COLOR@Base 6.1.20030421
+ MAGENTA_COLOR@Base 6.1.20030421
+ Nlm_AddArc@Base 6.1.20030421
+ Nlm_AddAttribute@Base 6.1.20030421
+ Nlm_AddBitmap@Base 6.1.20030421
+ Nlm_AddInvFrame@Base 6.1.20030421
+ Nlm_AddLabel@Base 6.1.20030421
+ Nlm_AddLine@Base 6.1.20030421
+ Nlm_AddMarker@Base 6.1.20030421
+ Nlm_AddPolygon@Base 6.1.20030421
+ Nlm_AddPrimitive@Base 6.1.20030421
+ Nlm_AddPt@Base 6.1.20030421
+ Nlm_AddRectangle@Base 6.1.20030421
+ Nlm_AddRoundedRectangle@Base 6.1.20030421
+ Nlm_AddSegRect@Base 6.1.20030421
+ Nlm_AddSilentSegRect@Base 6.1.20030421
+ Nlm_AddSntRectangle@Base 6.1.20030421
+ Nlm_AddSymbol@Base 6.1.20030421
+ Nlm_AddTextLabel@Base 6.1.20030421
+ Nlm_Ascent@Base 6.1.20030421
+ Nlm_AssignPrinterFont@Base 6.1.20030421
+ Nlm_Black@Base 6.1.20030421
+ Nlm_Blue@Base 6.1.20030421
+ Nlm_BoxInViewport@Base 6.1.20030421
+ Nlm_ChangeAddPrimOrder@Base 6.1.20030421
+ Nlm_ChangePrimAttribute@Base 6.1.20030421
+ Nlm_ChangeSentinelRectangle@Base 6.1.20030421
+ Nlm_CharWidth@Base 6.1.20030421
+ Nlm_CleanUpDrawingTools@Base 6.1.20030421
+ Nlm_CleanupPrimitive@Base 6.1.20030421
+ Nlm_ClearRgn@Base 6.1.20030421
+ Nlm_ClipRect@Base 6.1.20030421
+ Nlm_ClipRgn@Base 6.1.20030421
+ Nlm_CopyBits@Base 6.1.20030421
+ Nlm_CopyFont@Base 6.1.20030421
+ Nlm_CopyMode@Base 6.1.20030421
+ Nlm_CopyPixmap@Base 6.1.20030421
+ Nlm_Courier@Base 6.1.20030421
+ Nlm_CreateFont@Base 6.1.20030421
+ Nlm_CreateGIF@Base 6.1.20030421
+ Nlm_CreatePicture@Base 6.1.20030421
+ Nlm_CreateRgn@Base 6.1.20030421
+ Nlm_CreateSegment@Base 6.1.20030421
+ Nlm_Cyan@Base 6.1.20030421
+ Nlm_Dark@Base 6.1.20030421
+ Nlm_Dashed@Base 6.1.20030421
+ Nlm_DecodeColor@Base 6.1.20030421
+ Nlm_DeleteFont@Base 6.1.20030421
+ Nlm_DeletePicture@Base 6.1.20030421
+ Nlm_DeletePrim@Base 6.1.20030421
+ Nlm_DeleteSegment@Base 6.1.20030421
+ Nlm_Descent@Base 6.1.20030421
+ Nlm_DestroyGIF@Base 6.1.20030421
+ Nlm_DestroyRgn@Base 6.1.20030421
+ Nlm_DiffRgn@Base 6.1.20030421
+ Nlm_DkGray@Base 6.1.20030421
+ Nlm_Dotted@Base 6.1.20030421
+ Nlm_DrawLine@Base 6.1.20030421
+ Nlm_DrawPrimitive@Base 6.1.20030421
+ Nlm_DrawSegment@Base 6.1.20030421
+ Nlm_DrawString@Base 6.1.20030421
+ Nlm_DrawText@Base 6.1.20030421
+ Nlm_Empty@Base 6.1.20030421
+ Nlm_EmptyRect@Base 6.1.20030421
+ Nlm_EmptyRgn@Base 6.1.20030421
+ Nlm_EqualFontSpec@Base 6.1.20030421
+ Nlm_EqualPt@Base 6.1.20030421
+ Nlm_EqualRect@Base 6.1.20030421
+ Nlm_EqualRgn@Base 6.1.20030421
+ Nlm_EraseArc@Base 6.1.20030421
+ Nlm_EraseMode@Base 6.1.20030421
+ Nlm_EraseOval@Base 6.1.20030421
+ Nlm_ErasePoly@Base 6.1.20030421
+ Nlm_EraseQuadrant@Base 6.1.20030421
+ Nlm_EraseRect@Base 6.1.20030421
+ Nlm_EraseRgn@Base 6.1.20030421
+ Nlm_EraseRoundRect@Base 6.1.20030421
+ Nlm_ExploreSegment@Base 6.1.20030421
+ Nlm_FindNextResidentFont@Base 6.1.20030421
+ Nlm_FindPrimGIF@Base 6.1.20030421
+ Nlm_FindSegGIF@Base 6.1.20030421
+ Nlm_FitStringWidth@Base 6.1.20030421
+ Nlm_FontHeight@Base 6.1.20030421
+ Nlm_FrameArc@Base 6.1.20030421
+ Nlm_FrameOval@Base 6.1.20030421
+ Nlm_FramePoly@Base 6.1.20030421
+ Nlm_FrameQuadrant@Base 6.1.20030421
+ Nlm_FrameRect@Base 6.1.20030421
+ Nlm_FrameRgn@Base 6.1.20030421
+ Nlm_FrameRoundRect@Base 6.1.20030421
+ Nlm_GetColor@Base 6.1.20030421
+ Nlm_GetColorRGB@Base 6.1.20030421
+ Nlm_GetFont@Base 6.1.20030421
+ Nlm_GetFontEx@Base 6.1.20030421
+ Nlm_GetFontSpec@Base 6.1.20030421
+ Nlm_GetHitWindow@Base 6.1.20030421
+ Nlm_GetOffsetX@Base 6.1.20030421
+ Nlm_GetOffsetY@Base 6.1.20030421
+ Nlm_GetPen@Base 6.1.20030421
+ Nlm_GetPrimDrawAttribute@Base 6.1.20030421
+ Nlm_GetPrimHligh@Base 6.1.20030421
+ Nlm_GetPrimitive@Base 6.1.20030421
+ Nlm_GetPrimitiveIDs@Base 6.1.20030421
+ Nlm_GetResidentFont@Base 6.1.20030421
+ Nlm_GetScaleX@Base 6.1.20030421
+ Nlm_GetScaleY@Base 6.1.20030421
+ Nlm_GetWorldWindow@Base 6.1.20030421
+ Nlm_Gothic@Base 6.1.20030421
+ Nlm_GothicFixed@Base 6.1.20030421
+ Nlm_Gray@Base 6.1.20030421
+ Nlm_Green@Base 6.1.20030421
+ Nlm_Helvetica@Base 6.1.20030421
+ Nlm_InsetRect@Base 6.1.20030421
+ Nlm_InvalRect@Base 6.1.20030421
+ Nlm_InvalRgn@Base 6.1.20030421
+ Nlm_InvertArc@Base 6.1.20030421
+ Nlm_InvertColors@Base 6.1.20030421
+ Nlm_InvertMode@Base 6.1.20030421
+ Nlm_InvertOval@Base 6.1.20030421
+ Nlm_InvertPoly@Base 6.1.20030421
+ Nlm_InvertQuadrant@Base 6.1.20030421
+ Nlm_InvertRect@Base 6.1.20030421
+ Nlm_InvertRgn@Base 6.1.20030421
+ Nlm_InvertRoundRect@Base 6.1.20030421
+ Nlm_IsLineInVPort@Base 6.1.20030421
+ Nlm_Leading@Base 6.1.20030421
+ Nlm_Light@Base 6.1.20030421
+ Nlm_LineHeight@Base 6.1.20030421
+ Nlm_LineIntoVPort@Base 6.1.20030421
+ Nlm_LineTo@Base 6.1.20030421
+ Nlm_LinkSegment@Base 6.1.20030421
+ Nlm_LoadBox@Base 6.1.20030421
+ Nlm_LoadPt@Base 6.1.20030421
+ Nlm_LoadRect@Base 6.1.20030421
+ Nlm_LoadRectRgn@Base 6.1.20030421
+ Nlm_LtGray@Base 6.1.20030421
+ Nlm_Magenta@Base 6.1.20030421
+ Nlm_MapPixelPointToWorld@Base 6.1.20030421
+ Nlm_MapRectToWorldBox@Base 6.1.20030421
+ Nlm_MapWorldBoxToRect@Base 6.1.20030421
+ Nlm_MapWorldPointToPixel@Base 6.1.20030421
+ Nlm_MaxCharWidth@Base 6.1.20030421
+ Nlm_Medium@Base 6.1.20030421
+ Nlm_MergeMode@Base 6.1.20030421
+ Nlm_Minchou@Base 6.1.20030421
+ Nlm_MinchouFixed@Base 6.1.20030421
+ Nlm_MoveTo@Base 6.1.20030421
+ Nlm_NormalizeBox@Base 6.1.20030421
+ Nlm_OffsetPrim@Base 6.1.20030421
+ Nlm_OffsetRect@Base 6.1.20030421
+ Nlm_OffsetRgn@Base 6.1.20030421
+ Nlm_OffsetSegment@Base 6.1.20030421
+ Nlm_OutsetBox@Base 6.1.20030421
+ Nlm_PaintArc@Base 6.1.20030421
+ Nlm_PaintChar@Base 6.1.20030421
+ Nlm_PaintOval@Base 6.1.20030421
+ Nlm_PaintPoly@Base 6.1.20030421
+ Nlm_PaintQuadrant@Base 6.1.20030421
+ Nlm_PaintRect@Base 6.1.20030421
+ Nlm_PaintRgn@Base 6.1.20030421
+ Nlm_PaintRoundRect@Base 6.1.20030421
+ Nlm_PaintString@Base 6.1.20030421
+ Nlm_PaintStringEx@Base 6.1.20030421
+ Nlm_PaintText@Base 6.1.20030421
+ Nlm_ParentSegment@Base 6.1.20030421
+ Nlm_ParseFont@Base 6.1.20030421
+ Nlm_ParseFontEx@Base 6.1.20030421
+ Nlm_Picture2gdImage@Base 6.1.20030421
+ Nlm_PictureToGIF@Base 6.1.20030421
+ Nlm_PrimitiveBox@Base 6.1.20030421
+ Nlm_PrimitiveIsCloseToPoint@Base 6.1.20030421
+ Nlm_PtInRect@Base 6.1.20030421
+ Nlm_PtInRgn@Base 6.1.20030421
+ Nlm_RecalculateSegment@Base 6.1.20030421
+ Nlm_RectInRect@Base 6.1.20030421
+ Nlm_RectInRgn@Base 6.1.20030421
+ Nlm_Red@Base 6.1.20030421
+ Nlm_ResetClip@Base 6.1.20030421
+ Nlm_ResetDrawingTools@Base 6.1.20030421
+ Nlm_ResetSegment@Base 6.1.20030421
+ Nlm_RestorePrimAttribute@Base 6.1.20030421
+ Nlm_SaveGIF@Base 6.1.20030421
+ Nlm_ScrollRect@Base 6.1.20030421
+ Nlm_SearchSegment@Base 6.1.20030421
+ Nlm_SectRect@Base 6.1.20030421
+ Nlm_SectRgn@Base 6.1.20030421
+ Nlm_SegmentBox@Base 6.1.20030421
+ Nlm_SegmentID@Base 6.1.20030421
+ Nlm_SegmentStyle@Base 6.1.20030421
+ Nlm_SegmentVisible@Base 6.1.20030421
+ Nlm_SelectColor@Base 6.1.20030421
+ Nlm_SelectFont@Base 6.1.20030421
+ Nlm_SetColor@Base 6.1.20030421
+ Nlm_SetColorEx@Base 6.1.20030421
+ Nlm_SetCurrentGIF@Base 6.1.20030421
+ Nlm_SetDefArrowSize@Base 6.1.20030421
+ Nlm_SetLargeFont@Base 6.1.20030421
+ Nlm_SetMediumFont@Base 6.1.20030421
+ Nlm_SetPen@Base 6.1.20030421
+ Nlm_SetPenDash@Base 6.1.20030421
+ Nlm_SetPenPattern@Base 6.1.20030421
+ Nlm_SetPenWidth@Base 6.1.20080302
+ Nlm_SetPrimAttribute@Base 6.1.20030421
+ Nlm_SetPrimitiveIDs@Base 6.1.20030421
+ Nlm_SetSegmentVisibleFlag@Base 6.1.20030421
+ Nlm_SetSmallFont@Base 6.1.20030421
+ Nlm_SetUpDrawingTools@Base 6.1.20030421
+ Nlm_Solid@Base 6.1.20030421
+ Nlm_StringWidth@Base 6.1.20030421
+ Nlm_SubPt@Base 6.1.20030421
+ Nlm_Symbol@Base 6.1.20030421
+ Nlm_TextWidth@Base 6.1.20030421
+ Nlm_Times@Base 6.1.20030421
+ Nlm_TryGetPrimitiveLimits@Base 6.1.20030421
+ Nlm_TryHighlightPrimitive@Base 6.1.20030421
+ Nlm_TryOffsetPrimitive@Base 6.1.20030421
+ Nlm_UnionRect@Base 6.1.20030421
+ Nlm_UnionRgn@Base 6.1.20030421
+ Nlm_UnlinkSegment@Base 6.1.20030421
+ Nlm_UpdateColorTable@Base 6.1.20030421
+ Nlm_UpsetRect@Base 6.1.20030421
+ Nlm_ValidRect@Base 6.1.20030421
+ Nlm_ValidRgn@Base 6.1.20030421
+ Nlm_VibrantIsGUI@Base 6.1.20030421
+ Nlm_VibrantSetGUI@Base 6.1.20030421
+ Nlm_White@Base 6.1.20030421
+ Nlm_WidePen@Base 6.1.20030421
+ Nlm_XorRgn@Base 6.1.20030421
+ Nlm_Yellow@Base 6.1.20030421
+ Nlm_isPrimInWindow@Base 6.1.20030421
+ Nlm_largeFont@Base 6.1.20030421
+ Nlm_mediumFont@Base 6.1.20030421
+ Nlm_nowPrinting@Base 6.1.20030421
+ Nlm_programFont@Base 6.1.20030421
+ Nlm_smallFont@Base 6.1.20030421
+ Nlm_stdAscent@Base 6.1.20030421
+ Nlm_stdCharWidth@Base 6.1.20030421
+ Nlm_stdDescent@Base 6.1.20030421
+ Nlm_stdFontHeight@Base 6.1.20030421
+ Nlm_stdLeading@Base 6.1.20030421
+ Nlm_stdLineHeight@Base 6.1.20030421
+ Nlm_systemFont@Base 6.1.20030421
+ Nlm_updateRect@Base 6.1.20030421
+ Nlm_updateRgn@Base 6.1.20030421
+ RED_COLOR@Base 6.1.20030421
+ WHITE_COLOR@Base 6.1.20030421
+ YELLOW_COLOR@Base 6.1.20030421
+ blackAttPData@Base 6.1.20030421
+ gdFont5X8@Base 6.1.20030421
+ gdFont6X12@Base 6.1.20030421
+ gdFont7X13b@Base 6.1.20030421
+ gdFont8X16@Base 6.1.20030421
+ gdFont9X15b@Base 6.1.20030421
+ main@Base 6.1.20030421
+ whiteAttPData@Base 6.1.20030421
diff --git a/debian/libvibrant6-dev.install b/debian/libvibrant6-dev.install
new file mode 100644
index 00000000..231eb98b
--- /dev/null
+++ b/debian/libvibrant6-dev.install
@@ -0,0 +1,87 @@
+usr/include/ncbi/aacomp.h
+usr/include/ncbi/algorend.h
+usr/include/ncbi/apparam.h
+usr/include/ncbi/biosrc.h
+usr/include/ncbi/bspview.h
+usr/include/ncbi/cdrgn.h
+usr/include/ncbi/cn3d*.h
+usr/include/ncbi/ddvclick.h
+usr/include/ncbi/ddvcreate.h
+usr/include/ncbi/ddvgraph.h
+usr/include/ncbi/ddvmain.h
+usr/include/ncbi/ddvopen.h
+usr/include/ncbi/ddvpanel.h
+usr/include/ncbi/diagnost.h
+usr/include/ncbi/dlogutil.h
+usr/include/ncbi/document.h
+usr/include/ncbi/dotmatrx.h
+usr/include/ncbi/dotviewer.h
+usr/include/ncbi/drawingp.h
+usr/include/ncbi/drawseq.h
+usr/include/ncbi/entrez*.h
+usr/include/ncbi/fea2seg.h
+usr/include/ncbi/fstyle*.h
+usr/include/ncbi/glbpic.h
+usr/include/ncbi/gphdraw.h
+usr/include/ncbi/gtrdraw.h
+usr/include/ncbi/gxydraw.h
+usr/include/ncbi/image*.h
+usr/include/ncbi/import.h
+usr/include/ncbi/ingen*.h
+usr/include/ncbi/layout.h
+usr/include/ncbi/legend.h
+usr/include/ncbi/macrodlg.h
+usr/include/ncbi/mapgene.h
+usr/include/ncbi/mappingp.h
+usr/include/ncbi/medview.h
+usr/include/ncbi/motif.h
+usr/include/ncbi/ncbidraw.h
+usr/include/ncbi/ncbigif.h
+usr/include/ncbi/ncbiport.h
+usr/include/ncbi/netscape.h
+usr/include/ncbi/odlbox.h
+usr/include/ncbi/panels.h
+usr/include/ncbi/pictur*.h
+usr/include/ncbi/ppict3d.h
+usr/include/ncbi/prtgene.h
+usr/include/ncbi/pubdesc.h
+usr/include/ncbi/saldist.h
+usr/include/ncbi/saled.h
+usr/include/ncbi/saledit.h
+usr/include/ncbi/salfiles.h
+usr/include/ncbi/salogif.h
+usr/include/ncbi/salpanel.h
+usr/include/ncbi/salparam.h
+usr/include/ncbi/sdisplay.h
+usr/include/ncbi/seqanal.h
+usr/include/ncbi/seqcons.h
+usr/include/ncbi/seqfltr.h
+usr/include/ncbi/seqgraph.h
+usr/include/ncbi/seqgrphx.h
+usr/include/ncbi/seqmtrx.h
+usr/include/ncbi/seqpanel.h
+usr/include/ncbi/seqpcc.h
+usr/include/ncbi/seqscrl.h
+usr/include/ncbi/seqsub.h
+usr/include/ncbi/shim3d.h
+usr/include/ncbi/treevi*.h
+usr/include/ncbi/udvdef.h
+usr/include/ncbi/udviewer.h
+usr/include/ncbi/udvseq.h
+usr/include/ncbi/urkgraph.h
+usr/include/ncbi/valdlg.h
+usr/include/ncbi/vib*.h
+usr/include/ncbi/viewer*.h
+usr/include/ncbi/vsm*.h
+usr/lib/*/libddvlib.a
+usr/lib/*/libddvlib.so
+usr/lib/*/libncbicn3d*.a
+usr/lib/*/libncbicn3d*.so
+usr/lib/*/libncbidesk.a
+usr/lib/*/libncbidesk.so
+usr/lib/*/libvibgif.a
+usr/lib/*/libvibgif.so
+usr/lib/*/libvibnet.a
+usr/lib/*/libvibnet.so
+usr/lib/*/libvibrant*.a
+usr/lib/*/libvibrant*.so
diff --git a/debian/libvibrant6-dev.postinst b/debian/libvibrant6-dev.postinst
new file mode 100644
index 00000000..82adcf5f
--- /dev/null
+++ b/debian/libvibrant6-dev.postinst
@@ -0,0 +1,13 @@
+#!/bin/sh
+set -e
+
+# Formerly used to support libvibrant6-gl-dev's shenanigans. (Don't ask.)
+olddir=/usr/lib/libvibrant-nogl
+
+if [ "$1" = configure ] && [ -d $olddir ]; then
+ echo "Cleaning up obsolete directory $olddir ..."
+ rm -f $olddir/libncbicn3d.so.6 $olddir/libvibrant.so.6
+ rmdir --ignore-fail-on-non-empty $olddir
+fi
+
+#DEBHELPER#
diff --git a/debian/libvibrant6b.install b/debian/libvibrant6b.install
new file mode 100644
index 00000000..4c3c16ff
--- /dev/null
+++ b/debian/libvibrant6b.install
@@ -0,0 +1,5 @@
+usr/lib/*/libddvlib.so.*
+usr/lib/*/libncbicn3d*.so.*
+usr/lib/*/libncbidesk.so.*
+usr/lib/*/libvibnet.so.*
+usr/lib/*/libvibrant*.so.*
diff --git a/debian/libvibrant6b.lintian-overrides b/debian/libvibrant6b.lintian-overrides
new file mode 100644
index 00000000..5604f7ac
--- /dev/null
+++ b/debian/libvibrant6b.lintian-overrides
@@ -0,0 +1 @@
+libvibrant6b: package-name-doesnt-match-sonames
diff --git a/debian/libvibrant6b.symbols b/debian/libvibrant6b.symbols
new file mode 100644
index 00000000..1f48382f
--- /dev/null
+++ b/debian/libvibrant6b.symbols
@@ -0,0 +1,2469 @@
+libddvlib.so.6 libvibrant6b #MINVER#
+ DDVResetProc@Base 6.1.20060507
+ DDV_AdjustDrawingRect@Base 6.1.20060507
+ DDV_Blast2Seqs@Base 6.1.20060507
+ DDV_Cancel@Base 6.1.20060507
+ DDV_CleanupDDVPdata_g@Base 6.1.20060507
+ DDV_ClickProc@Base 6.1.20060507
+ DDV_ClickProcLower@Base 6.1.20060507
+ DDV_ClickProcUpper@Base 6.1.20060507
+ DDV_CloseData@Base 6.1.20060507
+ DDV_ComputeColWidth@Base 6.1.20060507
+ DDV_ComputeRuler@Base 6.1.20060507
+ DDV_CreateDataForEditor@Base 6.1.20060507
+ DDV_CreateViewerPanel@Base 6.1.20060507
+ DDV_DispPositionInStatus@Base 6.1.20060507
+ DDV_DoAlign@Base 6.1.20060507
+ DDV_DragProc@Base 6.1.20060507
+ DDV_DrawPanelContent@Base 6.1.20060507
+ DDV_DrawPanelContent_H@Base 6.1.20060507
+ DDV_DrawViewer@Base 6.1.20060507
+ DDV_EnableGotoTBItems@Base 6.1.20060507
+ DDV_FileCloseIt@Base 6.1.20060507
+ DDV_GetAndCheckSeqAlign@Base 6.1.20060507
+ DDV_GetCharBufferForEditor@Base 6.1.20060507
+ DDV_GetColNumberGivenMousePos@Base 6.1.20060507
+ DDV_GetCurrentDispRange@Base 6.1.20060507
+ DDV_GetHPixelPosGivenColNumber@Base 6.1.20060507
+ DDV_GetHPixelPosGivenColNumberAndScroll@Base 6.1.20060507
+ DDV_GetMtdpListForEditor@Base 6.1.20060507
+ DDV_GetRulerForEditor@Base 6.1.20060507
+ DDV_GetSelectedRegions@Base 6.1.20060507
+ DDV_GetSeqNameGivenRow@Base 6.1.20060507
+ DDV_GetVPixelPosGivenRowNumber@Base 6.1.20060507
+ DDV_GetVPixelPosGivenRowNumberAndScroll@Base 6.1.20060507
+ DDV_GetVPixelPosOfEmptySpace@Base 6.1.20060507
+ DDV_GreyOut@Base 6.1.20060507
+ DDV_HScrlProc@Base 6.1.20060507
+ DDV_HideDlg@Base 6.1.20060507
+ DDV_HideDlgItem@Base 6.1.20060507
+ DDV_HoldProc@Base 6.1.20060507
+ DDV_ImportBioseq@Base 6.1.20060507
+ DDV_ImportBioseqDlg@Base 6.1.20060507
+ DDV_ImportCB@Base 6.1.20060507
+ DDV_ImportNucSeqAlign@Base 6.1.20060507
+ DDV_ImportProtSeqAlign@Base 6.1.20060507
+ DDV_InitGraphGlobal@Base 6.1.20060507
+ DDV_InitPanelData@Base 6.1.20060507
+ DDV_InvalRegion@Base 6.1.20060507
+ DDV_IsLetterSelected@Base 6.1.20060507
+ DDV_KeyboardProc@Base 6.1.20060507
+ DDV_NoSave@Base 6.1.20060507
+ DDV_ObjRegMasterEditDDV@Base 6.1.20060507
+ DDV_ObjRegMasterViewDDV@Base 6.1.20060507
+ DDV_ObjRegSlaveEditDDV@Base 6.1.20060507
+ DDV_ObjRegSlaveViewDDV@Base 6.1.20060507
+ DDV_OpenFile@Base 6.1.20060507
+ DDV_OpenNetwork@Base 6.1.20060507
+ DDV_ReDraw@Base 6.1.20060507
+ DDV_ReDrawAtCol@Base 6.1.20060507
+ DDV_ReleaseProc@Base 6.1.20060507
+ DDV_Resize_DDV@Base 6.1.20060507
+ DDV_Save@Base 6.1.20060507
+ DDV_SaveEdits@Base 6.1.20060507
+ DDV_SetMenuFocus@Base 6.1.20060507
+ DDV_SetRulerAttribInPGP@Base 6.1.20060507
+ DDV_SetupMenus@Base 6.1.20060507
+ DDV_SetupWin@Base 6.1.20060507
+ DDV_ShredAln@Base 6.1.20060507
+ DDV_SlaveQuit@Base 6.1.20060507
+ DDV_SortPGPLineNum@Base 6.1.20060507
+ DDV_StartMainWin_Slave@Base 6.1.20060507
+ DDV_TimerProc@Base 6.1.20060507
+ DDV_UpdateHScrollVal@Base 6.1.20060507
+ DDV_UpdateVScrollVal@Base 6.1.20060507
+ DDV_VHScrl@Base 6.1.20060507
+ DDV_VScrlProc@Base 6.1.20060507
+ DDV_WhatSize@Base 6.1.20060507
+ DDV_WinMainCleanup@Base 6.1.20060507
+ DDV_WinMainProgQuit@Base 6.1.20060507
+ DDV_WinMainResize@Base 6.1.20060507
+ ddvPageData@Base 6.1.20060507
+ szAppName2@Base 6.1.20060507
+ szAppName@Base 6.1.20060507
+libncbicn3dOGL.so.6 libvibrant6b #MINVER#
+ AlgorithmicRendering@Base 6.1.20060507
+ AssignDomainAlignedStatus@Base 6.1.20060507
+ AssignDomainAlignedStatusForStrucSeqs@Base 6.1.20060507
+ CSC_CalculateColumnColors@Base 6.1.20060507
+ CSC_GetAlgorithmName@Base 6.1.20060507
+ CSC_GetColumnColorByRow@Base 6.1.20060507
+ CSC_SetAllDDVRowCells@Base 6.1.20060507
+ CSC_SetDDVRowCells@Base 6.1.20060507
+ CSC_SetNonStructureDDVRowCells@Base 6.1.20060507
+ ClearDomainData@Base 6.1.20060507
+ ClearRest@Base 6.1.20060507
+ ClearSequences@Base 6.1.20060507
+ Cn3DAddUserDefinedFeatureToBiostruc@Base 6.1.20060507
+ Cn3DCheckAndDoHighlight@Base 6.1.20060507
+ Cn3DCheckHighlighted@Base 6.1.20060507
+ Cn3DCheckNoSingleHighlight@Base 6.1.20060507
+ Cn3DFetchSeqEntry@Base 6.1.20060507
+ Cn3DIndexUserDefinedFeature@Base 6.1.20060507
+ Cn3DMime@Base 6.1.20060507
+ Cn3DRemoveUserDefinedFeatureFromBiostruc@Base 6.1.20060507
+ Cn3DResizeProc@Base 6.1.20060507
+ Cn3DWin@Base 6.1.20060507
+ Cn3DWin_Entrez@Base 6.1.20060507
+ Cn3D_Accession2Gi@Base 6.1.20060507
+ Cn3D_AddFeatureSet@Base 6.1.20060507
+ Cn3D_Animate@Base 6.1.20060507
+ Cn3D_AnnotEditFunc@Base 6.1.20060507
+ Cn3D_Asn2Matrix@Base 6.1.20060507
+ Cn3D_CheckNetworkUse@Base 6.1.20060507
+ Cn3D_ColCPK@Base 6.1.20060507
+ Cn3D_ColCyChain@Base 6.1.20060507
+ Cn3D_ColDomain@Base 6.1.20060507
+ Cn3D_ColHydro@Base 6.1.20060507
+ Cn3D_ColObject@Base 6.1.20060507
+ Cn3D_ColRes@Base 6.1.20060507
+ Cn3D_ColSecStruc@Base 6.1.20060507
+ Cn3D_ColSeqCons@Base 6.1.20060507
+ Cn3D_ColStrucAlign@Base 6.1.20060507
+ Cn3D_ColTemp@Base 6.1.20060507
+ Cn3D_ColorData@Base 6.1.20060507
+ Cn3D_ColorFuncFind@Base 6.1.20060507
+ Cn3D_ColorFuncName@Base 6.1.20060507
+ Cn3D_ColorList@Base 6.1.20060507
+ Cn3D_ColorSpecial@Base 6.1.20060507
+ Cn3D_Color_BYCHAIN@Base 6.1.20060507
+ Cn3D_Color_BYDOMAIN@Base 6.1.20060507
+ Cn3D_Color_BYHYDRO@Base 6.1.20060507
+ Cn3D_Color_BYOBJECT@Base 6.1.20060507
+ Cn3D_Color_BYRES@Base 6.1.20060507
+ Cn3D_Color_BYSECSTRUC@Base 6.1.20060507
+ Cn3D_Color_BYSEQCONS@Base 6.1.20060507
+ Cn3D_Color_BYSTRUCCONS@Base 6.1.20060507
+ Cn3D_Color_BYTEMP@Base 6.1.20060507
+ Cn3D_Color_CPK@Base 6.1.20060507
+ Cn3D_ConstructColorData@Base 6.1.20060507
+ Cn3D_CountDomainProc@Base 6.1.20060507
+ Cn3D_CountRows@Base 6.1.20060507
+ Cn3D_DestructColorData@Base 6.1.20060507
+ Cn3D_DisableFileOps@Base 6.1.20060507
+ Cn3D_DisableMenus@Base 6.1.20060507
+ Cn3D_DisplayProc@Base 6.1.20060507
+ Cn3D_EnableFileOps@Base 6.1.20060507
+ Cn3D_EnableMenus@Base 6.1.20060507
+ Cn3D_EntrezOn@Base 6.1.20060507
+ Cn3D_ExportSub@Base 6.1.20060507
+ Cn3D_FindFeature@Base 6.1.20060507
+ Cn3D_GetCurrentOGLData@Base 6.1.20060507
+ Cn3D_GetRenderSettingsFromBiostruc@Base 6.1.20060507
+ Cn3D_HideCtrl@Base 6.1.20060507
+ Cn3D_ImportBioseq@Base 6.1.20060507
+ Cn3D_ImportBioseqFile@Base 6.1.20060507
+ Cn3D_ImportBioseqFileGap@Base 6.1.20060507
+ Cn3D_ImportBioseqGap@Base 6.1.20060507
+ Cn3D_IsVisible@Base 6.1.20060507
+ Cn3D_LaunchSeqAnnot@Base 6.1.20060507
+ Cn3D_LaunchSeqEntry@Base 6.1.20060507
+ Cn3D_ListDomainProc@Base 6.1.20060507
+ Cn3D_Matrix2Asn@Base 6.1.20060507
+ Cn3D_ModelSelect@Base 6.1.20060507
+ Cn3D_NetOpenBiostruc@Base 6.1.20060507
+ Cn3D_OpenBiostruc@Base 6.1.20060507
+ Cn3D_OpenEnd@Base 6.1.20060507
+ Cn3D_OpenMesh@Base 6.1.20060507
+ Cn3D_OpenStart@Base 6.1.20060507
+ Cn3D_Redraw@Base 6.1.20060507
+ Cn3D_RedrawEx@Base 6.1.20060507
+ Cn3D_RedrawNUpdate@Base 6.1.20060507
+ Cn3D_RedrawProc@Base 6.1.20060507
+ Cn3D_RegisterColor@Base 6.1.20060507
+ Cn3D_RegisterSeqAnnot@Base 6.1.20060507
+ Cn3D_RegisterSeqEntry@Base 6.1.20060507
+ Cn3D_RenAlign@Base 6.1.20060507
+ Cn3D_RenBS@Base 6.1.20060507
+ Cn3D_RenDefault@Base 6.1.20060507
+ Cn3D_RenHier@Base 6.1.20060507
+ Cn3D_RenSpace@Base 6.1.20060507
+ Cn3D_RenStruc@Base 6.1.20060507
+ Cn3D_RenTube@Base 6.1.20060507
+ Cn3D_RenWire@Base 6.1.20060507
+ Cn3D_ResetActiveStrucProc@Base 6.1.20060507
+ Cn3D_SaveActiveCam@Base 6.1.20060507
+ Cn3D_SaveBiostruc@Base 6.1.20060507
+ Cn3D_SaveSub@Base 6.1.20060507
+ Cn3D_SendUpdate@Base 6.1.20060507
+ Cn3D_SetPars@Base 6.1.20060507
+ Cn3D_SetQualityFromAppParams@Base 6.1.20060507
+ Cn3D_SetQueryCallback@Base 6.1.20060507
+ Cn3D_SetStrucList@Base 6.1.20060507
+ Cn3D_SetVisible@Base 6.1.20060507
+ Cn3D_Size@Base 6.1.20060507
+ Cn3D_StartNet@Base 6.1.20060507
+ Cn3D_UsingEntrez@Base 6.1.20060507
+ Cn3D_fAlignOn@Base 6.1.20060507
+ Cn3D_fUnalignOn@Base 6.1.20060507
+ Cn3dObjMgrGetSelected@Base 6.1.20060507
+ Cn3d_ColorNames@Base 6.1.20060507
+ Cn3d_PaletteRGB@Base 6.1.20060507
+ CopyRenderKeep@Base 6.1.20060507
+ DecrementFeatureID@Base 6.1.20060507
+ DisplayControls@Base 6.1.20060507
+ DoCHighlightSeg@Base 6.1.20060507
+ DoMediaHL@Base 6.1.20060507
+ FindMM@Base 6.1.20060507
+ FreeAlgorRenderSet@Base 6.1.20060507
+ FreeRenderKeep@Base 6.1.20060507
+ GetGraphNCBI4na@Base 6.1.20060507
+ GetGraphNCBIstdaa@Base 6.1.20060507
+ GetSpecialAlgorRenderSet@Base 6.1.20060507
+ LabelControls@Base 6.1.20060507
+ LaunchSequenceWindow@Base 6.1.20060507
+ MMDB_OpenTraverse@Base 6.1.20060507
+ MMDB_ReadMime@Base 6.1.20060507
+ MakeStrucPalette@Base 6.1.20060507
+ MediaHL@Base 6.1.20060507
+ MediaObjSelect@Base 6.1.20060507
+ Mesh@Base 6.1.20060507
+ MeshLoaded@Base 6.1.20060507
+ Mime_ReadIn@Base 6.1.20060507
+ ModelControls@Base 6.1.20060507
+ NewAlignRenderSet@Base 6.1.20060507
+ NewRenderKeep@Base 6.1.20060507
+ NewStructureRenderSet@Base 6.1.20060507
+ Nlm_Call_SaveImageGIF@Base 6.1.20060507
+ Nlm_Call_SetPosition3D@Base 6.1.20060507
+ OGL_Quality@Base 6.1.20060507
+ OpenMimeFileWithDeletion@Base 6.1.20060507
+ PickedModels@Base 6.1.20060507
+ RemovePARSFromMGD@Base 6.1.20060507
+ RenderAnAtom@Base 6.1.20060507
+ RenderControls@Base 6.1.20060507
+ RenderObject@Base 6.1.20060507
+ ResetDisplayCtrls@Base 6.1.20060507
+ ResetLabelCtrls@Base 6.1.20060507
+ ResetRenderCtrls@Base 6.1.20060507
+ SeqStrucMediaFunc@Base 6.1.20060507
+ SetAlignAlgorRender@Base 6.1.20060507
+ SetStructureAlgorRender@Base 6.1.20060507
+ allowAltConfIdOverlay@Base 6.1.20060507
+ fnARLoop@Base 6.1.20060507
+ fnAlignList@Base 6.1.20060507
+ fnCHLresidue@Base 6.1.20060507
+ fnClearMarkedResidues@Base 6.1.20060507
+ fnCn3D_RedrawWrapper@Base 6.1.20060507
+ fnMSPLoop@Base 6.1.20060507
+ fnMarkAlignedResidues@Base 6.1.20060507
+ fnPreCHLresidue@Base 6.1.20060507
+ fnSetGlobalPARSinMG@Base 6.1.20060507
+ iCountItemGet@Base 6.1.20060507
+ readErrors@Base 6.1.20060507
+libncbidesk.so.6 libvibrant6b #MINVER#
+ AAComposition@Base 6.1.20060507
+ ActOnFeatureReplaceList@Base 6.1.20081116
+ AddAppearanceItemToAppearance@Base 6.1.20060507
+ AddBioseqPageToList@Base 6.1.20060507
+ AddFeatureToFilterItem@Base 6.1.20060507
+ AddFeaturesToList@Base 6.1.20081116
+ AddFeaturesToReplaceList@Base 6.1.20081116
+ AddGraphSentinelToPicture@Base 6.1.20060507
+ AddIntervalForImage@Base 6.1.20060507
+ AddScrollControl@Base 6.1.20060507
+ AddStringToValNodeChain@Base 6.1.20060507
+ AddToComment@Base 6.1.20080302
+ AdjustFromForGap@Base 6.1.20060507
+ AdjustToForGap@Base 6.1.20060507
+ AlgEditFunc@Base 6.1.20060507
+ AlgViewFunc@Base 6.1.20060507
+ AlignReportItem@Base 6.1.20060507
+ AlnSettingsDlg@Base 6.1.20120620
+ AlreadyHasRNA@Base 6.1.20080302
+ AnnotAlgEditFunc@Base 6.1.20060507
+ AppendReplaceMessage@Base 6.1.20060507
+ ApplyFeatureDetailsDialog@Base 6.1.20100808
+ ApplyFeatureDetailsFree@Base 6.1.20100808
+ ApplyFeatureDetailsNew@Base 6.1.20100808
+ ApplyFeatureToAlignment@Base 6.1.20060507
+ ApplyProductToRNA@Base 6.1.20080302
+ ApplyRnaTypeToSeqFeat@Base 6.1.20080302
+ AsnReadForSalsa@Base 6.1.20060507
+ AuthorSpreadsheetStringToNameStdPtr@Base 6.1.20060507
+ AutofixOnStartup@Base 6.1.20110713
+ AutomatchFeatures@Base 6.1.20081116
+ BatchApplyFeatureDetailsDialog@Base 6.1.20060507
+ BatchApplyFeatureDetailsFree@Base 6.1.20060507
+ BatchApplyFeatureDetailsNew@Base 6.1.20060507
+ BioSourceDialog@Base 6.1.20060507
+ BioSourceDialogToGenBankDivision@Base 6.1.20060507
+ BioSourceGenFunc@Base 6.1.20060507
+ BioseqPageListFree@Base 6.1.20060507
+ BioseqPtrToGraphViewForm@Base 6.1.20060507
+ BioseqPtrToSeqAnalForm@Base 6.1.20060507
+ BioseqViewCanSaveFasta@Base 6.1.20060507
+ BioseqViewMsgFunc@Base 6.1.20060507
+ ButRegAdd@Base 6.1.20060507
+ ButRegFree@Base 6.1.20060507
+ ButRegNew@Base 6.1.20060507
+ ButRegSelectProc@Base 6.1.20060507
+ CCFetchFromNet@Base 6.1.20060507
+ CCReadAnythingLoop@Base 6.1.20060507
+ CalculateAlignmentOffsets@Base 6.1.20061015
+ CapChangeDialog@Base 6.1.20100808
+ CapChangeDialogEx@Base 6.1.20120620
+ CdRgnFeatFormActnProc@Base 6.1.20060507
+ CdRgnGenFunc@Base 6.1.20060507
+ CdRgnToProtProc@Base 6.1.20060507
+ CdRgnTranslateWithFrame@Base 6.1.20060507
+ ChangeComplexConstraintFieldType@Base 6.1.20100808
+ ChangeDataForTabColumnConfigListDialog@Base 6.1.20090301
+ CheckAlignmentSequenceLengths@Base 6.1.20061015
+ CitSubFromContactInfo@Base 6.1.20060507
+ CleanupEvidenceGBQuals@Base 6.1.20060507
+ ClearTextBtn@Base 6.1.20160908
+ ClearUDV_mouse_select@Base 6.1.20060507
+ ClearValidateWindow@Base 6.1.20060507
+ CloseAlignmentEditor@Base 6.1.20110713
+ CloseLog@Base 6.1.20090719
+ CloseMacroEditorWindowProc@Base 6.1.20120620
+ CollectFeatures@Base 6.1.20060507
+ CollectionDateDialog@Base 6.1.20070822
+ ColorIdentityDialog@Base 6.1.20060507
+ ColorIdentityDialogItem@Base 6.1.20060507
+ ComMatFree@Base 6.1.20060507
+ CommentRuleDialog@Base 6.1.20090719
+ CommentSetDialog@Base 6.1.20090719
+ CompareFeatureValNodeStrings@Base 6.1.20060507
+ CompareImpFeatEnumFieldAssoc@Base 6.1.20060507
+ CompileMatrix@Base 6.1.20060507
+ ComplexConstraintDialog@Base 6.1.20081116
+ ConstraintSetDialog@Base 6.1.20100808
+ ConvertPairwiseToMultipleAlignment@Base 6.1.20060507
+ ConvertProductQualToRnaRefName@Base 6.1.20080302
+ CopyMedlineViewFormToClipboard@Base 6.1.20060507
+ CopyTableDisplayRowList@Base 6.1.20060507
+ CorrectAlignmentIDs@Base 6.1.20120620
+ CountIvals@Base 6.1.20060507
+ CountMaxSeqLabel@Base 6.1.20060507
+ CreateAffilDialog@Base 6.1.20060507
+ CreateAlnEditorWindow@Base 6.1.20060507
+ CreateAlnEditorWindowEx@Base 6.1.20100808
+ CreateAppearance@Base 6.1.20060507
+ CreateAuthorDialog@Base 6.1.20060507
+ CreateAuthorDialogEx@Base 6.1.20160908
+ CreateBioSourceDescForm@Base 6.1.20060507
+ CreateBioSourceFeatForm@Base 6.1.20060507
+ CreateBondEditorDialog@Base 6.1.20060507
+ CreateCdRgnForm@Base 6.1.20060507
+ CreateCitSubDialog@Base 6.1.20060507
+ CreateClickableListDialog@Base 6.1.20070822
+ CreateClickableListDialogEx@Base 6.1.20070822
+ CreateClickableListDialogExEx@Base 6.1.20081116
+ CreateClickableListDialogExExEx@Base 6.1.20120620
+ CreateCommonFeatureGroup@Base 6.1.20060507
+ CreateCommonFeatureGroupEx@Base 6.1.20060507
+ CreateContactDialog@Base 6.1.20060507
+ CreateDatabaseAlist@Base 6.1.20060507
+ CreateDateDialog@Base 6.1.20060507
+ CreateDateDialogEx@Base 6.1.20081116
+ CreateDateForm@Base 6.1.20060507
+ CreateDbtagDialog@Base 6.1.20060507
+ CreateDocsumForm@Base 6.1.20060507
+ CreateDotMatrixForm@Base 6.1.20060507
+ CreateDotMatrixFormEx@Base 6.1.20060507
+ CreateEnumForm@Base 6.1.20060507
+ CreateExperimentDialog@Base 6.1.20160908
+ CreateExtAffilDialog@Base 6.1.20060507
+ CreateExtProceedingsDialog@Base 6.1.20060507
+ CreateExtPublisherAffilDialog@Base 6.1.20060507
+ CreateFieldAlist@Base 6.1.20060507
+ CreateFilter@Base 6.1.20060507
+ CreateGenBankForm@Base 6.1.20060507
+ CreateGeneForm@Base 6.1.20060507
+ CreateGlobalDrawData@Base 6.1.20060507
+ CreateGraphViewForm@Base 6.1.20060507
+ CreateGraphicView@Base 6.1.20060507
+ CreateGraphicViewFromBsp@Base 6.1.20060507
+ CreateGraphicViewInternal@Base 6.1.20060507
+ CreateImportFields@Base 6.1.20060507
+ CreateImportForm@Base 6.1.20060507
+ CreateInferenceEditDialog@Base 6.1.20070822
+ CreateIntervalEditorDialog@Base 6.1.20060507
+ CreateIntervalEditorDialogEx@Base 6.1.20060507
+ CreateIntervalEditorDialogExEx@Base 6.1.20060507
+ CreateLegendItem@Base 6.1.20060507
+ CreateMainControls@Base 6.1.20060507
+ CreateMedlineViewForm@Base 6.1.20060507
+ CreateMolInfoDialog@Base 6.1.20060507
+ CreateMolInfoForm@Base 6.1.20060507
+ CreateNewFilterItemInFilter@Base 6.1.20060507
+ CreateNewLayoutMenu@Base 6.1.20060507
+ CreateNewSeqEntryViewForm@Base 6.1.20060507
+ CreateOrgModDialog@Base 6.1.20070822
+ CreateProceedingsDialog@Base 6.1.20060507
+ CreateProtForm@Base 6.1.20060507
+ CreatePubdescDescForm@Base 6.1.20060507
+ CreatePubdescFeatForm@Base 6.1.20060507
+ CreatePubdescInitForm@Base 6.1.20060507
+ CreatePublisherAffilDialog@Base 6.1.20060507
+ CreateQualsDialog@Base 6.1.20060507
+ CreateRegionOrCommentForm@Base 6.1.20060507
+ CreateReplaceWindow@Base 6.1.20060507
+ CreateRnaForm@Base 6.1.20060507
+ CreateRptUnitRangeDialog@Base 6.1.20070822
+ CreateSearchWindow@Base 6.1.20060507
+ CreateSeqAlignLabel@Base 6.1.20070822
+ CreateSeqAnalForm@Base 6.1.20060507
+ CreateSeqEditorWindow@Base 6.1.20060507
+ CreateSeqViewPanel@Base 6.1.20060507
+ CreateSimpleBioSourceDialog@Base 6.1.20060507
+ CreateStandardEditMenu@Base 6.1.20070822
+ CreateStdEditorFormMenus@Base 6.1.20060507
+ CreateStdValidatorFormMenus@Base 6.1.20060507
+ CreateSubSourceDialog@Base 6.1.20070822
+ CreateSubmitBlockForm@Base 6.1.20060507
+ CreateSubmitDataDialog@Base 6.1.20060507
+ CreateSubmitTemplateEditorForm@Base 6.1.20060507
+ CreateTermlistForm@Base 6.1.20060507
+ CreateValidateWindow@Base 6.1.20060507
+ CreateValidateWindowEx@Base 6.1.20060507
+ CreateValidateWindowExEx@Base 6.1.20090719
+ CreateValidateWindowExExEx@Base 6.1.20090719
+ CreateVisStrForm@Base 6.1.20060507
+ CreateVisibleStringDialog@Base 6.1.20060507
+ CreatencRNAClassDialog@Base 6.1.20080302
+ DBGetIDFromName@Base 6.1.20060507
+ DBGetNameFromID@Base 6.1.20060507
+ DOT_AlignInfoNew@Base 6.1.20060507
+ DOT_AlignPlotGivenScp@Base 6.1.20060507
+ DOT_AlignPlotGivenSeqAlign@Base 6.1.20060507
+ DOT_CancelParams@Base 6.1.20060507
+ DOT_Compression@Base 6.1.20060507
+ DOT_DoParams@Base 6.1.20060507
+ DOT_DoZoom@Base 6.1.20060507
+ DOT_DrawScale@Base 6.1.20060507
+ DOT_DrawXGrids@Base 6.1.20060507
+ DOT_FillAlignInfoPointer@Base 6.1.20060507
+ DOT_GetValue@Base 6.1.20060507
+ DOT_MakeMainViewer@Base 6.1.20060507
+ DOT_Prob_FillAlignInfoPointer@Base 6.1.20060507
+ DOT_QuitProg@Base 6.1.20060507
+ DOT_RegDiagsDisplay@Base 6.1.20060507
+ DOT_SVFindHit@Base 6.1.20060507
+ DOT_SetupBlastWindow@Base 6.1.20060507
+ DOT_SetupMenus@Base 6.1.20060507
+ DOT_SetupParamsWindow@Base 6.1.20060507
+ DOT_SetupZoomWindow@Base 6.1.20060507
+ DOT_StartDOTPLOT@Base 6.1.20060507
+ DOT_UpdateLRBT@Base 6.1.20060507
+ DateGenFunc@Base 6.1.20060507
+ DatePtrToVibrant@Base 6.1.20060507
+ DefinePanelDialog@Base 6.1.20060507
+ DescFormReplaceWithoutUpdateProc@Base 6.1.20060507
+ DescFormReplaceWithoutUpdateProcEx@Base 6.1.20100808
+ DescriptorPropagate@Base 6.1.20060507
+ DescriptorStreamEditor@Base 6.1.20100808
+ DestroyAppearance@Base 6.1.20060507
+ DestroyFilter@Base 6.1.20060507
+ DisableStrainForwarding@Base 6.1.20160908
+ DisplayEntrezReply@Base 6.1.20060507
+ DisplayEntrezRequest@Base 6.1.20060507
+ DisplayErrorMessages@Base 6.1.20060507
+ DistPosItem@Base 6.1.20060507
+ DoFixCDS@Base 6.1.20060507
+ DotMatrixAlignmentNew@Base 6.1.20060507
+ DotMatrixGenFunc@Base 6.1.20060507
+ DotMatrixSearch@Base 6.1.20060507
+ DotPlotDialog@Base 6.1.20060507
+ DotPlotItem@Base 6.1.20060507
+ DotXYPlot@Base 6.1.20060507
+ DrawAlignNode@Base 6.1.20060507
+ DrawCompressAlignment@Base 6.1.20060507
+ DrawCytoContigMap@Base 6.1.20060507
+ DrawCytoMap@Base 6.1.20060507
+ DrawFeatNode@Base 6.1.20060507
+ DrawFeatures@Base 6.1.20060507
+ DrawFlatAlign@Base 6.1.20060507
+ DrawFlatNode@Base 6.1.20060507
+ DrawGeneticMap@Base 6.1.20060507
+ DrawGenomeMap@Base 6.1.20060507
+ DrawGenomeMapEx@Base 6.1.20060507
+ DrawGraphToPanel@Base 6.1.20060507
+ DrawHistory@Base 6.1.20060507
+ DrawMPAlignment@Base 6.1.20060507
+ DrawPhysicalMap@Base 6.1.20060507
+ DrawRestrictionMap@Base 6.1.20060507
+ DrawSeqGraphSegment@Base 6.1.20060507
+ DrawSeqHistoryAlignment@Base 6.1.20060507
+ DrawSeqMap@Base 6.1.20060507
+ DrawSeqScale@Base 6.1.20060507
+ DrawSequinMap@Base 6.1.20060507
+ DrawSequinMapEx@Base 6.1.20060507
+ DrawTree@Base 6.1.20060507
+ DrawVerticalAlign@Base 6.1.20060507
+ Draw_Global@Base 6.1.20060507
+ EditAlignDataRepopulateFromSeqAlign@Base 6.1.20060507
+ EditApplyDialog@Base 6.1.20070822
+ EditApplyFree@Base 6.1.20070822
+ EditApplyNew@Base 6.1.20080302
+ EditBioseqToFasta@Base 6.1.20060507
+ EditCitDescDirectly@Base 6.1.20090719
+ EditCitFeatDirectly@Base 6.1.20090719
+ EditMacroTemplate@Base 6.1.20110713
+ EditPubdescInPlace@Base 6.1.20100808
+ EditPublicationInDialog@Base 6.1.20060507
+ EditableTableDisplayDialog@Base 6.1.20120620
+ EnableDisableLegendItem@Base 6.1.20060507
+ EndDistanceDialog@Base 6.1.20100808
+ EntityAlreadyHasViewer@Base 6.1.20061015
+ EnumAssocSelectionDialog@Base 6.1.20060507
+ EnumGenFunc@Base 6.1.20060507
+ ExperimentDialogToGbquals@Base 6.1.20160908
+ ExportBioseqViewFasta@Base 6.1.20060507
+ ExportMedlineViewFormToFile@Base 6.1.20060507
+ ExportSeqAnnotFeatureTable@Base 6.1.20070822
+ ExportTextFunc@Base 6.1.20060507
+ FastaRead@Base 6.1.20060507
+ FeatCitEditDialog@Base 6.1.20060507
+ FeatFormReplaceWithoutUpdateProc@Base 6.1.20060507
+ FeatureLocationAlignment@Base 6.1.20060507
+ FeaturePropagateForm@Base 6.1.20060507
+ FeatureReplaceListDialog@Base 6.1.20081116
+ FeatureReplaceListFree@Base 6.1.20081116
+ FeatureReplaceListFromSeqAnnot@Base 6.1.20081116
+ FeatureSelectListDialog@Base 6.1.20081116
+ FeatureTypeDialog@Base 6.1.20080302
+ FeatureTypeDialogMulti@Base 6.1.20090719
+ FigureMaxScale@Base 6.1.20060507
+ FigureMinScale@Base 6.1.20060507
+ FileInProc@Base 6.1.20060507
+ FileToClipboard@Base 6.1.20060507
+ FileToScrollText@Base 6.1.20060507
+ FilterSeq@Base 6.1.20060507
+ FindAppearanceByName@Base 6.1.20060507
+ FindFilterByName@Base 6.1.20060507
+ FindIdsInSalsaPanel@Base 6.1.20060507
+ FindLayoutByName@Base 6.1.20060507
+ FindPatternDialog@Base 6.1.20060507
+ FixCapsSourceCountryDialog@Base 6.1.20110713
+ FixSpecialCharacters@Base 6.1.20080302
+ FixSpecialCharactersForObject@Base 6.1.20080302
+ FixSpecialCharactersForStringsInList@Base 6.1.20080302
+ FormulaDialog@Base 6.1.20060507
+ FreeCollectedFeatures@Base 6.1.20060507
+ FreeGeneticCodes@Base 6.1.20060507
+ FreeOrganismTable@Base 6.1.20060507
+ FreePrintOptions@Base 6.1.20060507
+ FreeReplaceWindow@Base 6.1.20060507
+ FreeSearchWindow@Base 6.1.20060507
+ FreeSqnTempFiles@Base 6.1.20080302
+ FreeTableDisplayRowList@Base 6.1.20060507
+ FreeValidateWindow@Base 6.1.20060507
+ GBQualsToExperimentDialog@Base 6.1.20160908
+ GBQualsToInferenceDialog@Base 6.1.20060507
+ GenBankGenFunc@Base 6.1.20060507
+ GeneGenFunc@Base 6.1.20060507
+ GenericMacroActionForm@Base 6.1.20120620
+ GetAlignDataPanel@Base 6.1.20060507
+ GetAlignEditData@Base 6.1.20060507
+ GetAlignmentOptions@Base 6.1.20120620
+ GetAlignmentsInSeqEntryCallback@Base 6.1.20070822
+ GetAlnScoreCount@Base 6.1.20060507
+ GetAlnScoreCutoffCount@Base 6.1.20060507
+ GetAlnScoreCutoffList@Base 6.1.20060507
+ GetAlnScoreNameList@Base 6.1.20060507
+ GetAppearanceCount@Base 6.1.20060507
+ GetBaseFormList@Base 6.1.20080302
+ GetBioseqViewPtrFromBaseFormPtr@Base 6.1.20060507
+ GetBioseqViewTarget@Base 6.1.20070822
+ GetCapChangeDialogValue@Base 6.1.20110713
+ GetExistingTextHandlerInfo@Base 6.1.20070822
+ GetFeatureTypeFromFeatureTypeDialog@Base 6.1.20110713
+ GetFilterCount@Base 6.1.20060507
+ GetFilterNameList@Base 6.1.20060507
+ GetGeneticCodeValNodeList@Base 6.1.20060507
+ GetGraphicConfigParseResults@Base 6.1.20060507
+ GetIdStringsForSeqEntryAligns@Base 6.1.20060507
+ GetLayoutCount@Base 6.1.20060507
+ GetLayoutNameList@Base 6.1.20060507
+ GetLocListForBioSource@Base 6.1.20081116
+ GetMatchLocationFromIdMatchLocationDlg@Base 6.1.20110713
+ GetModifiersEnum@Base 6.1.20070822
+ GetMoleculeClassName@Base 6.1.20070822
+ GetMoleculeTopologyName@Base 6.1.20120620
+ GetMoleculeTypeName@Base 6.1.20070822
+ GetNextFeatureOnSegOrMaster@Base 6.1.20060507
+ GetPanelFromWindow@Base 6.1.20060507
+ GetProcIdForItemEditor@Base 6.1.20090719
+ GetRidOfEmptyFeatsDescStrings@Base 6.1.20060507
+ GetRowListCellText@Base 6.1.20060507
+ GetSelectedClickableListText@Base 6.1.20070822
+ GetSelectedDocText@Base 6.1.20080302
+ GetSelectedNewFeature@Base 6.1.20081116
+ GetSeqAnnotForAlignment@Base 6.1.20060507
+ GetStyleNameList@Base 6.1.20060507
+ GetSubSourceAndOrgModEnum@Base 6.1.20070822
+ GetTableDisplayDefaultFont@Base 6.1.20060507
+ GetTextSelectCharOffsetEx@Base 6.1.20080302
+ GetUidsForOneSeqAnnot@Base 6.1.20060507
+ GetUidsForSeqEntryAligns@Base 6.1.20060507
+ GetViewedSeqEntryList@Base 6.1.20080302
+ GlobalPictureUpdate@Base 6.1.20060507
+ GoToButton@Base 6.1.20060507
+ GpDistanceItem@Base 6.1.20060507
+ GraphViewFormFree@Base 6.1.20060507
+ GraphViewFormNew@Base 6.1.20060507
+ GridMatch@Base 6.1.20060507
+ GridMatchSetUp@Base 6.1.20060507
+ GroupFeatNode@Base 6.1.20060507
+ HandleExistingText@Base 6.1.20070822
+ HideBioseqView@Base 6.1.20100808
+ HideFeatureFunc@Base 6.1.20060507
+ HideValidateDoc@Base 6.1.20060507
+ HscrlProc@Base 6.1.20060507
+ IdMatchLocationDlg@Base 6.1.20110713
+ ImportFromFile@Base 6.1.20060507
+ ImportGenFunc@Base 6.1.20060507
+ InBioseqViewEntityList@Base 6.1.20060507
+ InferenceDialogToGBQuals@Base 6.1.20060507
+ InferenceEditFree@Base 6.1.20070822
+ InferenceFieldEditFree@Base 6.1.20070822
+ InferenceTextFromStruct@Base 6.1.20070822
+ Ing_AddGCRect@Base 6.1.20060507
+ Ing_AddRuler@Base 6.1.20060507
+ Ing_AttachMessageProc@Base 6.1.20060507
+ Ing_AttachSeqAnnotToSeqEntry@Base 6.1.20060507
+ Ing_BigDecodeIdxFeat@Base 6.1.20060507
+ Ing_BigEncodeIdxFeat@Base 6.1.20060507
+ Ing_Blast2SeqsProc@Base 6.1.20060507
+ Ing_BuildColorTable@Base 6.1.20060507
+ Ing_CanSaveFasta@Base 6.1.20060507
+ Ing_CreateBlast2SeqsForm@Base 6.1.20060507
+ Ing_CreateDotMatrixForm@Base 6.1.20060507
+ Ing_CreateSpideyForm@Base 6.1.20060507
+ Ing_DeleteSpidey@Base 6.1.20060507
+ Ing_DoesAlignmentCoverAll@Base 6.1.20060507
+ Ing_DotDiagProc@Base 6.1.20060507
+ Ing_ExploreSegments@Base 6.1.20060507
+ Ing_ExportFasta@Base 6.1.20060507
+ Ing_FileOpenFromCommandline@Base 6.1.20060507
+ Ing_FileOpenProc@Base 6.1.20060507
+ Ing_FillSeqBuffer@Base 6.1.20060507
+ Ing_FindSpidpGivenParent@Base 6.1.20060507
+ Ing_FreeColorTable@Base 6.1.20060507
+ Ing_GetBspFromGIOrAcc@Base 6.1.20060507
+ Ing_GetFileForDotMatrix@Base 6.1.20060507
+ Ing_GetFileForSpidey@Base 6.1.20060507
+ Ing_GetFromNetwork@Base 6.1.20060507
+ Ing_GetScoreAndEvalue@Base 6.1.20060507
+ Ing_GetValue@Base 6.1.20060507
+ Ing_HighlightReportWindow@Base 6.1.20060507
+ Ing_InitAlignArrays@Base 6.1.20060507
+ Ing_InitGrData@Base 6.1.20060507
+ Ing_InitfeatDefFilter@Base 6.1.20060507
+ Ing_MainDataNew@Base 6.1.20060507
+ Ing_MakeLocListFromSpidp@Base 6.1.20060507
+ Ing_NetOpenFromCommandline@Base 6.1.20060507
+ Ing_OpenFromFileORNetwork@Base 6.1.20060507
+ Ing_OpenUDV@Base 6.1.20060507
+ Ing_ParseSeqIdFile@Base 6.1.20060507
+ Ing_PopDetailedPage@Base 6.1.20060507
+ Ing_PopOverviewPage@Base 6.1.20060507
+ Ing_PopOverviewRuler@Base 6.1.20060507
+ Ing_PopulateDetailedPage@Base 6.1.20060507
+ Ing_PopulateOverviewPage@Base 6.1.20060507
+ Ing_PopulateReport@Base 6.1.20060507
+ Ing_PopulateSequinGraphic@Base 6.1.20060507
+ Ing_PrintText@Base 6.1.20060507
+ Ing_ProgressEnd@Base 6.1.20060507
+ Ing_ProgressNew@Base 6.1.20060507
+ Ing_PutColor@Base 6.1.20060507
+ Ing_QBlastProc@Base 6.1.20060507
+ Ing_ReadmRNAs@Base 6.1.20060507
+ Ing_RegIngenueProc@Base 6.1.20060507
+ Ing_RegisterIngenueProc@Base 6.1.20060507
+ Ing_ReplaceAllMismatchedInLocation@Base 6.1.20060507
+ Ing_ReportWindow@Base 6.1.20060507
+ Ing_SearchAli@Base 6.1.20060507
+ Ing_SetupMenus@Base 6.1.20060507
+ Ing_StringCat@Base 6.1.20060507
+ Ing_WinTimerProc@Base 6.1.20060507
+ Ing_mRNAOrExons@Base 6.1.20060507
+ Ing_tRNAscanMenu@Base 6.1.20060507
+ IngenueCheckSocketsProc@Base 6.1.20060507
+ IngfeatDefFilter@Base 6.1.20060507
+ IngfeatDefTrack2@Base 6.1.20060507
+ IngfeatDefTrack@Base 6.1.20060507
+ InitPseudogenePopup@Base 6.1.20120620
+ InvertMatrix@Base 6.1.20060507
+ IsADeltaBioseq@Base 6.1.20060507
+ IsAGenomeRecord@Base 6.1.20060507
+ IsANamedAlignment@Base 6.1.20060507
+ IsNonTextModifier@Base 6.1.20070822
+ IsSegmentedBioseqWithoutParts@Base 6.1.20060507
+ IsTaxValidationRequested@Base 6.1.20100808
+ IsVSeqMgrOpen@Base 6.1.20160908
+ ItemAlreadyHasEditor@Base 6.1.20060507
+ JK_NTPattern2@Base 6.1.20060507
+ JK_NTPattern2Ex@Base 6.1.20060507
+ JK_NTPattern@Base 6.1.20060507
+ Label_GData@Base 6.1.20060507
+ LaunchAlignEditor@Base 6.1.20060507
+ LaunchAlignEditorFromDesktop2@Base 6.1.20060507
+ LaunchAlignEditorFromDesktop@Base 6.1.20060507
+ LaunchAlignViewer@Base 6.1.20060507
+ LaunchAnnotAlignEditor@Base 6.1.20060507
+ LaunchAsnTextViewer@Base 6.1.20060507
+ LaunchCommentRulesEditor@Base 6.1.20090719
+ LaunchEntrezURL@Base 6.1.20060507
+ LaunchGeneralTextViewer@Base 6.1.20060507
+ LaunchGeneralTextViewerWithRepopulate@Base 6.1.20060507
+ LaunchMacroEditor@Base 6.1.20080302
+ LaunchMacroEditorMenuItem@Base 6.1.20120620
+ LaunchMacroTemplateEditor@Base 6.1.20110713
+ LaunchNewBioseqViewer@Base 6.1.20060507
+ LaunchRecViewer@Base 6.1.20060507
+ LaunchSuspectProductRuleEditor@Base 6.1.20110713
+ LaunchSuspectProductRuleEditorBaseForm@Base 6.1.20110713
+ LaunchViewerNotEditor@Base 6.1.20060507
+ LayoutAlignFlat@Base 6.1.20060507
+ LayoutAlignNode@Base 6.1.20060507
+ LayoutFeatNode@Base 6.1.20060507
+ LayoutGlobalDrawData@Base 6.1.20060507
+ LayoutNodeFlat@Base 6.1.20060507
+ LoadContigAlign@Base 6.1.20060507
+ LoadOrganismTable@Base 6.1.20060507
+ LocationConstraintDialog@Base 6.1.20080302
+ LogoFontCreate@Base 6.1.20060507
+ LookAtButton@Base 6.1.20060507
+ MUSK_COLOR@Base 6.1.20060507
+ MacroApplyKeyword@Base 6.1.20090719
+ MacroTemplateApplyTextDialog@Base 6.1.20110713
+ MacroTemplateStringDialog@Base 6.1.20110713
+ MakeCompressAlignList@Base 6.1.20060507
+ MakeFeatProc@Base 6.1.20060507
+ MakeIvals@Base 6.1.20060507
+ MakeToolFormForBioseqView@Base 6.1.20060507
+ MakeTxLink@Base 6.1.20060507
+ MakeViewerIndependent@Base 6.1.20061015
+ MapCytoBand@Base 6.1.20060507
+ MatchTypeDialog@Base 6.1.20081116
+ MatchesRnaType@Base 6.1.20080302
+ MatrixSeq@Base 6.1.20060507
+ MedlineViewGenFunc@Base 6.1.20060507
+ ModTextFixNew@Base 6.1.20060507
+ ModalAcceptButton@Base 6.1.20060507
+ ModalCancelButton@Base 6.1.20060507
+ ModalThirdOptionButton@Base 6.1.20060507
+ MolInfoBlockDialog@Base 6.1.20081116
+ MolInfoGenFunc@Base 6.1.20060507
+ MolinfoFieldChoiceDialog@Base 6.1.20090719
+ Msk_OrderWasModified@Base 6.1.20060507
+ MuskGlobalPicture@Base 6.1.20060507
+ NameStdPtrToAuthorSpreadsheetString@Base 6.1.20060507
+ NameValuePairCopy@Base 6.1.20070822
+ NameValuePairFree@Base 6.1.20070822
+ NameValuePairListFree@Base 6.1.20070822
+ NewCreateImportFields@Base 6.1.20070822
+ NewSaveBioseqViewFormGifItemTable@Base 6.1.20060507
+ NewSeqEntryViewGenFunc@Base 6.1.20060507
+ NewlinesToTildes@Base 6.1.20080302
+ Nlm_CopyMuskStyle@Base 6.1.20060507
+ Nlm_CreateDlgCColor@Base 6.1.20060507
+ Nlm_CreateDlgCommon@Base 6.1.20060507
+ Nlm_CreateDlgExtra@Base 6.1.20060507
+ Nlm_CreateDlgFeatures@Base 6.1.20060507
+ Nlm_CreateDlgGroup@Base 6.1.20060507
+ Nlm_CreateDlgSeq@Base 6.1.20060507
+ Nlm_CtreateToolsSM@Base 6.1.20060507
+ Nlm_DeleteMuskStyle@Base 6.1.20060507
+ Nlm_DisableSM@Base 6.1.20060507
+ Nlm_EditMuskStyle@Base 6.1.20060507
+ Nlm_EnableSM@Base 6.1.20060507
+ Nlm_ExitMuskStyles@Base 6.1.20060507
+ Nlm_FreeMuskStyleEd@Base 6.1.20060507
+ Nlm_GetMuskCParam@Base 6.1.20060507
+ Nlm_GetMuskCParamEd@Base 6.1.20060507
+ Nlm_GetMuskCurrentSt@Base 6.1.20060507
+ Nlm_GetMuskStyleName@Base 6.1.20060507
+ Nlm_GetMuskTotalSt@Base 6.1.20060507
+ Nlm_GetToolValueSM@Base 6.1.20060507
+ Nlm_InitMuskStyles@Base 6.1.20060507
+ Nlm_LaunchGeneFeatEd@Base 6.1.20060507
+ Nlm_LaunchWebPage@Base 6.1.20060507
+ Nlm_LoadMuskFont@Base 6.1.20060507
+ Nlm_MuskStyleDialog@Base 6.1.20060507
+ Nlm_MuskStyleManager@Base 6.1.20060507
+ Nlm_SetMuskCParamEd@Base 6.1.20060507
+ Nlm_SetMuskCurrentSt@Base 6.1.20060507
+ Nlm_SetMuskManagetTitle@Base 6.1.20060507
+ Nlm_SetTDefCColor@Base 6.1.20060507
+ Nlm_SetTDefCommon@Base 6.1.20060507
+ Nlm_SetTDefExtra@Base 6.1.20060507
+ Nlm_SetTDefFeatures@Base 6.1.20060507
+ Nlm_SetTDefGroup@Base 6.1.20060507
+ Nlm_SetTDefSeq@Base 6.1.20060507
+ Nlm_SetToolDefaultSM@Base 6.1.20060507
+ Nlm_SetToolsCallbackSM@Base 6.1.20060507
+ Nlm_ShowToolsSM@Base 6.1.20060507
+ Nlm_ToolDlgCColor@Base 6.1.20060507
+ Nlm_ToolDlgCommon@Base 6.1.20060507
+ Nlm_ToolDlgExtra@Base 6.1.20060507
+ Nlm_ToolDlgFeatures@Base 6.1.20060507
+ Nlm_ToolDlgGroup@Base 6.1.20060507
+ Nlm_ToolDlgSeq@Base 6.1.20060507
+ NonsyToSynItem1@Base 6.1.20060507
+ NonsyToSynItem2@Base 6.1.20060507
+ NonsyToSynItem3@Base 6.1.20060507
+ NonsyToSynItem4@Base 6.1.20060507
+ NonsyToSynItem5@Base 6.1.20060507
+ NonsyToSynItem6@Base 6.1.20060507
+ NormaliseScore@Base 6.1.20060507
+ OBJ_@Base 6.1.20060507
+ OkToAcceptBatchApplyFeatureDetails@Base 6.1.20070822
+ OkToListFeatDefInRemainingFeatures@Base 6.1.20080302
+ OldAlignmentEditor@Base 6.1.20060507
+ OpenNewAlignmentEditor@Base 6.1.20060507
+ OrderCdsmRNA@Base 6.1.20060507
+ OrgModTypeDialog@Base 6.1.20070822
+ PCCPredictFunc@Base 6.1.20060507
+ PCCProc@Base 6.1.20060507
+ PanelOffsetFromCharOffsetEx@Base 6.1.20080302
+ ParseCollectionDateOk@Base 6.1.20070822
+ ParseConfigFile@Base 6.1.20060507
+ ParseDstDialog@Base 6.1.20100808
+ ParseInferenceText@Base 6.1.20070822
+ PicForAlignNode@Base 6.1.20060507
+ PopulateGenePopup@Base 6.1.20060507
+ PopulateGeneticCodePopup@Base 6.1.20160908
+ PopulateSalsaPanel@Base 6.1.20060507
+ PopulateTabConfigListColumnListDoc@Base 6.1.20120620
+ PredictCodingRegion@Base 6.1.20060507
+ PrintBandHeader@Base 6.1.20060507
+ PrintContigAlign@Base 6.1.20060507
+ PrintContigForOneMap@Base 6.1.20060507
+ PrintDataBaseLink@Base 6.1.20060507
+ PrintGeneticMarkerForOneMap@Base 6.1.20060507
+ PrintMedlineViewForm@Base 6.1.20060507
+ PrintTableDisplayRowListToFile@Base 6.1.20060507
+ ProduceAlignmentNotes@Base 6.1.20120620
+ PropagateFeatDialog@Base 6.1.20060507
+ PropagateOneFeat@Base 6.1.20070822
+ ProtGenFunc@Base 6.1.20060507
+ PubdescGenFunc@Base 6.1.20060507
+ PublicationListDialog@Base 6.1.20060507
+ PwDistanceItem@Base 6.1.20060507
+ PwDistanceLongItem@Base 6.1.20060507
+ Query_FetchCount@Base 6.1.20060507
+ Query_FetchParsedCount@Base 6.1.20060507
+ Query_FetchSeveralCounts@Base 6.1.20060507
+ Query_FetchUIDs@Base 6.1.20060507
+ Query_GetInfo@Base 6.1.20060507
+ QuorumItem@Base 6.1.20060507
+ ReSetFeatNode@Base 6.1.20060507
+ ReadAAC@Base 6.1.20060507
+ ReadAlignmentForSeqEntry@Base 6.1.20120620
+ ReadAnyAlignment@Base 6.1.20060507
+ ReadContiguouseAlign@Base 6.1.20060507
+ ReadInterleaveAlign@Base 6.1.20060507
+ ReadLocalAlignment@Base 6.1.20060507
+ ReadMatrix@Base 6.1.20060507
+ RefineUIDs@Base 6.1.20060507
+ RegionOrCommentGenFunc@Base 6.1.20060507
+ RememberSqnTempFile@Base 6.1.20080302
+ RemoveDuplicateFeatActionDialog@Base 6.1.20110713
+ RemoveFeatureFromFilterItem@Base 6.1.20060507
+ RemoveFeaturesFromReplaceList@Base 6.1.20081116
+ RemoveSelectedFeaturesFromList@Base 6.1.20081116
+ RemoveSeqEdCloseFunc@Base 6.1.20100808
+ RemoveSeqEntryViewer@Base 6.1.20060507
+ RemoveTextFromTextFreeSubSourceModifiers@Base 6.1.20060507
+ ReplaceBioSourceGencodePopup@Base 6.1.20060507
+ ReplaceToolFormForBioseqView@Base 6.1.20100808
+ ReplaceToolFormWithDataForBioseqView@Base 6.1.20110713
+ RepopulateValidateFilter@Base 6.1.20060507
+ ResetFeatureFunc@Base 6.1.20060507
+ RestoreEntityIDFromFile@Base 6.1.20080302
+ RestoreEntityIDFromFileEx@Base 6.1.20110713
+ RestoreFromFile@Base 6.1.20080302
+ RestoreFromFileEx@Base 6.1.20110713
+ RetrieveDocs@Base 6.1.20060507
+ RnaGenFunc@Base 6.1.20060507
+ RnaTypeDialog@Base 6.1.20080302
+ RnaTypeFree@Base 6.1.20080302
+ RunAutoFixScript@Base 6.1.20110713
+ SCP_CompareOrderOrganizeBioseqs@Base 6.1.20060507
+ SCP_OrganizeAlnsInSet@Base 6.1.20060507
+ SalsaExportDialog@Base 6.1.20060507
+ SalsaPanelHasResized@Base 6.1.20060507
+ SalsaTextPanel@Base 6.1.20060507
+ SaveAllFeatProc@Base 6.1.20060507
+ SaveFeatProc@Base 6.1.20060507
+ SaveSalsaPanel@Base 6.1.20060507
+ SaveStringFromTextAndStripNewlines@Base 6.1.20060507
+ ScalePlot@Base 6.1.20060507
+ ScrollTextToFile@Base 6.1.20060507
+ ScrollToMatchingFeatures@Base 6.1.20081116
+ ScrollToNextClickableTextDescription@Base 6.1.20070822
+ ScrollToPreviousClickableTextDescription@Base 6.1.20070822
+ SearchBioseq@Base 6.1.20060507
+ SearchFuncDialog@Base 6.1.20110713
+ SelectRegionDialog@Base 6.1.20060507
+ SelectSeqDialog@Base 6.1.20060507
+ SelectionDialog@Base 6.1.20060507
+ SelectionDialogEx@Base 6.1.20060507
+ SelectionDialogExEx@Base 6.1.20081116
+ SelectiveMacroRun@Base 6.1.20110713
+ SeqAlnWindowScrollToAlnPos@Base 6.1.20100808
+ SeqAnalFormFree@Base 6.1.20060507
+ SeqAnalFormNew@Base 6.1.20060507
+ SeqEdCorrectBarMax@Base 6.1.20060507
+ SeqEdCorrectBarPage@Base 6.1.20060507
+ SeqEdCorrectBarValue@Base 6.1.20060507
+ SeqEdGetSlateScrollBar@Base 6.1.20060507
+ SeqEdGetValueScrollBar@Base 6.1.20060507
+ SeqEdJournalNewTranslate@Base 6.1.20060507
+ SeqEdSetCorrectBarMax@Base 6.1.20060507
+ SeqEdSetValueScrollBar@Base 6.1.20060507
+ SeqEditFunc@Base 6.1.20060507
+ SeqFeatPtrToCommon@Base 6.1.20060507
+ SeqFeatPtrToFieldPage@Base 6.1.20060507
+ SeqFontProc@Base 6.1.20060507
+ SeqScrollDataFree@Base 6.1.20060507
+ SeqScrollDataNew@Base 6.1.20060507
+ SeqnSeqEntrysToFasta@Base 6.1.20060507
+ SequenceConstraintDialog@Base 6.1.20110713
+ SequenceSelectionDialog@Base 6.1.20060507
+ SequenceSelectionDialogEx@Base 6.1.20080302
+ SequinGlobalPicture@Base 6.1.20060507
+ Sequin_GlobalAlign2Seq@Base 6.1.20060507
+ SetBioSourceDialogTaxName@Base 6.1.20060507
+ SetBioseqViewTarget@Base 6.1.20060507
+ SetCapChangeDialogValue@Base 6.1.20110713
+ SetClickableListDialogTitles@Base 6.1.20080302
+ SetClickableListDisplayChosen@Base 6.1.20081116
+ SetClosestParentIfDuplicating@Base 6.1.20060507
+ SetComplexConstraintType@Base 6.1.20120620
+ SetConstraintSetDefaultConstraintType@Base 6.1.20160908
+ SetDescriptorStreamEditorIdList@Base 6.1.20100808
+ SetFeatureTypeInFeatureTypeDialog@Base 6.1.20110713
+ SetGenome@Base 6.1.20060507
+ SetMatchLocationInIdMatchLocationDlg@Base 6.1.20110713
+ SetNewFeatureDefaultInterval@Base 6.1.20060507
+ SetSequenceAndStrandForIntervalPage@Base 6.1.20060507
+ SetupGeneticCodes@Base 6.1.20060507
+ SetupPrintOptions@Base 6.1.20060507
+ ShouldSetJustShowAccession@Base 6.1.20060507
+ ShouldSetSuppressContext@Base 6.1.20060507
+ ShowASN@Base 6.1.20060507
+ ShowFeatureFunc@Base 6.1.20060507
+ ShowFeatureProc@Base 6.1.20060507
+ ShowGeneList@Base 6.1.20060507
+ ShowLog@Base 6.1.20160908
+ ShowNewNetConfigForm@Base 6.1.20060507
+ ShowReplaceWindow@Base 6.1.20060507
+ ShowSearchWindow@Base 6.1.20060507
+ ShowValidateDoc@Base 6.1.20060507
+ ShowValidateWindow@Base 6.1.20060507
+ SimpleReplaceDialog@Base 6.1.20110713
+ SingleAECRMacroAction@Base 6.1.20081116
+ SingleMacroAction@Base 6.1.20110713
+ SingleParseAction@Base 6.1.20090301
+ SmartDrawText@Base 6.1.20060507
+ SmartSeqEntryViewGenFunc@Base 6.1.20060507
+ SortByVnpDataIntvalue@Base 6.1.20060507
+ SortEnumFieldAssocPtrArray@Base 6.1.20060507
+ SortSameSeqInAlignNode@Base 6.1.20060507
+ SortSeqFeatInAnnot@Base 6.1.20081116
+ SortbyLenItem@Base 6.1.20060507
+ SortbySimItem@Base 6.1.20060507
+ SpecialEntrezSynchronousQuery@Base 6.1.20060507
+ StdDescFormActnProc@Base 6.1.20060507
+ StdDescFormActnProcNoFeatureChangeNoMolInfoChange@Base 6.1.20100808
+ StdDescFormCleanupProc@Base 6.1.20060507
+ StdFeatFormAcceptButtonProc@Base 6.1.20060507
+ StdFeatFormActnProc@Base 6.1.20060507
+ StdFeatFormCleanupProc@Base 6.1.20060507
+ StdFeatIntEdPartialCallback@Base 6.1.20060507
+ StdInitFeatFormProc@Base 6.1.20060507
+ StdReplaceNotify@Base 6.1.20060507
+ StdSeqFeatPtrToFeatFormProc@Base 6.1.20060507
+ StdVibrantEditorMsgFunc@Base 6.1.20060507
+ StringComboDialog@Base 6.1.20110713
+ StringConstraintDialog@Base 6.1.20080302
+ StripNewlines@Base 6.1.20080302
+ StructuredCommentDatabaseNameDialog@Base 6.1.20110713
+ SubSourceTypeDialog@Base 6.1.20070822
+ SubmitBlockDialog@Base 6.1.20060507
+ SubmitBlockGenFunc@Base 6.1.20060507
+ SuspectRuleDialog@Base 6.1.20110713
+ TabColumnConfigDialog@Base 6.1.20080302
+ TabColumnConfigListDialog@Base 6.1.20080302
+ TableDisplayDialog@Base 6.1.20060507
+ TermList_UnselectAll@Base 6.1.20060507
+ TestInference@Base 6.1.20060507
+ TextPortionDialog@Base 6.1.20100808
+ TextScrollWindowNew@Base 6.1.20060507
+ TextToFeatID@Base 6.1.20100808
+ TextToFeatXref@Base 6.1.20100808
+ TextTransformSetDialog@Base 6.1.20110713
+ ThreeOptionsDlg@Base 6.1.20100808
+ TranslateAllBioseq@Base 6.1.20060507
+ TruncateLocation@Base 6.1.20070822
+ TwoStepExistingText@Base 6.1.20081116
+ UDVResetProc@Base 6.1.20060507
+ UDV_BuildFeatColorTable@Base 6.1.20060507
+ UDV_Build_AA_LayoutPalette@Base 6.1.20060507
+ UDV_Build_NA_LayoutPalette@Base 6.1.20060507
+ UDV_Build_Other_Colors@Base 6.1.20060507
+ UDV_ClickProc@Base 6.1.20060507
+ UDV_ComputeBlockByLine@Base 6.1.20060507
+ UDV_ComputeLineHeight@Base 6.1.20060507
+ UDV_ComputePanelSize@Base 6.1.20060507
+ UDV_CreateListBioseqDlg@Base 6.1.20060507
+ UDV_DragMouse@Base 6.1.20060507
+ UDV_DragProc@Base 6.1.20060507
+ UDV_Draw_features@Base 6.1.20060507
+ UDV_Draw_features_MAP@Base 6.1.20060507
+ UDV_Draw_scale@Base 6.1.20060507
+ UDV_Draw_sequence@Base 6.1.20060507
+ UDV_FeaturesListBoxFind@Base 6.1.20060507
+ UDV_FileClose@Base 6.1.20060507
+ UDV_FileOpen@Base 6.1.20060507
+ UDV_FontDim@Base 6.1.20060507
+ UDV_FreeVDPstruct@Base 6.1.20060507
+ UDV_GetClosetSeqLocGivenBspPos@Base 6.1.20060507
+ UDV_GetCurrentDispRange@Base 6.1.20060507
+ UDV_GetSelectedRegions@Base 6.1.20060507
+ UDV_HoldProc@Base 6.1.20060507
+ UDV_InitFont@Base 6.1.20060507
+ UDV_InitForSequin@Base 6.1.20060507
+ UDV_Init_GraphData@Base 6.1.20060507
+ UDV_Init_NonAutonomous@Base 6.1.20060507
+ UDV_Init_ScaleData@Base 6.1.20060507
+ UDV_Init_vdp_struct@Base 6.1.20060507
+ UDV_InvalRegion@Base 6.1.20060507
+ UDV_IsLetterSelected@Base 6.1.20060507
+ UDV_LoadSpecificEditor@Base 6.1.20060507
+ UDV_Logo_onDraw@Base 6.1.20060507
+ UDV_ManageDragHoldActions@Base 6.1.20060507
+ UDV_NetOpen@Base 6.1.20060507
+ UDV_ObjRegAutonomous@Base 6.1.20060507
+ UDV_ReleaseMouse@Base 6.1.20060507
+ UDV_ReleaseProc@Base 6.1.20060507
+ UDV_Resize_Logo_Panel@Base 6.1.20060507
+ UDV_SelectFeatInFeatDlg@Base 6.1.20060507
+ UDV_SetupMenus@Base 6.1.20060507
+ UDV_WinMainCleanupExtraProc@Base 6.1.20060507
+ UDV_WinMainProgQuit@Base 6.1.20060507
+ UDV_WinMainResize@Base 6.1.20060507
+ UDV_analyze_SEP_for_open@Base 6.1.20060507
+ UDV_create_buffer@Base 6.1.20060507
+ UDV_deselect_feature@Base 6.1.20060507
+ UDV_draw_double_cursor@Base 6.1.20060507
+ UDV_draw_horizontal_bar@Base 6.1.20060507
+ UDV_draw_horizontal_line@Base 6.1.20060507
+ UDV_draw_rectangle@Base 6.1.20060507
+ UDV_draw_vertical_bar@Base 6.1.20060507
+ UDV_draw_viewer@Base 6.1.20060507
+ UDV_init_bsp_forViewer@Base 6.1.20060507
+ UDV_resize_viewer@Base 6.1.20060507
+ UDV_select_feature@Base 6.1.20060507
+ UDV_set_MainControls@Base 6.1.20060507
+ UDV_set_MainMenus@Base 6.1.20060507
+ UDV_set_PullMenus@Base 6.1.20060507
+ UnDViewerVScrlProc@Base 6.1.20060507
+ UnDViewerVScrlUpdate@Base 6.1.20060507
+ UntranslateFunc@Base 6.1.20060507
+ UpdateGeneLocation@Base 6.1.20060507
+ UpdateOneSeqAlignFarPointer@Base 6.1.20081116
+ UpdateSeqAlign@Base 6.1.20060507
+ UpdateSeqViewPanel@Base 6.1.20060507
+ UpdatemRNAAfterEditing@Base 6.1.20110713
+ VSMAddMenu@Base 6.1.20060507
+ VSMAddToMenu@Base 6.1.20060507
+ VSMDescriptorAsnSave@Base 6.1.20080302
+ VSMEntityDraw@Base 6.1.20060507
+ VSMExportNucFeatureTable@Base 6.1.20060507
+ VSMExportNucFeatureTableSelectedFeatures@Base 6.1.20060507
+ VSMExportNucFeatureTableSelectedFeaturesSuppressProteinIDs@Base 6.1.20060507
+ VSMExportNucFeatureTableSuppressProteinIDs@Base 6.1.20060507
+ VSMExportNucFeatureTableWithoutSources@Base 6.1.20060507
+ VSMExportNucFeatureTableWithoutSourcesSuppressProteinIDs@Base 6.1.20060507
+ VSMExportProteinFeatureTable@Base 6.1.20060507
+ VSMFastaNucOpen@Base 6.1.20060507
+ VSMFastaNucSave@Base 6.1.20060507
+ VSMFastaProtOpen@Base 6.1.20060507
+ VSMFastaProtSave@Base 6.1.20060507
+ VSMFastaProtSaveWithProduct@Base 6.1.20100808
+ VSMFastaSortedProtSave@Base 6.1.20060507
+ VSMFileInit@Base 6.1.20060507
+ VSMGenericBinAsnOpen@Base 6.1.20060507
+ VSMGenericBinAsnSave@Base 6.1.20060507
+ VSMGenericTextAsnOpen@Base 6.1.20060507
+ VSMGenericTextAsnSave@Base 6.1.20060507
+ VSMPictMsgFunc@Base 6.1.20060507
+ VSMSaveSetsAsFiles@Base 6.1.20090719
+ VSeqMgrDelete@Base 6.1.20060507
+ VSeqMgrGenFunc@Base 6.1.20060507
+ VSeqMgrGet@Base 6.1.20060507
+ VSeqMgrInit@Base 6.1.20060507
+ VSeqMgrMsgFunc@Base 6.1.20060507
+ VSeqMgrRun@Base 6.1.20060507
+ VSeqMgrShow@Base 6.1.20060507
+ ValNodeChoiceMatch@Base 6.1.20060507
+ ValNodeSelectionDialog@Base 6.1.20060507
+ ValNodeSelectionDialogEx@Base 6.1.20060507
+ ValNodeSelectionDialogExEx@Base 6.1.20081116
+ ValNodeSimpleDataFree@Base 6.1.20060507
+ ValNodeStringCopy@Base 6.1.20060507
+ ValNodeStringMatch@Base 6.1.20060507
+ ValNodeStringName@Base 6.1.20060507
+ ValidErrCallback@Base 6.1.20070822
+ ValidErrHook@Base 6.1.20060507
+ ValidateSeqAlignandACC@Base 6.1.20061015
+ ValidateSeqAlignandACCFromData@Base 6.1.20061015
+ ValidateSeqAlignandACCInSeqEntry@Base 6.1.20061015
+ ValueListDialog@Base 6.1.20070822
+ VibrantToDatePtr@Base 6.1.20060507
+ ViewSortedProteins@Base 6.1.20070822
+ VisStrGenFunc@Base 6.1.20060507
+ VisStringDialogToGbquals@Base 6.1.20060507
+ VscrlProc@Base 6.1.20060507
+ WWW_PrintGeneRef@Base 6.1.20060507
+ WordSubstitutionSetDialog@Base 6.1.20110713
+ WriteAlignmentContiguousToFile@Base 6.1.20060507
+ WriteAlignmentInterleaveToFile@Base 6.1.20060507
+ WriteAlignmentInterleaveToFileEx@Base 6.1.20061015
+ WriteBadSpecificHostTable@Base 6.1.20070822
+ XYPlot@Base 6.1.20060507
+ accessionlist_types@Base 6.1.20080302
+ accessionlist_widths@Base 6.1.20080302
+ accn_type_alist@Base 6.1.20060507
+ add_attribute_pen@Base 6.1.20060507
+ alnPageData@Base 6.1.20060507
+ amino_acid_order@Base 6.1.20060507
+ asn2gphGphPageData@Base 6.1.20060507
+ asnPageData@Base 6.1.20060507
+ author_types@Base 6.1.20060507
+ biosource_genome_simple_alist@Base 6.1.20060507
+ biosource_origin_alist@Base 6.1.20060507
+ blosum30mt@Base 6.1.20060507
+ blosum40mt@Base 6.1.20060507
+ blosum45mt@Base 6.1.20060507
+ blosum62mt2@Base 6.1.20060507
+ blosum62mt@Base 6.1.20060507
+ blosum80mt@Base 6.1.20060507
+ codebreak_alists@Base 6.1.20060507
+ codebreak_types@Base 6.1.20060507
+ codebreak_widths@Base 6.1.20060507
+ codon_start_values@Base 6.1.20070822
+ collect_alignnode_from_slp@Base 6.1.20060507
+ compose_g_legend@Base 6.1.20060507
+ create_gene_data@Base 6.1.20060507
+ custom_color@Base 6.1.20060507
+ ddbjPageData@Base 6.1.20060507
+ direction_values@Base 6.1.20070822
+ do_copy@Base 6.1.20060507
+ do_cut@Base 6.1.20060507
+ do_paste@Base 6.1.20060507
+ do_resize_panel@Base 6.1.20060507
+ do_resize_window@Base 6.1.20060507
+ draw_one_align@Base 6.1.20060507
+ dskPageData@Base 6.1.20060507
+ emblPageData@Base 6.1.20060507
+ enum_bond_alist@Base 6.1.20060507
+ enum_site_alist@Base 6.1.20060507
+ ep_t@Base 6.1.20060507
+ ep_types_f@Base 6.1.20060507
+ ep_types_m@Base 6.1.20060507
+ ep_w@Base 6.1.20060507
+ ep_width_f@Base 6.1.20060507
+ ep_width_m@Base 6.1.20060507
+ evcat_alist@Base 6.1.20110713
+ experiment_category_alist@Base 6.1.20160908
+ experiment_types@Base 6.1.20160908
+ experiment_widths@Base 6.1.20160908
+ feature2segment@Base 6.1.20060507
+ find_map_pos@Base 6.1.20060507
+ free_global_draw@Base 6.1.20060507
+ fstaPageData@Base 6.1.20060507
+ ftblPageData@Base 6.1.20060507
+ gbgnPageData@Base 6.1.20060507
+ gbqual_edit_list@Base 6.1.20070822
+ gbqual_types@Base 6.1.20060507
+ gbqual_widths@Base 6.1.20060507
+ gbseqPageData@Base 6.1.20060507
+ gcIdToIndex@Base 6.1.20060507
+ gcIndexToId@Base 6.1.20060507
+ gcNames@Base 6.1.20060507
+ gene2segment@Base 6.1.20060507
+ get_current_class@Base 6.1.20060507
+ get_enz_color@Base 6.1.20060507
+ get_map_type@Base 6.1.20060507
+ get_seg_color@Base 6.1.20060507
+ getwindow_frompanel@Base 6.1.20060507
+ gnbkPageData@Base 6.1.20060507
+ gnptPageData@Base 6.1.20060507
+ gon120mt@Base 6.1.20060507
+ gon160mt@Base 6.1.20060507
+ gon250mt@Base 6.1.20060507
+ gon300mt@Base 6.1.20060507
+ gon350mt@Base 6.1.20060507
+ gon40mt@Base 6.1.20060507
+ gon80mt@Base 6.1.20060507
+ gphPageData@Base 6.1.20060507
+ has_cyto_map@Base 6.1.20060507
+ hoffset2voffset@Base 6.1.20060507
+ idmat@Base 6.1.20060507
+ import_featdef_alist@Base 6.1.20060507
+ inference_alist@Base 6.1.20060507
+ interval_types@Base 6.1.20060507
+ interval_widths@Base 6.1.20060507
+ inval_all@Base 6.1.20060507
+ inval_allines@Base 6.1.20060507
+ inval_panel@Base 6.1.20060507
+ inval_pep@Base 6.1.20060507
+ inval_rect@Base 6.1.20060507
+ inval_rectidselected@Base 6.1.20060507
+ inval_selstruct@Base 6.1.20060507
+ inval_selstructloc@Base 6.1.20060507
+ inval_selstructloc_forfeat@Base 6.1.20060507
+ inval_selstructpos@Base 6.1.20060507
+ inval_selstructpos_tobottom@Base 6.1.20060507
+ inval_window@Base 6.1.20060507
+ kDisableStrainForwardAttrib@Base 6.1.20160908
+ kDoNotEditTitle@Base 6.1.20160908
+ kTransSplicing@Base 6.1.20160908
+ legacy_pseudogene_alist@Base 6.1.20120620
+ load_align_label_rectangle@Base 6.1.20060507
+ load_align_option_for_graphic@Base 6.1.20060507
+ locate_point@Base 6.1.20060507
+ locate_region@Base 6.1.20060507
+ mRNAFilter@Base 6.1.20060507
+ mRNALookup@Base 6.1.20060507
+ mRNATrack@Base 6.1.20060507
+ mSM_allfeatureNames@Base 6.1.20060507
+ mapPageData@Base 6.1.20060507
+ map_gene_location@Base 6.1.20060507
+ map_one_location_to_slp_list@Base 6.1.20060507
+ merge_same_itemID@Base 6.1.20060507
+ mobile_element_keywords@Base 6.1.20070822
+ modify_insert_fnode@Base 6.1.20060507
+ mol_type_values@Base 6.1.20070822
+ months_alist@Base 6.1.20060507
+ new_pseudogene_alist@Base 6.1.20120620
+ nucleotide_alphabet@Base 6.1.20120620
+ numAccnTypePrefixes@Base 6.1.20080302
+ numGeneticCodes@Base 6.1.20060507
+ on_click@Base 6.1.20060507
+ on_drag@Base 6.1.20060507
+ on_draw@Base 6.1.20060507
+ on_hold@Base 6.1.20060507
+ on_key@Base 6.1.20060507
+ on_release@Base 6.1.20060507
+ on_time@Base 6.1.20060507
+ organelle_values@Base 6.1.20070822
+ orgmod_types@Base 6.1.20060507
+ orgmod_widths@Base 6.1.20060507
+ pam120mt@Base 6.1.20060507
+ pam20mt@Base 6.1.20060507
+ pam250mt@Base 6.1.20060507
+ pam350mt@Base 6.1.20060507
+ pam60mt@Base 6.1.20060507
+ pcr_primer_dlg_types@Base 6.1.20110713
+ pcr_primer_dlg_widths@Base 6.1.20110713
+ pic_for_f_legend@Base 6.1.20060507
+ prev_primID@Base 6.1.20060507
+ print_contig_html_color@Base 6.1.20060507
+ print_genome_interval@Base 6.1.20060507
+ program_alist@Base 6.1.20060507
+ progressW@Base 6.1.20060507
+ protein_alphabet@Base 6.1.20120620
+ qualPageData@Base 6.1.20060507
+ readonlystring_types@Base 6.1.20060507
+ recombination_class_keywords@Base 6.1.20170106
+ regulatory_class_keywords@Base 6.1.20160908
+ replace_region@Base 6.1.20060507
+ repopulate_panel@Base 6.1.20060507
+ rf10ItemProc@Base 6.1.20060507
+ rf1ItemProc@Base 6.1.20060507
+ rf2ItemProc@Base 6.1.20060507
+ rf3ItemProc@Base 6.1.20060507
+ rf4ItemProc@Base 6.1.20060507
+ rf5ItemProc@Base 6.1.20060507
+ rf6ItemProc@Base 6.1.20060507
+ rf7ItemProc@Base 6.1.20060507
+ rf8ItemProc@Base 6.1.20060507
+ rf9ItemProc@Base 6.1.20060507
+ rpt_type_values@Base 6.1.20070822
+ satellite_keywords@Base 6.1.20081116
+ seqAlnPnlPageData@Base 6.1.20060507
+ seqPageData@Base 6.1.20060507
+ seqalign_write@Base 6.1.20060507
+ seqannot_write@Base 6.1.20060507
+ seqentry_read@Base 6.1.20060507
+ seqpnlPageData@Base 6.1.20060507
+ sesp_to_pept@Base 6.1.20060507
+ setUpLetterColor@Base 6.1.20060507
+ smartBioseqViewForm@Base 6.1.20060507
+ spop@Base 6.1.20060507
+ startPt@Base 6.1.20060507
+ std_author_widths@Base 6.1.20060507
+ stopPt@Base 6.1.20060507
+ str_author_widths@Base 6.1.20060507
+ strip_repeat_feature@Base 6.1.20060507
+ subsource_types@Base 6.1.20060507
+ subsource_widths@Base 6.1.20060507
+ sumPageData@Base 6.1.20060507
+ to_update_prompt@Base 6.1.20060507
+ true_false@Base 6.1.20090719
+ udvPageData@Base 6.1.20060507
+ update_codonstartbt@Base 6.1.20060507
+ update_edititem@Base 6.1.20060507
+ update_featpept@Base 6.1.20060507
+ update_translateitem@Base 6.1.20060507
+ visstring_types@Base 6.1.20060507
+ visstring_widths@Base 6.1.20060507
+ xmlPageData@Base 6.1.20060507
+libvibnet.so.6 libvibrant6b #MINVER#
+ CreateClearUnusedItem@Base 6.1.20060507
+ CreateDocSumForm@Base 6.1.20060507
+ CreateEntrezPrefsDialog@Base 6.1.20060507
+ CreateNeighborDelayChoice@Base 6.1.20060507
+ CreateQueryTypeChoice@Base 6.1.20060507
+ CreateTermListForm@Base 6.1.20060507
+ DSLoadUidListProc@Base 6.1.20060507
+ DSSaveUidListProc@Base 6.1.20060507
+ DatabaseFromName@Base 6.1.20060507
+ DisplayFontChangeProc@Base 6.1.20060507
+ DocSumCanSaveFasta@Base 6.1.20060507
+ DocSumFontChangeProc@Base 6.1.20060507
+ EntrezPrefsFree@Base 6.1.20060507
+ EntrezPrefsNew@Base 6.1.20060507
+ ExportDocSumFasta@Base 6.1.20060507
+ FieldFromTag@Base 6.1.20060507
+ LaunchRecordViewer@Base 6.1.20060507
+ LoadDocsumOptionsMenu@Base 6.1.20060507
+ LoadNamedUidList@Base 6.1.20060507
+ MakeDatabaseAlist@Base 6.1.20060507
+ MakeFieldAlist@Base 6.1.20060507
+ MakeViewerLinkControls@Base 6.1.20060507
+ RetrieveDocuments@Base 6.1.20060507
+ RetrieveSimpleSeqs@Base 6.1.20060507
+ ShowNetConfigForm@Base 6.1.20060507
+ TLLoadUidListProc@Base 6.1.20060507
+ TLSaveUidListProc@Base 6.1.20060507
+ UpdateViewerLinkTarget@Base 6.1.20060507
+ UseDelayedNeighbor@Base 6.1.20060507
+ UsingDelayedNeighbor@Base 6.1.20060507
+ UsingTextQuery@Base 6.1.20060507
+libvibrantOGL.so.6 libvibrant6b #MINVER#
+ AddOval@Base 6.1.20060507
+ AppendPalette@Base 6.1.20060507
+ AppendTableText@Base 6.1.20060507
+ BLACK_COLOR@Base 6.1.20060507
+ BLUE_COLOR@Base 6.1.20060507
+ BgColorDlg3D@Base 6.1.20060507
+ CYAN_COLOR@Base 6.1.20060507
+ CreateTagListDialogEx3@Base 6.1.20070822
+ CreateTagListDialogEx@Base 6.1.20060507
+ CreateTagListDialogExEx@Base 6.1.20060507
+ DoNothingMA@Base 6.1.20060507
+ GREEN_COLOR@Base 6.1.20060507
+ GetPaletteValue@Base 6.1.20060507
+ GetTableGray@Base 6.1.20060507
+ GetTableHilight@Base 6.1.20060507
+ GetTableText@Base 6.1.20060507
+ MAGENTA_COLOR@Base 6.1.20060507
+ MA_AddAction@Base 6.1.20060507
+ MA_AddGroup@Base 6.1.20060507
+ MA_Create@Base 6.1.20060507
+ MA_Destroy@Base 6.1.20060507
+ MA_GetExtra@Base 6.1.20060507
+ MA_GetPanel@Base 6.1.20060507
+ MA_GetVisible@Base 6.1.20060507
+ MA_LinkPanel@Base 6.1.20060507
+ MA_Reset@Base 6.1.20060507
+ MA_SetAction@Base 6.1.20060507
+ MA_SetExtra@Base 6.1.20060507
+ MA_SetGroup@Base 6.1.20060507
+ MA_SetVisible@Base 6.1.20060507
+ MA_UnlinkPanel@Base 6.1.20060507
+ MA_UnsetAll@Base 6.1.20060507
+ MA_UnsetGroup@Base 6.1.20060507
+ NS_OpenURL@Base 6.1.20060507
+ NS_ResetWindow@Base 6.1.20060507
+ NS_SendCommand@Base 6.1.20060507
+ NS_WindowFree@Base 6.1.20060507
+ Nlm_ActiveWindow@Base 6.1.20060507
+ Nlm_AddArc@Base 6.1.20060507
+ Nlm_AddAttribute@Base 6.1.20060507
+ Nlm_AddBitmap@Base 6.1.20060507
+ Nlm_AddCylinder3D@Base 6.1.20060507
+ Nlm_AddHalfWorm3D@Base 6.1.20060507
+ Nlm_AddInvFrame@Base 6.1.20060507
+ Nlm_AddLabel@Base 6.1.20060507
+ Nlm_AddLine3D@Base 6.1.20060507
+ Nlm_AddLine@Base 6.1.20060507
+ Nlm_AddMarker@Base 6.1.20060507
+ Nlm_AddPoly3D@Base 6.1.20060507
+ Nlm_AddPolygon@Base 6.1.20060507
+ Nlm_AddPrim3D@Base 6.1.20060507
+ Nlm_AddPrimitive@Base 6.1.20060507
+ Nlm_AddPt@Base 6.1.20060507
+ Nlm_AddRectangle@Base 6.1.20060507
+ Nlm_AddRoundedRectangle@Base 6.1.20060507
+ Nlm_AddSegRect@Base 6.1.20060507
+ Nlm_AddSegment3D@Base 6.1.20060507
+ Nlm_AddSilentSegRect@Base 6.1.20060507
+ Nlm_AddSntRectangle@Base 6.1.20060507
+ Nlm_AddSphere3D@Base 6.1.20060507
+ Nlm_AddSubwindowShell@Base 6.1.20060507
+ Nlm_AddSymbol@Base 6.1.20060507
+ Nlm_AddText3D@Base 6.1.20060507
+ Nlm_AddTextLabel@Base 6.1.20060507
+ Nlm_AddVertPoly3D@Base 6.1.20060507
+ Nlm_Adjust3D@Base 6.1.20060507
+ Nlm_AdjustDocScroll@Base 6.1.20060507
+ Nlm_AdjustPrnt@Base 6.1.20060507
+ Nlm_Advance@Base 6.1.20060507
+ Nlm_AlertWindow@Base 6.1.20060507
+ Nlm_AlignObjects@Base 6.1.20060507
+ Nlm_AllLayerSet3D@Base 6.1.20060507
+ Nlm_AllParentsButWindowVisible@Base 6.1.20060507
+ Nlm_AllParentsEnabled@Base 6.1.20060507
+ Nlm_AllParentsVisible@Base 6.1.20060507
+ Nlm_AllocPalette3D@Base 6.1.20060507
+ Nlm_AllocateImage@Base 6.1.20060507
+ Nlm_AppendItem@Base 6.1.20060507
+ Nlm_AppendText@Base 6.1.20060507
+ Nlm_AppleMenu@Base 6.1.20060507
+ Nlm_ArrowCursor@Base 6.1.20060507
+ Nlm_Ascent@Base 6.1.20060507
+ Nlm_AssignPrinterFont@Base 6.1.20060507
+ Nlm_AttachInstance@Base 6.1.20060507
+ Nlm_AttachPicture3D@Base 6.1.20060507
+ Nlm_AttachPicture@Base 6.1.20060507
+ Nlm_Autonomous3DPanel@Base 6.1.20060507
+ Nlm_AutonomousPanel4@Base 6.1.20060507
+ Nlm_AutonomousPanel@Base 6.1.20060507
+ Nlm_Black@Base 6.1.20060507
+ Nlm_Blue@Base 6.1.20060507
+ Nlm_BoxInViewport@Base 6.1.20060507
+ Nlm_Break@Base 6.1.20060507
+ Nlm_BulkAppendItem@Base 6.1.20060507
+ Nlm_CaptureSlateFocus@Base 6.1.20060507
+ Nlm_CardToStr@Base 6.1.20060507
+ Nlm_ChangeAddPrimOrder@Base 6.1.20060507
+ Nlm_ChangePrim3D@Base 6.1.20060507
+ Nlm_ChangePrimAttribute@Base 6.1.20060507
+ Nlm_ChangeSegment3D@Base 6.1.20060507
+ Nlm_ChangeSentinelRectangle@Base 6.1.20060507
+ Nlm_CharWidth@Base 6.1.20060507
+ Nlm_CheckBox@Base 6.1.20060507
+ Nlm_CheckBoxEx@Base 6.1.20170106
+ Nlm_CheckX@Base 6.1.20060507
+ Nlm_ChoiceGroup@Base 6.1.20060507
+ Nlm_ChoiceItem@Base 6.1.20060507
+ Nlm_ChooseColorDialog@Base 6.1.20060507
+ Nlm_ChooseFont@Base 6.1.20060507
+ Nlm_CleanUpDrawingTools@Base 6.1.20060507
+ Nlm_CleanupPrimitive@Base 6.1.20060507
+ Nlm_ClearItemsInGroup@Base 6.1.20060507
+ Nlm_ClearRgn@Base 6.1.20060507
+ Nlm_ClearText@Base 6.1.20060507
+ Nlm_ClipPrintingRect@Base 6.1.20060507
+ Nlm_ClipRect@Base 6.1.20060507
+ Nlm_ClipRgn@Base 6.1.20060507
+ Nlm_ClipboardHasString@Base 6.1.20060507
+ Nlm_ClipboardToString@Base 6.1.20060507
+ Nlm_CommandItem@Base 6.1.20060507
+ Nlm_ComputerTime@Base 6.1.20060507
+ Nlm_CopyAllViewer@Base 6.1.20060507
+ Nlm_CopyBits@Base 6.1.20060507
+ Nlm_CopyFont@Base 6.1.20060507
+ Nlm_CopyMode@Base 6.1.20060507
+ Nlm_CopyPixmap@Base 6.1.20060507
+ Nlm_CopyText@Base 6.1.20060507
+ Nlm_CopyViewer@Base 6.1.20060507
+ Nlm_CopyWindowImage@Base 6.1.20060507
+ Nlm_CorrectBarMax@Base 6.1.20060507
+ Nlm_CorrectBarPage@Base 6.1.20060507
+ Nlm_CorrectBarValue@Base 6.1.20060507
+ Nlm_CountGroupItems@Base 6.1.20060507
+ Nlm_CountItems@Base 6.1.20060507
+ Nlm_Courier@Base 6.1.20060507
+ Nlm_CreateControls3D@Base 6.1.20060507
+ Nlm_CreateEnumListDialog@Base 6.1.20060507
+ Nlm_CreateEnumPopupDialog@Base 6.1.20060507
+ Nlm_CreateEnumPopupListInitName@Base 6.1.20060507
+ Nlm_CreateEnumPopupListInitVal@Base 6.1.20060507
+ Nlm_CreateFolderTabButtons@Base 6.1.20120620
+ Nlm_CreateFolderTabs@Base 6.1.20060507
+ Nlm_CreateFont@Base 6.1.20060507
+ Nlm_CreateGIF@Base 6.1.20060507
+ Nlm_CreateImage@Base 6.1.20060507
+ Nlm_CreateLink@Base 6.1.20060507
+ Nlm_CreatePicture3D@Base 6.1.20060507
+ Nlm_CreatePicture@Base 6.1.20060507
+ Nlm_CreateRgn@Base 6.1.20060507
+ Nlm_CreateSegment@Base 6.1.20060507
+ Nlm_CreateTagListDialog@Base 6.1.20060507
+ Nlm_CreateTextTabs@Base 6.1.20060507
+ Nlm_CreateViewer3D@Base 6.1.20060507
+ Nlm_CreateViewer@Base 6.1.20060507
+ Nlm_CrossCursor@Base 6.1.20060507
+ Nlm_CurrentText@Base 6.1.20060507
+ Nlm_CurrentVisibleText@Base 6.1.20060507
+ Nlm_CurrentWindow@Base 6.1.20060507
+ Nlm_CustomPanel@Base 6.1.20060507
+ Nlm_CutText@Base 6.1.20060507
+ Nlm_Cyan@Base 6.1.20060507
+ Nlm_Dark@Base 6.1.20060507
+ Nlm_Dashed@Base 6.1.20060507
+ Nlm_DecodeColor@Base 6.1.20060507
+ Nlm_DefaultButton@Base 6.1.20060507
+ Nlm_DefaultButtonEx@Base 6.1.20170106
+ Nlm_DelSubwindowShell@Base 6.1.20060507
+ Nlm_DeleteControls3D@Base 6.1.20060507
+ Nlm_DeleteFont@Base 6.1.20060507
+ Nlm_DeleteImage@Base 6.1.20060507
+ Nlm_DeleteItem@Base 6.1.20060507
+ Nlm_DeletePicture3D@Base 6.1.20060507
+ Nlm_DeletePicture@Base 6.1.20060507
+ Nlm_DeletePrim3D@Base 6.1.20060507
+ Nlm_DeletePrim@Base 6.1.20060507
+ Nlm_DeleteSegment3D@Base 6.1.20060507
+ Nlm_DeleteSegment@Base 6.1.20060507
+ Nlm_DeleteViewer3D@Base 6.1.20060507
+ Nlm_DeleteViewer@Base 6.1.20060507
+ Nlm_DependentPrompt@Base 6.1.20060507
+ Nlm_Descent@Base 6.1.20060507
+ Nlm_DeskAccGroup@Base 6.1.20060507
+ Nlm_DestroyGIF@Base 6.1.20060507
+ Nlm_DestroyRgn@Base 6.1.20060507
+ Nlm_DiagGetRecordCount@Base 6.1.20060507
+ Nlm_DiagGetRecordStr@Base 6.1.20060507
+ Nlm_DiagGetRecordType@Base 6.1.20060507
+ Nlm_DiagHasErrorRec@Base 6.1.20060507
+ Nlm_DiagPutRecord@Base 6.1.20060507
+ Nlm_DiagReset@Base 6.1.20060507
+ Nlm_DialogText@Base 6.1.20060507
+ Nlm_DialogTextWithFont@Base 6.1.20120620
+ Nlm_DialogToPointer@Base 6.1.20060507
+ Nlm_DiffRgn@Base 6.1.20060507
+ Nlm_Disable@Base 6.1.20060507
+ Nlm_DisplayFancy@Base 6.1.20060507
+ Nlm_DisplayFile@Base 6.1.20060507
+ Nlm_DkGray@Base 6.1.20060507
+ Nlm_DoAction@Base 6.1.20060507
+ Nlm_DoActivate@Base 6.1.20060507
+ Nlm_DoAdjustPrnt@Base 6.1.20060507
+ Nlm_DoCallback@Base 6.1.20060507
+ Nlm_DoDeactivate@Base 6.1.20060507
+ Nlm_DoDisable@Base 6.1.20060507
+ Nlm_DoEnable@Base 6.1.20060507
+ Nlm_DoGainFocus@Base 6.1.20060507
+ Nlm_DoGetOffset@Base 6.1.20060507
+ Nlm_DoGetPosition@Base 6.1.20060507
+ Nlm_DoGetStatus@Base 6.1.20060507
+ Nlm_DoGetTitle@Base 6.1.20060507
+ Nlm_DoGetValue@Base 6.1.20060507
+ Nlm_DoHide@Base 6.1.20060507
+ Nlm_DoLinkIn@Base 6.1.20060507
+ Nlm_DoLoseFocus@Base 6.1.20060507
+ Nlm_DoRemove@Base 6.1.20060507
+ Nlm_DoReset@Base 6.1.20060507
+ Nlm_DoSelect@Base 6.1.20060507
+ Nlm_DoSendChar@Base 6.1.20060507
+ Nlm_DoSendFocus@Base 6.1.20060507
+ Nlm_DoSetOffset@Base 6.1.20060507
+ Nlm_DoSetPosition@Base 6.1.20060507
+ Nlm_DoSetRange@Base 6.1.20060507
+ Nlm_DoSetStatus@Base 6.1.20060507
+ Nlm_DoSetTitle@Base 6.1.20060507
+ Nlm_DoSetValue@Base 6.1.20060507
+ Nlm_DoShow@Base 6.1.20060507
+ Nlm_DocumentPanel@Base 6.1.20060507
+ Nlm_DocumentWindow@Base 6.1.20060507
+ Nlm_Dotted@Base 6.1.20060507
+ Nlm_DoubleToStr@Base 6.1.20060507
+ Nlm_DrawLine@Base 6.1.20060507
+ Nlm_DrawPrimitive@Base 6.1.20060507
+ Nlm_DrawSegment@Base 6.1.20060507
+ Nlm_DrawString@Base 6.1.20060507
+ Nlm_DrawText@Base 6.1.20060507
+ Nlm_DuplicateEnumFieldAlist@Base 6.1.20060507
+ Nlm_Empty@Base 6.1.20060507
+ Nlm_EmptyRect@Base 6.1.20060507
+ Nlm_EmptyRgn@Base 6.1.20060507
+ Nlm_Enable@Base 6.1.20060507
+ Nlm_Enabled@Base 6.1.20060507
+ Nlm_EndPage@Base 6.1.20060507
+ Nlm_EndPicture@Base 6.1.20060507
+ Nlm_EndPrinting@Base 6.1.20060507
+ Nlm_EqualFontSpec@Base 6.1.20060507
+ Nlm_EqualPt@Base 6.1.20060507
+ Nlm_EqualRect@Base 6.1.20060507
+ Nlm_EqualRgn@Base 6.1.20060507
+ Nlm_EraseArc@Base 6.1.20060507
+ Nlm_EraseMode@Base 6.1.20060507
+ Nlm_EraseOval@Base 6.1.20060507
+ Nlm_ErasePoly@Base 6.1.20060507
+ Nlm_EraseQuadrant@Base 6.1.20060507
+ Nlm_EraseRect@Base 6.1.20060507
+ Nlm_EraseRgn@Base 6.1.20060507
+ Nlm_EraseRoundRect@Base 6.1.20060507
+ Nlm_EraseWindow@Base 6.1.20060507
+ Nlm_EstimateScaling@Base 6.1.20060507
+ Nlm_EventAvail@Base 6.1.20060507
+ Nlm_Execv@Base 6.1.20060507
+ Nlm_ExploreSegment@Base 6.1.20060507
+ Nlm_ExportDialog@Base 6.1.20060507
+ Nlm_ExportForm@Base 6.1.20060507
+ Nlm_ExtendedList@Base 6.1.20060507
+ Nlm_ExtractTagListColumn@Base 6.1.20060507
+ Nlm_FindAvailableFonts@Base 6.1.20060507
+ Nlm_FindFormMenuItem@Base 6.1.20060507
+ Nlm_FindItem@Base 6.1.20060507
+ Nlm_FindNextResidentFont@Base 6.1.20060507
+ Nlm_FindPrim3D@Base 6.1.20060507
+ Nlm_FindSegPrim@Base 6.1.20060507
+ Nlm_FindSegment@Base 6.1.20060507
+ Nlm_FineGranularitySleep@Base 6.1.20060507
+ Nlm_FitStringWidth@Base 6.1.20060507
+ Nlm_FixedWindow@Base 6.1.20060507
+ Nlm_FloatingWindow@Base 6.1.20060507
+ Nlm_FlushEvents@Base 6.1.20060507
+ Nlm_FontGroup@Base 6.1.20060507
+ Nlm_FontHeight@Base 6.1.20060507
+ Nlm_FontSpecToStr@Base 6.1.20060507
+ Nlm_ForceFormat@Base 6.1.20060507
+ Nlm_FormCommandItem@Base 6.1.20060507
+ Nlm_FormToPointer@Base 6.1.20060507
+ Nlm_FrameArc@Base 6.1.20060507
+ Nlm_FrameOval@Base 6.1.20060507
+ Nlm_FramePoly@Base 6.1.20060507
+ Nlm_FrameQuadrant@Base 6.1.20060507
+ Nlm_FrameRect@Base 6.1.20060507
+ Nlm_FrameRgn@Base 6.1.20060507
+ Nlm_FrameRoundRect@Base 6.1.20060507
+ Nlm_FreeBars@Base 6.1.20060507
+ Nlm_FreeButtons@Base 6.1.20060507
+ Nlm_FreeEnumFieldAlist@Base 6.1.20060507
+ Nlm_FreeExtras@Base 6.1.20060507
+ Nlm_FreeForms@Base 6.1.20060507
+ Nlm_FreeGroup@Base 6.1.20060507
+ Nlm_FreeLists@Base 6.1.20060507
+ Nlm_FreeMenus@Base 6.1.20060507
+ Nlm_FreePrompt@Base 6.1.20060507
+ Nlm_FreeSlate@Base 6.1.20060507
+ Nlm_FreeTexts@Base 6.1.20060507
+ Nlm_FreeWindows@Base 6.1.20060507
+ Nlm_FrontWindow@Base 6.1.20060507
+ Nlm_FrozenWindow@Base 6.1.20060507
+ Nlm_GeneralPanel@Base 6.1.20060507
+ Nlm_GeneralSlate@Base 6.1.20060507
+ Nlm_GetAllParentsEnabled@Base 6.1.20060507
+ Nlm_GetAllParentsVisible@Base 6.1.20060507
+ Nlm_GetArgs@Base 6.1.20060507
+ Nlm_GetArgsSilent@Base 6.1.20060507
+ Nlm_GetBarMax@Base 6.1.20060507
+ Nlm_GetBarValue@Base 6.1.20060507
+ Nlm_GetBestOGLVisual@Base 6.1.20060507
+ Nlm_GetBoxData@Base 6.1.20060507
+ Nlm_GetChild@Base 6.1.20060507
+ Nlm_GetChoiceTitle@Base 6.1.20060507
+ Nlm_GetClassPtr@Base 6.1.20060507
+ Nlm_GetColParams@Base 6.1.20060507
+ Nlm_GetColor3D@Base 6.1.20060507
+ Nlm_GetColor@Base 6.1.20060507
+ Nlm_GetColorImage@Base 6.1.20060507
+ Nlm_GetColorRGB@Base 6.1.20060507
+ Nlm_GetDocData@Base 6.1.20060507
+ Nlm_GetDocHighlight@Base 6.1.20060507
+ Nlm_GetDocParams4@Base 6.1.20060507
+ Nlm_GetDocParams@Base 6.1.20060507
+ Nlm_GetDocText@Base 6.1.20060507
+ Nlm_GetEnabled@Base 6.1.20060507
+ Nlm_GetEnumName@Base 6.1.20060507
+ Nlm_GetEnumPopup@Base 6.1.20060507
+ Nlm_GetEnumPopupByName@Base 6.1.20060507
+ Nlm_GetExtraData@Base 6.1.20060507
+ Nlm_GetFixedColormap@Base 6.1.20060507
+ Nlm_GetFont@Base 6.1.20060507
+ Nlm_GetFontEx@Base 6.1.20060507
+ Nlm_GetFontSpec@Base 6.1.20060507
+ Nlm_GetFoundPrim3D@Base 6.1.20060507
+ Nlm_GetGraphicData@Base 6.1.20060507
+ Nlm_GetHitWindow@Base 6.1.20060507
+ Nlm_GetImageSize@Base 6.1.20060507
+ Nlm_GetInputChar@Base 6.1.20060507
+ Nlm_GetInputFileName@Base 6.1.20060507
+ Nlm_GetInputFileNameEx@Base 6.1.20170106
+ Nlm_GetItemIndex@Base 6.1.20060507
+ Nlm_GetItemParams4@Base 6.1.20060507
+ Nlm_GetItemParams@Base 6.1.20060507
+ Nlm_GetItemStatus@Base 6.1.20060507
+ Nlm_GetItemTitle@Base 6.1.20060507
+ Nlm_GetLayerStatus3D@Base 6.1.20060507
+ Nlm_GetLayerTop3D@Base 6.1.20060507
+ Nlm_GetListItem@Base 6.1.20060507
+ Nlm_GetNext@Base 6.1.20060507
+ Nlm_GetNextItem@Base 6.1.20060507
+ Nlm_GetNextPosition@Base 6.1.20060507
+ Nlm_GetObject@Base 6.1.20060507
+ Nlm_GetObjectExtra@Base 6.1.20060507
+ Nlm_GetOffset@Base 6.1.20060507
+ Nlm_GetOffsetX@Base 6.1.20060507
+ Nlm_GetOffsetY@Base 6.1.20060507
+ Nlm_GetOutputFileName@Base 6.1.20060507
+ Nlm_GetPanelExtra@Base 6.1.20060507
+ Nlm_GetParent@Base 6.1.20060507
+ Nlm_GetParentWindow@Base 6.1.20060507
+ Nlm_GetPen@Base 6.1.20060507
+ Nlm_GetPosition@Base 6.1.20060507
+ Nlm_GetPrimDrawAttribute@Base 6.1.20060507
+ Nlm_GetPrimHligh@Base 6.1.20060507
+ Nlm_GetPrimInfo3D@Base 6.1.20060507
+ Nlm_GetPrimitive@Base 6.1.20060507
+ Nlm_GetPrimitiveIDs@Base 6.1.20060507
+ Nlm_GetRealized@Base 6.1.20060507
+ Nlm_GetRect@Base 6.1.20060507
+ Nlm_GetResidentFont@Base 6.1.20060507
+ Nlm_GetScaleX@Base 6.1.20060507
+ Nlm_GetScaleY@Base 6.1.20060507
+ Nlm_GetScrlParams4@Base 6.1.20060507
+ Nlm_GetScrlParams@Base 6.1.20060507
+ Nlm_GetScrollTextOffset4@Base 6.1.20061015
+ Nlm_GetSegBox3D@Base 6.1.20060507
+ Nlm_GetSegSphere3D@Base 6.1.20060507
+ Nlm_GetSegmentInfo3D@Base 6.1.20060507
+ Nlm_GetSlateHScrollBar@Base 6.1.20060507
+ Nlm_GetSlateVScrollBar@Base 6.1.20060507
+ Nlm_GetStatus@Base 6.1.20060507
+ Nlm_GetString@Base 6.1.20060507
+ Nlm_GetSwitchMax@Base 6.1.20060507
+ Nlm_GetTextCursorPos@Base 6.1.20060507
+ Nlm_GetTitle@Base 6.1.20060507
+ Nlm_GetValue@Base 6.1.20060507
+ Nlm_GetViewerData@Base 6.1.20060507
+ Nlm_GetViewerImage3D@Base 6.1.20060507
+ Nlm_GetViewerInfo3D@Base 6.1.20060507
+ Nlm_GetVisible@Base 6.1.20060507
+ Nlm_GetVnpFromText@Base 6.1.20060507
+ Nlm_GetWindowCharDisplay@Base 6.1.20060507
+ Nlm_GetWindowDefaultButton@Base 6.1.20060507
+ Nlm_GetWindowExtra@Base 6.1.20060507
+ Nlm_GetWindowMenuBar@Base 6.1.20060507
+ Nlm_GetWindowShell@Base 6.1.20060507
+ Nlm_GetWorldWindow@Base 6.1.20060507
+ Nlm_GlobalToLocal@Base 6.1.20060507
+ Nlm_Gothic@Base 6.1.20060507
+ Nlm_GothicFixed@Base 6.1.20060507
+ Nlm_Gray@Base 6.1.20060507
+ Nlm_Green@Base 6.1.20060507
+ Nlm_HasAquaMenuLayout@Base 6.1.20060507
+ Nlm_HasDualScreen@Base 6.1.20060507
+ Nlm_Helvetica@Base 6.1.20060507
+ Nlm_HiddenGroup@Base 6.1.20060507
+ Nlm_HiddenSlate@Base 6.1.20060507
+ Nlm_HiddenText@Base 6.1.20060507
+ Nlm_Hide@Base 6.1.20060507
+ Nlm_HideSegment@Base 6.1.20060507
+ Nlm_HighlightPrim3D@Base 6.1.20060507
+ Nlm_HighlightPrimitive@Base 6.1.20060507
+ Nlm_HighlightSeg3D@Base 6.1.20060507
+ Nlm_HighlightSegment@Base 6.1.20060507
+ Nlm_HorizScrollBar4@Base 6.1.20060507
+ Nlm_HorizScrollBar@Base 6.1.20060507
+ Nlm_IBeamCursor@Base 6.1.20060507
+ Nlm_IconButton@Base 6.1.20060507
+ Nlm_IconicWindow@Base 6.1.20060507
+ Nlm_IconifyWindow@Base 6.1.20060507
+ Nlm_ImageGetBlack@Base 6.1.20060507
+ Nlm_ImageGetColorMax@Base 6.1.20060507
+ Nlm_ImageGetColorOffset@Base 6.1.20060507
+ Nlm_ImageModified@Base 6.1.20060507
+ Nlm_ImageSetPalette@Base 6.1.20060507
+ Nlm_ImageShow@Base 6.1.20060507
+ Nlm_ImportDialog@Base 6.1.20060507
+ Nlm_ImportForm@Base 6.1.20060507
+ Nlm_InFront@Base 6.1.20060507
+ Nlm_InWindow@Base 6.1.20060507
+ Nlm_InitBars@Base 6.1.20060507
+ Nlm_InitButtons@Base 6.1.20060507
+ Nlm_InitCursorShapes@Base 6.1.20060507
+ Nlm_InitEnumPopup@Base 6.1.20060507
+ Nlm_InitExtras@Base 6.1.20060507
+ Nlm_InitForms@Base 6.1.20060507
+ Nlm_InitGroup@Base 6.1.20060507
+ Nlm_InitLists@Base 6.1.20060507
+ Nlm_InitMenus@Base 6.1.20060507
+ Nlm_InitPrompt@Base 6.1.20060507
+ Nlm_InitSlate@Base 6.1.20060507
+ Nlm_InitTexts@Base 6.1.20060507
+ Nlm_InitVibrantHooks@Base 6.1.20060507
+ Nlm_InitWindows@Base 6.1.20060507
+ Nlm_InsertItem@Base 6.1.20060507
+ Nlm_InsertText@Base 6.1.20060507
+ Nlm_InsetRect@Base 6.1.20060507
+ Nlm_IntToStr@Base 6.1.20060507
+ Nlm_InvalDocCols@Base 6.1.20060507
+ Nlm_InvalDocRows@Base 6.1.20060507
+ Nlm_InvalDocument@Base 6.1.20060507
+ Nlm_InvalObject@Base 6.1.20060507
+ Nlm_InvalRect@Base 6.1.20060507
+ Nlm_InvalRgn@Base 6.1.20060507
+ Nlm_InvertArc@Base 6.1.20060507
+ Nlm_InvertColors@Base 6.1.20060507
+ Nlm_InvertMode@Base 6.1.20060507
+ Nlm_InvertOval@Base 6.1.20060507
+ Nlm_InvertPoly@Base 6.1.20060507
+ Nlm_InvertQuadrant@Base 6.1.20060507
+ Nlm_InvertRect@Base 6.1.20060507
+ Nlm_InvertRgn@Base 6.1.20060507
+ Nlm_InvertRoundRect@Base 6.1.20060507
+ Nlm_IsLineInVPort@Base 6.1.20060507
+ Nlm_IsPlaying3D@Base 6.1.20060507
+ Nlm_IsPrim3DHlighted@Base 6.1.20060507
+ Nlm_IsRemoteDesktop@Base 6.1.20110713
+ Nlm_IsSeg3DHlighted@Base 6.1.20060507
+ Nlm_IsWindowDying@Base 6.1.20060507
+ Nlm_IsWindowModal@Base 6.1.20060507
+ Nlm_Isqrt@Base 6.1.20060507
+ Nlm_ItemIsVisible@Base 6.1.20060507
+ Nlm_JustInvalObject@Base 6.1.20060507
+ Nlm_JustSaveStringFromText@Base 6.1.20070822
+ Nlm_KeyboardView@Base 6.1.20060507
+ Nlm_KillSlateTimer@Base 6.1.20060507
+ Nlm_LaunchApp@Base 6.1.20060507
+ Nlm_LaunchAppEx@Base 6.1.20060507
+ Nlm_Leading@Base 6.1.20060507
+ Nlm_LeftRightSwitch@Base 6.1.20060507
+ Nlm_Light@Base 6.1.20060507
+ Nlm_LineHeight@Base 6.1.20060507
+ Nlm_LineIntoVPort@Base 6.1.20060507
+ Nlm_LineTo@Base 6.1.20060507
+ Nlm_LinkControls3D@Base 6.1.20060507
+ Nlm_LinkIn@Base 6.1.20060507
+ Nlm_LinkSegment@Base 6.1.20060507
+ Nlm_ListItem@Base 6.1.20060507
+ Nlm_LoadAction@Base 6.1.20060507
+ Nlm_LoadBox@Base 6.1.20060507
+ Nlm_LoadBoxData@Base 6.1.20060507
+ Nlm_LoadGraphicData@Base 6.1.20060507
+ Nlm_LoadImageBMP@Base 6.1.20060507
+ Nlm_LoadImageClip@Base 6.1.20060507
+ Nlm_LoadImageGIF@Base 6.1.20060507
+ Nlm_LoadPt@Base 6.1.20060507
+ Nlm_LoadRect@Base 6.1.20060507
+ Nlm_LoadRectRgn@Base 6.1.20060507
+ Nlm_LocalToGlobal@Base 6.1.20060507
+ Nlm_LockPixMapImage@Base 6.1.20060507
+ Nlm_LongToStr@Base 6.1.20060507
+ Nlm_LtGray@Base 6.1.20060507
+ Nlm_MAToViewer3D@Base 6.1.20060507
+ Nlm_Magenta@Base 6.1.20060507
+ Nlm_MakeEnumFieldAlistFromValNodeList@Base 6.1.20060507
+ Nlm_MapDefaultButton@Base 6.1.20060507
+ Nlm_MapDocPoint@Base 6.1.20060507
+ Nlm_MapDocPointEx@Base 6.1.20080302
+ Nlm_MapPixelPointToWorld@Base 6.1.20060507
+ Nlm_MapRectToWorldBox@Base 6.1.20060507
+ Nlm_MapViewerToWorld@Base 6.1.20060507
+ Nlm_MapWorldBoxToRect@Base 6.1.20060507
+ Nlm_MapWorldPointToPixel@Base 6.1.20060507
+ Nlm_MapWorldToViewer3D@Base 6.1.20060507
+ Nlm_MapWorldToViewer@Base 6.1.20060507
+ Nlm_MaxAlistWidths@Base 6.1.20060507
+ Nlm_MaxCharWidth@Base 6.1.20060507
+ Nlm_MaxStringWidths@Base 6.1.20060507
+ Nlm_Medium@Base 6.1.20060507
+ Nlm_MergeMode@Base 6.1.20060507
+ Nlm_Metronome@Base 6.1.20060507
+ Nlm_Minchou@Base 6.1.20060507
+ Nlm_MinchouFixed@Base 6.1.20060507
+ Nlm_ModalWindow@Base 6.1.20060507
+ Nlm_MouseButton@Base 6.1.20060507
+ Nlm_MousePosition@Base 6.1.20060507
+ Nlm_MovableModalWindow@Base 6.1.20060507
+ Nlm_MoveTo@Base 6.1.20060507
+ Nlm_MultiLinePrompt@Base 6.1.20060507
+ Nlm_MultiLinePromptEx@Base 6.1.20060507
+ Nlm_MultiList@Base 6.1.20060507
+ Nlm_NextLayer3D@Base 6.1.20060507
+ Nlm_NextPosition@Base 6.1.20060507
+ Nlm_NormalDisplay@Base 6.1.20060507
+ Nlm_NormalGroup@Base 6.1.20060507
+ Nlm_NormalSlate@Base 6.1.20060507
+ Nlm_NormalizeBox@Base 6.1.20060507
+ Nlm_ObjectRect@Base 6.1.20060507
+ Nlm_OffsetPrim@Base 6.1.20060507
+ Nlm_OffsetRect@Base 6.1.20060507
+ Nlm_OffsetRgn@Base 6.1.20060507
+ Nlm_OffsetSegment@Base 6.1.20060507
+ Nlm_OutsetBox@Base 6.1.20060507
+ Nlm_OverrideStdTranslations@Base 6.1.20060507
+ Nlm_PaintArc@Base 6.1.20060507
+ Nlm_PaintChar@Base 6.1.20060507
+ Nlm_PaintOval@Base 6.1.20060507
+ Nlm_PaintPoly@Base 6.1.20060507
+ Nlm_PaintQuadrant@Base 6.1.20060507
+ Nlm_PaintRect@Base 6.1.20060507
+ Nlm_PaintRgn@Base 6.1.20060507
+ Nlm_PaintRoundRect@Base 6.1.20060507
+ Nlm_PaintString@Base 6.1.20060507
+ Nlm_PaintStringEx@Base 6.1.20060507
+ Nlm_PaintText@Base 6.1.20060507
+ Nlm_PanelToViewer3D@Base 6.1.20060507
+ Nlm_Parent@Base 6.1.20060507
+ Nlm_ParentSegment@Base 6.1.20060507
+ Nlm_ParentWindow@Base 6.1.20060507
+ Nlm_ParentWindowMain@Base 6.1.20060507
+ Nlm_ParentWindowPort@Base 6.1.20060507
+ Nlm_ParentWindowPtr@Base 6.1.20060507
+ Nlm_ParentWindowShell@Base 6.1.20060507
+ Nlm_ParseFont@Base 6.1.20060507
+ Nlm_ParseFontEx@Base 6.1.20060507
+ Nlm_PassPanelClickToText@Base 6.1.20060507
+ Nlm_PasswordText@Base 6.1.20060507
+ Nlm_PasteText@Base 6.1.20060507
+ Nlm_PictureGrew@Base 6.1.20060507
+ Nlm_PictureHasEnlarged@Base 6.1.20060507
+ Nlm_PlainWindow@Base 6.1.20060507
+ Nlm_PlayLayer3D@Base 6.1.20060507
+ Nlm_PlusCursor@Base 6.1.20060507
+ Nlm_PoinTToPointTool@Base 6.1.20060507
+ Nlm_PointToolToPoinT@Base 6.1.20060507
+ Nlm_PointerToDialog@Base 6.1.20060507
+ Nlm_PointerToForm@Base 6.1.20060507
+ Nlm_PopupItem@Base 6.1.20060507
+ Nlm_PopupItems@Base 6.1.20060507
+ Nlm_PopupList@Base 6.1.20060507
+ Nlm_PopupListEx@Base 6.1.20170106
+ Nlm_PopupMenu@Base 6.1.20060507
+ Nlm_PopupParentWindow@Base 6.1.20060507
+ Nlm_PrevLayer3D@Base 6.1.20060507
+ Nlm_PrimitiveBox@Base 6.1.20060507
+ Nlm_PrimitiveIsCloseToPoint@Base 6.1.20060507
+ Nlm_PrintAllViewer@Base 6.1.20060507
+ Nlm_PrintDocument@Base 6.1.20060507
+ Nlm_PrintImage@Base 6.1.20060507
+ Nlm_PrintViewer@Base 6.1.20060507
+ Nlm_PrintingRect@Base 6.1.20060507
+ Nlm_ProcessAnEvent@Base 6.1.20060507
+ Nlm_ProcessEventOrIdle@Base 6.1.20060507
+ Nlm_ProcessEvents@Base 6.1.20060507
+ Nlm_ProcessExternalEvent@Base 6.1.20060507
+ Nlm_ProcessTimerEvent@Base 6.1.20060507
+ Nlm_ProcessUpdatesFirst@Base 6.1.20060507
+ Nlm_PtInRect@Base 6.1.20060507
+ Nlm_PtInRgn@Base 6.1.20060507
+ Nlm_PtrToStr@Base 6.1.20060507
+ Nlm_PulldownMenu@Base 6.1.20060507
+ Nlm_PushButton@Base 6.1.20060507
+ Nlm_PushButtonEx@Base 6.1.20170106
+ Nlm_QuitProgram@Base 6.1.20060507
+ Nlm_QuittingProgram@Base 6.1.20060507
+ Nlm_RadioButton@Base 6.1.20060507
+ Nlm_RadioButtonEx@Base 6.1.20170106
+ Nlm_ReadCard@Base 6.1.20060507
+ Nlm_ReadChar@Base 6.1.20060507
+ Nlm_ReadDouble@Base 6.1.20060507
+ Nlm_ReadField@Base 6.1.20060507
+ Nlm_ReadInt@Base 6.1.20060507
+ Nlm_ReadLine@Base 6.1.20060507
+ Nlm_ReadLong@Base 6.1.20060507
+ Nlm_ReadReal@Base 6.1.20060507
+ Nlm_ReadString@Base 6.1.20060507
+ Nlm_ReadText@Base 6.1.20060507
+ Nlm_RealToStr@Base 6.1.20060507
+ Nlm_RealizeWindow@Base 6.1.20060507
+ Nlm_RecTToRectTool@Base 6.1.20060507
+ Nlm_RecalculateSegment@Base 6.1.20060507
+ Nlm_RecordRect@Base 6.1.20060507
+ Nlm_RectInRect@Base 6.1.20060507
+ Nlm_RectInRgn@Base 6.1.20060507
+ Nlm_RectToolToRecT@Base 6.1.20060507
+ Nlm_Red@Base 6.1.20060507
+ Nlm_RedrawViewer3D@Base 6.1.20060507
+ Nlm_RegisterColumn@Base 6.1.20060507
+ Nlm_RegisterDropProc@Base 6.1.20060507
+ Nlm_RegisterFormMenuItemName@Base 6.1.20060507
+ Nlm_RegisterIO@Base 6.1.20060507
+ Nlm_RegisterRect@Base 6.1.20060507
+ Nlm_RegisterResultProc@Base 6.1.20060507
+ Nlm_RegisterRow@Base 6.1.20060507
+ Nlm_RegisterServiceProc@Base 6.1.20060507
+ Nlm_RegisterSlates@Base 6.1.20060507
+ Nlm_RegisterStdTranslations@Base 6.1.20060507
+ Nlm_RegisterTexts@Base 6.1.20060507
+ Nlm_RegisterWindows@Base 6.1.20060507
+ Nlm_ReleaseFolderTabButtons@Base 6.1.20120620
+ Nlm_Remove@Base 6.1.20060507
+ Nlm_RemoveDyingWindows@Base 6.1.20060507
+ Nlm_RemoveLink@Base 6.1.20060507
+ Nlm_RepeatButton@Base 6.1.20060507
+ Nlm_RepeatProcOnHandles@Base 6.1.20060507
+ Nlm_ReplaceItem@Base 6.1.20060507
+ Nlm_ReplaceText@Base 6.1.20060507
+ Nlm_Reset@Base 6.1.20060507
+ Nlm_ResetClip@Base 6.1.20060507
+ Nlm_ResetDrawingTools@Base 6.1.20060507
+ Nlm_ResetHighlight3D@Base 6.1.20060507
+ Nlm_ResetHighlight@Base 6.1.20060507
+ Nlm_ResetPicture3D@Base 6.1.20060507
+ Nlm_ResetSegment@Base 6.1.20060507
+ Nlm_ResetViewer@Base 6.1.20060507
+ Nlm_ResizableModalWindow@Base 6.1.20170106
+ Nlm_RestorePort@Base 6.1.20060507
+ Nlm_RestorePrimAttribute@Base 6.1.20060507
+ Nlm_RestrictMotifColorsTo@Base 6.1.20060507
+ Nlm_RoundWindow@Base 6.1.20060507
+ Nlm_RowIsVisible@Base 6.1.20060507
+ Nlm_SafeDisable@Base 6.1.20060507
+ Nlm_SafeEnable@Base 6.1.20060507
+ Nlm_SafeHide@Base 6.1.20060507
+ Nlm_SafeSetStatus@Base 6.1.20060507
+ Nlm_SafeSetTitle@Base 6.1.20060507
+ Nlm_SafeSetValue@Base 6.1.20060507
+ Nlm_SafeShow@Base 6.1.20060507
+ Nlm_SaveDocument@Base 6.1.20060507
+ Nlm_SaveDocumentItem@Base 6.1.20060507
+ Nlm_SaveGIF@Base 6.1.20060507
+ Nlm_SaveImageBMP@Base 6.1.20060507
+ Nlm_SaveImageClip@Base 6.1.20060507
+ Nlm_SaveImageGIF@Base 6.1.20060507
+ Nlm_SaveImagePNG@Base 6.1.20060507
+ Nlm_SavePort@Base 6.1.20060507
+ Nlm_SavePortIfNeeded@Base 6.1.20060507
+ Nlm_SaveStringFromText@Base 6.1.20060507
+ Nlm_SaveViewer3D@Base 6.1.20060507
+ Nlm_Scroll@Base 6.1.20060507
+ Nlm_ScrollBar4@Base 6.1.20060507
+ Nlm_ScrollBar@Base 6.1.20060507
+ Nlm_ScrollDisplay@Base 6.1.20060507
+ Nlm_ScrollRect@Base 6.1.20060507
+ Nlm_ScrollSlate@Base 6.1.20060507
+ Nlm_ScrollText@Base 6.1.20060507
+ Nlm_SearchSegment@Base 6.1.20060507
+ Nlm_SectRect@Base 6.1.20060507
+ Nlm_SectRgn@Base 6.1.20060507
+ Nlm_SegmentBox@Base 6.1.20060507
+ Nlm_SegmentID@Base 6.1.20060507
+ Nlm_SegmentStyle@Base 6.1.20060507
+ Nlm_SegmentVisible@Base 6.1.20060507
+ Nlm_Select@Base 6.1.20060507
+ Nlm_SelectColor@Base 6.1.20060507
+ Nlm_SelectFont@Base 6.1.20060507
+ Nlm_SelectText@Base 6.1.20060507
+ Nlm_SendMessageToDialog@Base 6.1.20060507
+ Nlm_SendMessageToForm@Base 6.1.20060507
+ Nlm_SeparatorItem@Base 6.1.20060507
+ Nlm_Set3DColorMap@Base 6.1.20060507
+ Nlm_SetAction@Base 6.1.20060507
+ Nlm_SetActivate@Base 6.1.20060507
+ Nlm_SetAdjust3D@Base 6.1.20060507
+ Nlm_SetBackground3D@Base 6.1.20060507
+ Nlm_SetBarAnomaly@Base 6.1.20060507
+ Nlm_SetBarMax@Base 6.1.20060507
+ Nlm_SetBarValue@Base 6.1.20060507
+ Nlm_SetBoxData@Base 6.1.20060507
+ Nlm_SetButtonAction@Base 6.1.20160908
+ Nlm_SetButtonDefault@Base 6.1.20060507
+ Nlm_SetChild@Base 6.1.20060507
+ Nlm_SetClose@Base 6.1.20060507
+ Nlm_SetColor3D@Base 6.1.20060507
+ Nlm_SetColor@Base 6.1.20060507
+ Nlm_SetColorCell@Base 6.1.20060507
+ Nlm_SetColorEx@Base 6.1.20060507
+ Nlm_SetColorImage@Base 6.1.20060507
+ Nlm_SetColorMap@Base 6.1.20060507
+ Nlm_SetCurrentGIF@Base 6.1.20060507
+ Nlm_SetCursorShape@Base 6.1.20060507
+ Nlm_SetDeactivate@Base 6.1.20060507
+ Nlm_SetDefArrowSize@Base 6.1.20060507
+ Nlm_SetDialogActnProc@Base 6.1.20090301
+ Nlm_SetDocAutoAdjust@Base 6.1.20060507
+ Nlm_SetDocCache@Base 6.1.20060507
+ Nlm_SetDocData@Base 6.1.20060507
+ Nlm_SetDocDefaults@Base 6.1.20060507
+ Nlm_SetDocExtra@Base 6.1.20060507
+ Nlm_SetDocHighlight@Base 6.1.20060507
+ Nlm_SetDocNotify@Base 6.1.20060507
+ Nlm_SetDocProcs@Base 6.1.20060507
+ Nlm_SetDocShade@Base 6.1.20060507
+ Nlm_SetDocSimpleMode@Base 6.1.20060507
+ Nlm_SetDocTabstops@Base 6.1.20060507
+ Nlm_SetEnabled@Base 6.1.20060507
+ Nlm_SetEnumPopup@Base 6.1.20060507
+ Nlm_SetEnumPopupByName@Base 6.1.20060507
+ Nlm_SetExtraData@Base 6.1.20060507
+ Nlm_SetFolderTabButton@Base 6.1.20120620
+ Nlm_SetFolderTabSubclass@Base 6.1.20060507
+ Nlm_SetFolderTabTitle@Base 6.1.20120620
+ Nlm_SetFolderTabValue@Base 6.1.20060507
+ Nlm_SetFormActnProc@Base 6.1.20060507
+ Nlm_SetFormMenuItem@Base 6.1.20060507
+ Nlm_SetGraphicData@Base 6.1.20060507
+ Nlm_SetGroupMargins@Base 6.1.20060507
+ Nlm_SetGroupSpacing@Base 6.1.20060507
+ Nlm_SetHLColor3D@Base 6.1.20060507
+ Nlm_SetItemStatus@Base 6.1.20060507
+ Nlm_SetItemTitle@Base 6.1.20060507
+ Nlm_SetKeepCrNlTextFieldCallback@Base 6.1.20060507
+ Nlm_SetLargeFont@Base 6.1.20060507
+ Nlm_SetLayer3D@Base 6.1.20060507
+ Nlm_SetLayerTop3D@Base 6.1.20060507
+ Nlm_SetMediumFont@Base 6.1.20060507
+ Nlm_SetMenuAction@Base 6.1.20160908
+ Nlm_SetModalWindowOwner@Base 6.1.20060507
+ Nlm_SetMotifWindowName@Base 6.1.20060507
+ Nlm_SetMouseMoveCallback@Base 6.1.20060507
+ Nlm_SetMouseMoveRegion@Base 6.1.20060507
+ Nlm_SetNext@Base 6.1.20060507
+ Nlm_SetNextPosition@Base 6.1.20060507
+ Nlm_SetOGLContext@Base 6.1.20060507
+ Nlm_SetObject@Base 6.1.20060507
+ Nlm_SetObjectExtra@Base 6.1.20060507
+ Nlm_SetOffset@Base 6.1.20060507
+ Nlm_SetPanelClick@Base 6.1.20060507
+ Nlm_SetPanelExtra@Base 6.1.20060507
+ Nlm_SetParent@Base 6.1.20060507
+ Nlm_SetPen@Base 6.1.20060507
+ Nlm_SetPenDash@Base 6.1.20060507
+ Nlm_SetPenPattern@Base 6.1.20060507
+ Nlm_SetPenWidth@Base 6.1.20080302
+ Nlm_SetPosition3D@Base 6.1.20060507
+ Nlm_SetPosition@Base 6.1.20060507
+ Nlm_SetPrimAttribute@Base 6.1.20060507
+ Nlm_SetPrimitiveIDs@Base 6.1.20060507
+ Nlm_SetRange@Base 6.1.20060507
+ Nlm_SetRealized@Base 6.1.20060507
+ Nlm_SetRect@Base 6.1.20060507
+ Nlm_SetResize@Base 6.1.20060507
+ Nlm_SetScrlParams4@Base 6.1.20061015
+ Nlm_SetScrollTextOffset4@Base 6.1.20061015
+ Nlm_SetSegmentVisibleFlag@Base 6.1.20060507
+ Nlm_SetSlateBorder@Base 6.1.20060507
+ Nlm_SetSlateChar@Base 6.1.20060507
+ Nlm_SetSlatePolicy@Base 6.1.20060507
+ Nlm_SetSmallFont@Base 6.1.20060507
+ Nlm_SetStatus@Base 6.1.20060507
+ Nlm_SetStdMouse3D@Base 6.1.20060507
+ Nlm_SetString@Base 6.1.20060507
+ Nlm_SetSwitchMax@Base 6.1.20060507
+ Nlm_SetSwitchParams@Base 6.1.20060507
+ Nlm_SetTextColor@Base 6.1.20060507
+ Nlm_SetTextCursorBlinkRate@Base 6.1.20060507
+ Nlm_SetTextCursorPos@Base 6.1.20060507
+ Nlm_SetTextEditable@Base 6.1.20060507
+ Nlm_SetTextFromVnp@Base 6.1.20060507
+ Nlm_SetTextSelect@Base 6.1.20060507
+ Nlm_SetTitle@Base 6.1.20060507
+ Nlm_SetUpDrawingTools@Base 6.1.20060507
+ Nlm_SetValue@Base 6.1.20060507
+ Nlm_SetViewerData@Base 6.1.20060507
+ Nlm_SetViewerProcs@Base 6.1.20060507
+ Nlm_SetVisible@Base 6.1.20060507
+ Nlm_SetWindowCharDisplay@Base 6.1.20060507
+ Nlm_SetWindowConfigureCallback@Base 6.1.20060507
+ Nlm_SetWindowDefaultButton@Base 6.1.20060507
+ Nlm_SetWindowExtra@Base 6.1.20060507
+ Nlm_SetWindowMenuBar@Base 6.1.20060507
+ Nlm_SetWindowTimer@Base 6.1.20060507
+ Nlm_ShadowWindow@Base 6.1.20060507
+ Nlm_Show@Base 6.1.20060507
+ Nlm_ShowSegment@Base 6.1.20060507
+ Nlm_SimplePanel@Base 6.1.20060507
+ Nlm_SingleList@Base 6.1.20060507
+ Nlm_Solid@Base 6.1.20060507
+ Nlm_SortEnumFieldAlist@Base 6.1.20060507
+ Nlm_SpecialText@Base 6.1.20060507
+ Nlm_SpecialTextWithFont@Base 6.1.20120620
+ Nlm_StartPage@Base 6.1.20060507
+ Nlm_StartPicture@Base 6.1.20060507
+ Nlm_StartPlaying3D@Base 6.1.20060507
+ Nlm_StartPrinting@Base 6.1.20060507
+ Nlm_StaticPrompt@Base 6.1.20060507
+ Nlm_StatusItem@Base 6.1.20060507
+ Nlm_StdAcceptFormButtonProc@Base 6.1.20060507
+ Nlm_StdCancelButtonProc@Base 6.1.20060507
+ Nlm_StdCleanupExtraProc@Base 6.1.20060507
+ Nlm_StdCleanupFormProc@Base 6.1.20060507
+ Nlm_StdCloseWindowProc@Base 6.1.20060507
+ Nlm_StdCopyTextProc@Base 6.1.20060507
+ Nlm_StdCutTextProc@Base 6.1.20060507
+ Nlm_StdDeleteTextProc@Base 6.1.20060507
+ Nlm_StdGetDocCache@Base 6.1.20060507
+ Nlm_StdPasteTextProc@Base 6.1.20060507
+ Nlm_StdPutDocCache@Base 6.1.20060507
+ Nlm_StdResetDocCache@Base 6.1.20060507
+ Nlm_StdSendAcceptButtonMessageProc@Base 6.1.20060507
+ Nlm_StdSendCancelButtonMessageProc@Base 6.1.20060507
+ Nlm_StdSendCloseWindowMessageProc@Base 6.1.20060507
+ Nlm_StopPlaying3D@Base 6.1.20060507
+ Nlm_StrToCard@Base 6.1.20060507
+ Nlm_StrToDouble@Base 6.1.20060507
+ Nlm_StrToFontSpec@Base 6.1.20060507
+ Nlm_StrToInt@Base 6.1.20060507
+ Nlm_StrToLong@Base 6.1.20060507
+ Nlm_StrToPtr@Base 6.1.20060507
+ Nlm_StrToReal@Base 6.1.20060507
+ Nlm_StringToClipboard@Base 6.1.20060507
+ Nlm_StringWidth@Base 6.1.20060507
+ Nlm_StrngCat@Base 6.1.20060507
+ Nlm_StrngCmp@Base 6.1.20060507
+ Nlm_StrngCpy@Base 6.1.20060507
+ Nlm_StrngEql@Base 6.1.20060507
+ Nlm_StrngLen@Base 6.1.20060507
+ Nlm_StrngPos@Base 6.1.20060507
+ Nlm_StrngPrintable@Base 6.1.20060507
+ Nlm_StrngRep@Base 6.1.20060507
+ Nlm_StrngSeg@Base 6.1.20060507
+ Nlm_SubMenu@Base 6.1.20060507
+ Nlm_SubPt@Base 6.1.20060507
+ Nlm_SymblCmp@Base 6.1.20060507
+ Nlm_Symbol@Base 6.1.20060507
+ Nlm_TestDialog@Base 6.1.20060507
+ Nlm_TestForm@Base 6.1.20060507
+ Nlm_TextHasNoText@Base 6.1.20060507
+ Nlm_TextLength@Base 6.1.20060507
+ Nlm_TextSelectionRange@Base 6.1.20060507
+ Nlm_TextWidth@Base 6.1.20060507
+ Nlm_Times@Base 6.1.20060507
+ Nlm_TryGetPrimitiveLimits@Base 6.1.20060507
+ Nlm_TryHighlightPrimitive@Base 6.1.20060507
+ Nlm_TryOffsetPrimitive@Base 6.1.20060507
+ Nlm_UnionRect@Base 6.1.20060507
+ Nlm_UnionRgn@Base 6.1.20060507
+ Nlm_UnlinkSegment@Base 6.1.20060507
+ Nlm_UnloadSegment@Base 6.1.20060507
+ Nlm_UnlockPixMapImage@Base 6.1.20060507
+ Nlm_UnregisterIO@Base 6.1.20060507
+ Nlm_UpDownSwitch@Base 6.1.20060507
+ Nlm_Update@Base 6.1.20060507
+ Nlm_UpdateColFmt@Base 6.1.20060507
+ Nlm_UpdateColorTable@Base 6.1.20060507
+ Nlm_UpdateDocument@Base 6.1.20060507
+ Nlm_UpdateGver@Base 6.1.20060507
+ Nlm_UpsetRect@Base 6.1.20060507
+ Nlm_UseFullScreen@Base 6.1.20060507
+ Nlm_UseLeftScreen@Base 6.1.20060507
+ Nlm_UsePrimaryMonitor@Base 6.1.20060507
+ Nlm_UseRightScreen@Base 6.1.20060507
+ Nlm_UseWindow@Base 6.1.20060507
+ Nlm_UsingWindow@Base 6.1.20060507
+ Nlm_ValidRect@Base 6.1.20060507
+ Nlm_ValidRgn@Base 6.1.20060507
+ Nlm_Version@Base 6.1.20060507
+ Nlm_VertScrollBar4@Base 6.1.20060507
+ Nlm_VertScrollBar@Base 6.1.20060507
+ Nlm_VibMainFinale@Base 6.1.20070822
+ Nlm_VibMainPrelude@Base 6.1.20070822
+ Nlm_VibrantDefaultColormap@Base 6.1.20060507
+ Nlm_VibrantDefaultDepth@Base 6.1.20060507
+ Nlm_VibrantDefaultVisual@Base 6.1.20060507
+ Nlm_VibrantIsGUI@Base 6.1.20060507
+ Nlm_VibrantSetGUI@Base 6.1.20060507
+ Nlm_ViewerBox@Base 6.1.20060507
+ Nlm_ViewerWasResized@Base 6.1.20060507
+ Nlm_VirtualSlate@Base 6.1.20060507
+ Nlm_Visible@Base 6.1.20060507
+ Nlm_WaitForXEvent@Base 6.1.20060507
+ Nlm_WatchCursor@Base 6.1.20060507
+ Nlm_WhereInEnumPopup@Base 6.1.20060507
+ Nlm_WhichWindow@Base 6.1.20060507
+ Nlm_White@Base 6.1.20060507
+ Nlm_WidePen@Base 6.1.20060507
+ Nlm_WidestAlist@Base 6.1.20060507
+ Nlm_WidestString@Base 6.1.20060507
+ Nlm_WindowFrameGroup@Base 6.1.20060507
+ Nlm_WindowHasBeenShown@Base 6.1.20060507
+ Nlm_WriteCard@Base 6.1.20060507
+ Nlm_WriteChar@Base 6.1.20060507
+ Nlm_WriteDouble@Base 6.1.20060507
+ Nlm_WriteInt@Base 6.1.20060507
+ Nlm_WriteLn@Base 6.1.20060507
+ Nlm_WriteLog@Base 6.1.20060507
+ Nlm_WriteLong@Base 6.1.20060507
+ Nlm_WriteReal@Base 6.1.20060507
+ Nlm_WriteString@Base 6.1.20060507
+ Nlm_WriteText@Base 6.1.20060507
+ Nlm_XAllocColor@Base 6.1.20060507
+ Nlm_XLoadQueryFont@Base 6.1.20060507
+ Nlm_XLoadStandardFont@Base 6.1.20060507
+ Nlm_XOffset@Base 6.1.20060507
+ Nlm_XSetForeground@Base 6.1.20060507
+ Nlm_XbackColor@Base 6.1.20060507
+ Nlm_XfontList@Base 6.1.20060507
+ Nlm_XforeColor@Base 6.1.20060507
+ Nlm_XorRgn@Base 6.1.20060507
+ Nlm_XrmGetResource@Base 6.1.20060507
+ Nlm_YOffset@Base 6.1.20060507
+ Nlm_Yellow@Base 6.1.20060507
+ Nlm_ZoomAll3D@Base 6.1.20060507
+ Nlm_appContext@Base 6.1.20060507
+ Nlm_clpRgn@Base 6.1.20060507
+ Nlm_cmmdKey@Base 6.1.20060507
+ Nlm_ctrlKey@Base 6.1.20060507
+ Nlm_currentCursor@Base 6.1.20060507
+ Nlm_currentEvent@Base 6.1.20060507
+ Nlm_currentKey@Base 6.1.20060507
+ Nlm_currentWindowTool@Base 6.1.20060507
+ Nlm_currentXDisplay@Base 6.1.20060507
+ Nlm_currentXGC@Base 6.1.20060507
+ Nlm_currentXScreen@Base 6.1.20060507
+ Nlm_currentXWindow@Base 6.1.20060507
+ Nlm_dblClick@Base 6.1.20060507
+ Nlm_desktopWindow@Base 6.1.20060507
+ Nlm_dialogTextHeight@Base 6.1.20060507
+ Nlm_fileDialogShell@Base 6.1.20060507
+ Nlm_fileDone@Base 6.1.20060507
+ Nlm_fileError@Base 6.1.20060507
+ Nlm_folderTabProcs@Base 6.1.20060507
+ Nlm_globalMouse@Base 6.1.20060507
+ Nlm_hScrollBarHeight@Base 6.1.20060507
+ Nlm_hasColor@Base 6.1.20060507
+ Nlm_internalMenuBarHeight@Base 6.1.20060507
+ Nlm_isPrimInWindow@Base 6.1.20060507
+ Nlm_largeFont@Base 6.1.20060507
+ Nlm_localMouse@Base 6.1.20060507
+ Nlm_mediumFont@Base 6.1.20060507
+ Nlm_nextIdNumber@Base 6.1.20060507
+ Nlm_nowPrinting@Base 6.1.20060507
+ Nlm_optKey@Base 6.1.20060507
+ Nlm_popupMenuHeight@Base 6.1.20060507
+ Nlm_processUpdatesFirstVal@Base 6.1.20060507
+ Nlm_programFont@Base 6.1.20060507
+ Nlm_screenRect@Base 6.1.20060507
+ Nlm_shftKey@Base 6.1.20060507
+ Nlm_smallFont@Base 6.1.20060507
+ Nlm_stCon@Base 6.1.20060507
+ Nlm_stdAscent@Base 6.1.20060507
+ Nlm_stdCharWidth@Base 6.1.20060507
+ Nlm_stdDescent@Base 6.1.20060507
+ Nlm_stdFontHeight@Base 6.1.20060507
+ Nlm_stdLeading@Base 6.1.20060507
+ Nlm_stdLineHeight@Base 6.1.20060507
+ Nlm_systemFont@Base 6.1.20060507
+ Nlm_systemWindow@Base 6.1.20060507
+ Nlm_termCH@Base 6.1.20060507
+ Nlm_textScrapFull@Base 6.1.20060507
+ Nlm_theWindow@Base 6.1.20060507
+ Nlm_updateRect@Base 6.1.20060507
+ Nlm_updateRgn@Base 6.1.20060507
+ Nlm_usesMacNavServices@Base 6.1.20060507
+ Nlm_vScrollBarWidth@Base 6.1.20060507
+ OGL_AddBrick3D@Base 6.1.20060507
+ OGL_AddCylinder3D@Base 6.1.20060507
+ OGL_AddLine3D@Base 6.1.20060507
+ OGL_AddQuad3D@Base 6.1.20060507
+ OGL_AddSphere3D@Base 6.1.20060507
+ OGL_AddText3D@Base 6.1.20060507
+ OGL_AddTri3D@Base 6.1.20060507
+ OGL_AllLayerOnProc@Base 6.1.20060507
+ OGL_ClearBoundBox@Base 6.1.20060507
+ OGL_ClearOGL_Data@Base 6.1.20060507
+ OGL_ClearTransparentSpheres@Base 6.1.20060507
+ OGL_CreateCTransform@Base 6.1.20060507
+ OGL_CreateViewer@Base 6.1.20060507
+ OGL_CrossProduct@Base 6.1.20060507
+ OGL_DistCompareFunc@Base 6.1.20060507
+ OGL_DrawLogo@Base 6.1.20060507
+ OGL_DrawViewer3D@Base 6.1.20060507
+ OGL_End@Base 6.1.20060507
+ OGL_GetLayer@Base 6.1.20060507
+ OGL_Hit@Base 6.1.20060507
+ OGL_InitializeLists@Base 6.1.20060507
+ OGL_IsPlaying@Base 6.1.20060507
+ OGL_LoadName@Base 6.1.20060507
+ OGL_MakeNormal@Base 6.1.20060507
+ OGL_NextLayerProc@Base 6.1.20060507
+ OGL_Normalize@Base 6.1.20060507
+ OGL_Play@Base 6.1.20060507
+ OGL_PopTransformation@Base 6.1.20060507
+ OGL_PrevLayerProc@Base 6.1.20060507
+ OGL_PushTransformation@Base 6.1.20060507
+ OGL_Reset@Base 6.1.20060507
+ OGL_RewindLayerProc@Base 6.1.20060507
+ OGL_SearchPaletteIndex@Base 6.1.20060507
+ OGL_Select@Base 6.1.20060507
+ OGL_SetColor@Base 6.1.20060507
+ OGL_SetLayer@Base 6.1.20060507
+ OGL_SetLayerTop3D@Base 6.1.20060507
+ OGL_SetLayers@Base 6.1.20060507
+ OGL_SetPosition3D@Base 6.1.20060507
+ OGL_SetSelectPoint@Base 6.1.20060507
+ OGL_Start@Base 6.1.20060507
+ OGL_StartPlaying@Base 6.1.20060507
+ OGL_StopPlaying@Base 6.1.20060507
+ OGL_XErrorHandler@Base 6.1.20060507
+ OGL_ZoomIn@Base 6.1.20060507
+ OGL_ZoomOut@Base 6.1.20060507
+ OwnerDrawLbox_AddItem@Base 6.1.20060507
+ OwnerDrawLbox_Create@Base 6.1.20060507
+ OwnerDrawLbox_GetCurData@Base 6.1.20060507
+ OwnerDrawLbox_GetCurSel@Base 6.1.20060507
+ OwnerDrawLbox_GetData@Base 6.1.20060507
+ OwnerDrawLbox_GetNentry@Base 6.1.20060507
+ OwnerDrawLbox_MoveWindow@Base 6.1.20060507
+ OwnerDrawLbox_ResetLBContent@Base 6.1.20060507
+ OwnerDrawLbox_SelectItem@Base 6.1.20060507
+ PaletteNumItems@Base 6.1.20060507
+ PalettePanel@Base 6.1.20060507
+ RED_COLOR@Base 6.1.20060507
+ RecordColumn@Base 6.1.20060507
+ ReplaceTagListColumn@Base 6.1.20060507
+ SetOGLFont@Base 6.1.20060507
+ SetPaletteValue@Base 6.1.20060507
+ SetTableBlockGray@Base 6.1.20060507
+ SetTableBlockHilight@Base 6.1.20060507
+ SetTableGray@Base 6.1.20060507
+ SetTableHilight@Base 6.1.20060507
+ TableNumLines@Base 6.1.20060507
+ TablePanel@Base 6.1.20060507
+ TableTextLength@Base 6.1.20060507
+ TableVisLines@Base 6.1.20060507
+ UpdateTagListPopupChoices@Base 6.1.20060507
+ VRML_AddCylinder3D@Base 6.1.20060507
+ VRML_AddSphere3D@Base 6.1.20060507
+ VRML_ColorToString@Base 6.1.20060507
+ WHITE_COLOR@Base 6.1.20060507
+ YELLOW_COLOR@Base 6.1.20060507
+ blackAttPData@Base 6.1.20060507
+ defFallbackRes@Base 6.1.20060507
+ ilst_add@Base 6.1.20060507
+ ilst_draw@Base 6.1.20060507
+ ilst_free@Base 6.1.20060507
+ ilst_new@Base 6.1.20060507
+ ilst_remove@Base 6.1.20060507
+ ilst_replace@Base 6.1.20060507
+ ilst_size@Base 6.1.20060507
+ main@Base 6.1.20060507
+ okayToDrawContents@Base 6.1.20060507
+ structControls3D@Base 6.1.20060507
+ tview_closeSubtree@Base 6.1.20060507
+ tview_create@Base 6.1.20060507
+ tview_createCustom@Base 6.1.20060507
+ tview_delete@Base 6.1.20060507
+ tview_disable@Base 6.1.20060507
+ tview_distanceCmp@Base 6.1.20060507
+ tview_enable@Base 6.1.20060507
+ tview_getSelected@Base 6.1.20060507
+ tview_getTreePtr@Base 6.1.20060507
+ tview_hide@Base 6.1.20060507
+ tview_labelCmp@Base 6.1.20060507
+ tview_moveRoot@Base 6.1.20060507
+ tview_openSubtree@Base 6.1.20060507
+ tview_redraw@Base 6.1.20060507
+ tview_resize@Base 6.1.20060507
+ tview_selectNode@Base 6.1.20060507
+ tview_setCtrlClickFunc@Base 6.1.20060507
+ tview_setDblClickFunc@Base 6.1.20060507
+ tview_setEventHandler@Base 6.1.20060507
+ tview_setLineColor@Base 6.1.20060507
+ tview_setNodeCmpFunc@Base 6.1.20060507
+ tview_setPlusColor@Base 6.1.20060507
+ tview_setSelBGColor@Base 6.1.20060507
+ tview_setSelFGColor@Base 6.1.20060507
+ tview_setShiftClickFunc@Base 6.1.20060507
+ tview_setTextColor@Base 6.1.20060507
+ tview_show@Base 6.1.20060507
+ tview_showSelected@Base 6.1.20060507
+ whiteAttPData@Base 6.1.20060507
+ write_row_callback@Base 6.1.20060507
diff --git a/debian/makemenu b/debian/makemenu
new file mode 100644
index 00000000..8f8de0b6
--- /dev/null
+++ b/debian/makemenu
@@ -0,0 +1,66 @@
+#!/bin/sh
+if [ "x$1" = "x-v" ]; then
+ vibrate=true
+ shift
+else
+ vibrate=false
+fi
+package=`basename $1 .install`
+if [ $vibrate = true ]; then
+ packages="libvibrant6b,$package"
+else
+ packages=$package
+fi
+menu=`echo $1 | sed -e 's/install$/menu/'`
+while read command junk; do
+ case $command in
+ */bin/*) ;;
+ * ) continue ;;
+ esac
+ case $package in
+ libncbi6-dev) section="Applications/Programming" ;;
+ * ) section="Applications/Science/Biology" ;;
+ esac
+ case $command in
+ # Doesn't use requisite argument-handling framework
+ */ncbisort) continue ;;
+ */Nentrez ) title=Entrez ;;
+ */Psequin ) title=Sequin ;;
+ */netentcf) title="Entrez net config" ;;
+ * ) title=`basename $command` ;;
+ esac
+ icondir=/usr/share/pixmaps
+ case $command in
+ */asntool) icon=$icondir/asntool.xpm ;;
+ *) icon=$icondir/ncbilogo.xpm ;;
+ esac
+ if [ $vibrate = true ]; then
+ command="usr/bin/vibrate /$command"
+ else
+ # generate an XDG .desktop file too
+ apps=debian/$package/usr/share/applications
+ base=`basename $command`
+ if test -f debian/$base.desktop.in; then
+ mkdir -p $apps
+ cat >$apps/$base.desktop <<EOF
+[Desktop Entry]
+Version=1.0
+EOF
+ cat debian/$base.desktop.in >> $apps/$base.desktop
+ cat >>$apps/$base.desktop <<EOF
+Type=Application
+Exec=$base
+Icon=ncbilogo
+Categories=Education;Science;Biology;
+EOF
+ continue
+ else
+ echo "$0: Warning: No .desktop information for $base" >&2
+ fi
+ fi
+ cat <<EOF
+?package($packages):command="/$command" needs="X11" \\
+ section="$section" title="$title" icon="$icon"
+EOF
+done < "$1" > "$menu"
+[ -s "$menu" ] || rm $menu
diff --git a/debian/man/Cn3D-3.0.1 b/debian/man/Cn3D-3.0.1
new file mode 100644
index 00000000..0eb59cd3
--- /dev/null
+++ b/debian/man/Cn3D-3.0.1
@@ -0,0 +1,26 @@
+.TH CN3D 1 2001-10-05 NCBI "NCBI Tools User's Manual"
+.SH NAME
+Cn3D \- a 3-dimensional viewer for biological molecules
+.SH SYNOPSIS
+.B Cn3D
+[\|\fIfilename\fP\|]
+.SH DESCRIPTION
+This manual page documents briefly the \fBCn3D\fP command.
+This manual page was written for the Debian GNU/Linux distribution
+because the original program does not have a manual page.
+.PP
+\fBCn3D\fP is a helper application for your web browser that allows
+you to view 3-dimensional structures from NCBI's Entrez retrieval
+service.
+.SH OPTIONS
+.TP
+\fIfilename\fP
+Initially display the data in \fIfilename\fP.
+.SH AUTHOR
+This manual page was written by Aaron M. Ucko <ucko@debian.org>,
+for the Debian GNU/Linux system (but may be used by others).
+.SH SEE ALSO
+.ad l
+.BR ddv (1),
+.BR udv (1),
+<http://www.ncbi.nlm.nih.gov/Structure/CN3D/cn3d.shtml>
diff --git a/debian/man/vibrate.1 b/debian/man/vibrate.1
new file mode 100644
index 00000000..3ee36dd7
--- /dev/null
+++ b/debian/man/vibrate.1
@@ -0,0 +1,21 @@
+.TH VIBRATE 1 2001-10-05 Debian "NCBI Tools User's Manual"
+.SH NAME
+vibrate \- run a program with the Vibrant library preloaded
+.SH SYNOPSIS
+.B vibrate
+[\|\fB\-\-help\fP\|]
+.PP
+.B vibrate
+\fIprogram\fP
+[\|\fIarguments\fP\|]
+.SH DESCRIPTION
+\fBvibrate\fP runs the specified program, which presumably uses the
+NCBI C toolkit, with the Vibrant library preloaded. The main effect
+of this preloading is that omitting arguments produces a dialog box
+for setting parameters rather than a usage message.
+.SH OPTIONS
+.TP
+\fB\-\-help\fP
+Print usage message and exit.
+.SH AUTHOR
+Aaron M. Ucko <ucko@debian.org>
diff --git a/debian/ncbi-cn3d.install b/debian/ncbi-cn3d.install
new file mode 100644
index 00000000..e4ec6b9a
--- /dev/null
+++ b/debian/ncbi-cn3d.install
@@ -0,0 +1 @@
+usr/bin/Cn3D-3.0
diff --git a/debian/ncbi-cn3d.mime b/debian/ncbi-cn3d.mime
new file mode 100644
index 00000000..1ff8905a
--- /dev/null
+++ b/debian/ncbi-cn3d.mime
@@ -0,0 +1,2 @@
+chemical/ncbi-asn1-binary; viewer=/usr/bin/Cn3D-3.0 %s; test=test -n "$DISPLAY"
+chemical/ncbi-asn1-text; viewer=/usr/bin/Cn3D-3.0 %s; test=test -n "$DISPLAY"
diff --git a/debian/ncbi-cn3d.postinst b/debian/ncbi-cn3d.postinst
new file mode 100644
index 00000000..2080f0a6
--- /dev/null
+++ b/debian/ncbi-cn3d.postinst
@@ -0,0 +1,8 @@
+#!/bin/sh -e
+
+update-alternatives --install \
+ /usr/bin/Cn3D Cn3D /usr/bin/Cn3D-3.0 30 \
+ --slave /usr/share/man/man1/Cn3D.1.gz Cn3D.1.gz \
+ /usr/share/man/man1/Cn3D-3.0.1.gz
+
+#DEBHELPER#
diff --git a/debian/ncbi-cn3d.prerm b/debian/ncbi-cn3d.prerm
new file mode 100644
index 00000000..935e1ff1
--- /dev/null
+++ b/debian/ncbi-cn3d.prerm
@@ -0,0 +1,5 @@
+#!/bin/sh -e
+
+update-alternatives --remove Cn3D /usr/bin/Cn3D-3.0
+
+#DEBHELPER#
diff --git a/debian/ncbi-tools-bin.docs b/debian/ncbi-tools-bin.docs
new file mode 100644
index 00000000..4d41115e
--- /dev/null
+++ b/debian/ncbi-tools-bin.docs
@@ -0,0 +1,8 @@
+doc/README.asn2xml
+doc/gene2xml.txt
+doc/tbl2asn.txt
+debian/README.test
+debian/tests/run-unit-test
+debian/tests/test-data
+asn/asnpub.all
+demo/medline.prt
diff --git a/debian/ncbi-tools-bin.examples b/debian/ncbi-tools-bin.examples
new file mode 100644
index 00000000..e0b4dcdc
--- /dev/null
+++ b/debian/ncbi-tools-bin.examples
@@ -0,0 +1,2 @@
+demo/*tbl*.??
+demo/rast*.sh
diff --git a/debian/ncbi-tools-bin.install b/debian/ncbi-tools-bin.install
new file mode 100644
index 00000000..ddf0d292
--- /dev/null
+++ b/debian/ncbi-tools-bin.install
@@ -0,0 +1,36 @@
+usr/bin/asn2all
+usr/bin/asn2asn
+usr/bin/asn2ff
+usr/bin/asn2fsa
+usr/bin/asn2gb
+usr/bin/asn2idx
+usr/bin/asn2xml
+usr/bin/asndhuff
+usr/bin/asndisc
+usr/bin/asnmacro
+usr/bin/asntool
+usr/bin/asnval
+usr/bin/checksub
+usr/bin/cleanasn
+usr/bin/debruijn
+usr/bin/errhdr
+usr/bin/fa2htgs
+usr/bin/findspl
+usr/bin/gbseqget
+usr/bin/gene2xml
+usr/bin/getmesh
+usr/bin/getpub
+usr/bin/gil2bin
+usr/bin/idfetch
+usr/bin/indexpub
+usr/bin/insdseqget
+usr/bin/makeset
+usr/bin/nps2gps
+usr/bin/sortbyquote
+usr/bin/spidey
+usr/bin/subfuse
+usr/bin/taxblast
+usr/bin/tbl2asn
+usr/bin/trna2sap
+usr/bin/trna2tbl
+usr/bin/vecscreen
diff --git a/debian/ncbi-tools-bin.lintian-overrides b/debian/ncbi-tools-bin.lintian-overrides
new file mode 100644
index 00000000..05098179
--- /dev/null
+++ b/debian/ncbi-tools-bin.lintian-overrides
@@ -0,0 +1,2 @@
+ncbi-tools-bin: menu-icon-missing usr/share/pixmaps/asntool.xpm
+ncbi-tools-bin: menu-icon-missing usr/share/pixmaps/ncbilogo.xpm
diff --git a/debian/ncbi-tools-x11.doc-base.firewall b/debian/ncbi-tools-x11.doc-base.firewall
new file mode 100644
index 00000000..a68c52ba
--- /dev/null
+++ b/debian/ncbi-tools-x11.doc-base.firewall
@@ -0,0 +1,11 @@
+Document: ncbi-tools-firewall
+Title: Connecting to Network Entrez through a firewall
+Author: The National Center for Biotechnology Information
+Abstract: Some NCBI applications may need to be explicitly configured
+ to access NCBI network resources. This document explains how to do
+ that, even when there is a firewall in between.
+Section: System/Administration
+
+Format: HTML
+Index: /usr/share/doc/ncbi-tools-x11/firewall.html
+Files: /usr/share/doc/ncbi-tools-x11/fire*
diff --git a/debian/ncbi-tools-x11.doc-base.sequin b/debian/ncbi-tools-x11.doc-base.sequin
new file mode 100644
index 00000000..14ec8d84
--- /dev/null
+++ b/debian/ncbi-tools-x11.doc-base.sequin
@@ -0,0 +1,15 @@
+Document: sequin
+Title: Sequin Quick Guide
+Author: Jonathan Kans, Colombe Chappey, Jinghui Zhang, Tatiana
+ Tatusov, and James Ostell
+Abstract: Sequin is a program designed to aid in the submission of
+ sequences to the GenBank, EMBL, and DDBJ sequence databases. It was
+ written at the National Center for Biotechnology Information, part of
+ the National Library of Medicine at the National Institutes of
+ Health.
+Section: Science/Biology
+
+Format: HTML
+Index: /usr/share/doc/ncbi-tools-x11/sequin.htm
+Files: /usr/share/doc/ncbi-tools-x11/images/*
+
diff --git a/debian/ncbi-tools-x11.docs b/debian/ncbi-tools-x11.docs
new file mode 100644
index 00000000..cc57cdab
--- /dev/null
+++ b/debian/ncbi-tools-x11.docs
@@ -0,0 +1,5 @@
+debian/*.css
+debian/*.gif
+doc/fire*
+doc/images
+doc/sequin.htm
diff --git a/debian/ncbi-tools-x11.install b/debian/ncbi-tools-x11.install
new file mode 100644
index 00000000..9d10cf82
--- /dev/null
+++ b/debian/ncbi-tools-x11.install
@@ -0,0 +1,5 @@
+usr/bin/Psequin
+usr/bin/ddv
+usr/bin/entrez2
+usr/bin/sbtedit
+usr/bin/udv
diff --git a/debian/ncbi-tools-x11.links b/debian/ncbi-tools-x11.links
new file mode 100644
index 00000000..7a75b3c9
--- /dev/null
+++ b/debian/ncbi-tools-x11.links
@@ -0,0 +1,2 @@
+usr/bin/entrez2 usr/bin/entrez
+usr/bin/Psequin usr/bin/sequin
diff --git a/debian/ncbi-tools-x11.lintian-overrides b/debian/ncbi-tools-x11.lintian-overrides
new file mode 100644
index 00000000..fc3c844e
--- /dev/null
+++ b/debian/ncbi-tools-x11.lintian-overrides
@@ -0,0 +1 @@
+ncbi-tools-x11: menu-icon-missing usr/share/pixmaps/ncbilogo.xpm
diff --git a/debian/ncbi2.css b/debian/ncbi2.css
new file mode 100644
index 00000000..5124169d
--- /dev/null
+++ b/debian/ncbi2.css
@@ -0,0 +1,184 @@
+.TEXT {
+ font-size: 90%;
+ font-family: arial,helvetica,sans-serif;
+ }
+
+.TEXTWIDE {
+ font-size: 90%;
+ font-family: arial,helvetica,sans-serif;
+ }
+
+.medium1 {
+ font-size: 75%;
+ font-family: arial,helvetica,sans-serif;
+ }
+
+.medium2 {
+ font-size: 75%;
+ font-family: verdana;
+ }
+
+.medium3 {
+ font-size: 75%;
+ font-family: courier;
+ }
+
+.medium4 {
+ font-size: 75%;
+ font-family: arial,helvetica,sans-serif;
+ font-style: italic;
+ }
+
+.GUTTER1 {
+ font-size: 85%;
+ font-family: arial,helvetica,sans-serif;
+ color:#ffcc66;
+ }
+
+.GUTTER2 {
+ font-size: 75%;
+ font-family: arial,helvetica,sans-serif;
+ color:#ccccff;
+ }
+
+.GUTTER3 {
+ font-size: 75%;
+ font-family: arial,helvetica,sans-serif;
+ color:#ffffff;
+ text-decoration:none;
+ }
+
+A {
+ color:#0033CC;
+ }
+
+A.BOOK {
+ color:#085a29;
+ font-weight: bold;
+ }
+
+A.BAR {
+ font-size:85%;
+ color:#ffffff;
+ font-family: arial,helvetica,sans-serif;
+ text-decoration:none;
+ }
+
+A.HELPBAR {
+ color:#000000;
+ font-size: 75%;
+ font-family: arial,helvetica,sans-serif;
+ text-decoration:none;
+ }
+
+A.GUTTER {
+ color:#ffffff;
+ font-size: 85%;
+ font-family: arial,helvetica,sans-serif;
+ text-decoration:none;
+ }
+
+A.GUTTER1 {
+ color:#ffcc66;
+ font-size:85%;
+ font-family: arial,helvetica,sans-serif;
+ text-decoration:none;
+ }
+
+A.GUTTER2 {
+ font-size: 75%;
+ font-family: arial,helvetica,sans-serif;
+ color:#ccccff;
+ text-decoration:none;
+ }
+
+A.GUTTER3 {
+ font-size: 75%;
+ font-family: arial,helvetica,sans-serif;
+ color:#ffffff;
+ text-decoration:none;
+ }
+
+A.BUTTON {
+ font-size: 75%;
+ font-family: arial,helvetica,sans-serif;
+ color:#000000;
+ text-decoration:none;
+ }
+
+H1, .H1 {
+ font-size: 125%;
+ font-weight: bold;
+ font-family: arial,helvetica,sans-serif;
+ }
+
+H2, .H2 {
+ font-size: 125%;
+ font-weight: bold;
+ font-family: arial,helvetica,sans-serif;
+ }
+
+H3, .H3 {
+ font-size: 100%;
+ font-weight: bold;
+ font-family: arial,helvetica,sans-serif;
+ }
+
+H4, .H4 {
+ font-size: 100%;
+ font-weight: bold;
+ font-family: arial,helvetica,sans-serif;
+ }
+
+H5, .H5 {
+ font-size: 85%;
+ font-weight: bold;
+ font-style: italic;
+ font-family: arial,helvetica,sans-serif;
+ }
+
+.pmlinka {
+ font-family: arial,helvetica,sans-serif;
+ font-size:85%;
+ font-weight:bold;
+ color: #336699;
+ text-align:center;
+ vertical-align:baseline;
+ text-decoration:none;
+ }
+
+.pmlinkna {
+ font-family: arial,helvetica,sans-serif;
+ font-size:85%;
+ color: #336699;
+ text-align:center;
+ vertical-align:baseline;
+ text-decoration:none;
+ }
+
+.taba {
+ background:#FFFFFF;
+ text-align:center;
+ vertical-align:baseline;
+ }
+
+.tabna {
+ background:#CCCCCC;
+ text-align:center;
+ vertical-align:baseline;
+ }
+
+.dblinks {
+ font-size: 75%;
+ font-family: arial,helvetica,sans-serif;
+ color:#336699;
+ text-decoration:none;
+ }
+
+A.popmenu:link { text-decoration: none; font-family: Verdana, Arial, Sans-serif; font-size: 11px; color: Navy; }
+A.popmenu:visited { text-decoration: none; font-family: Verdana, Arial, Sans-serif; font-size: 11px; color:#6C7F9A; }
+A.popmenu:active { text-decoration: none; font-family: Verdana, Arial, Sans-serif; font-size: 11px; color:#001A4F; }
+A.popmenu:hover { text-decoration: underline; color:#038000; font-family: Verdana, Arial, Sans-serif; font-size: 11px; }
+.menutitle { font-family: Verdana, Arial, Sans-serif; font-size: 10px; font-weight: bold; }
+.fixedsize_skobka { color:#000084; font-size:10px; font-family:Arial,sans-serif; }
+
diff --git a/debian/patches/debian-changes b/debian/patches/debian-changes
new file mode 100644
index 00000000..3eb336f0
--- /dev/null
+++ b/debian/patches/debian-changes
@@ -0,0 +1,955 @@
+Combined patches from git.
+--- /dev/null
++++ ncbi-tools6-6.1.20170106+dfsg1/.gitignore
+@@ -0,0 +1,6 @@
++bin
++build
++include
++lib
++shlib
++*-stamp
+--- ncbi-tools6-6.1.20170106+dfsg1.orig/access/ent2api.c
++++ ncbi-tools6-6.1.20170106+dfsg1/access/ent2api.c
+@@ -1273,7 +1273,7 @@ NLM_EXTERN CONN EntrezOpenConnection (
+ *arg = '\0';
+
+ return QUERY_OpenServiceQueryEx
+- (StringHasNoText (e2_service) ? "Entrez2" : e2_service, NULL, 30, arg);
++ (StringHasNoText (e2_service) ? "Entrez2s" : e2_service, NULL, 30, arg);
+ }
+
+ #ifdef OS_MAC
+--- ncbi-tools6-6.1.20170106+dfsg1.orig/api/sqnutil3.c
++++ ncbi-tools6-6.1.20170106+dfsg1/api/sqnutil3.c
+@@ -33198,7 +33198,7 @@ ClickableItemPtr LIBCALL ClickableGlobal
+ cip->clickable_item_type = item_type;
+ cip->description
+ = (CharPtr) MemNew ( sizeof (Char) * (StringLen (fmt) + 15));
+- sprintf (cip->description, fmt);
++ strcpy (cip->description, fmt);
+ return cip;
+ }
+ return NULL;
+--- ncbi-tools6-6.1.20170106+dfsg1.orig/connect/ncbi_gnutls.c
++++ ncbi-tools6-6.1.20170106+dfsg1/connect/ncbi_gnutls.c
+@@ -585,6 +585,7 @@ static EIO_Status s_GnuTlsInit(FSSLPull
+
+ assert(!s_GnuTlsCredAnon);
+
++#if 0
+ version = gnutls_check_version(0);
+ if (strcasecmp(GNUTLS_VERSION, version) != 0) {
+ CORE_LOGF(eLOG_Critical,
+@@ -592,6 +593,7 @@ static EIO_Status s_GnuTlsInit(FSSLPull
+ GNUTLS_VERSION, version));
+ assert(0);
+ }
++#endif
+
+ val = ConnNetInfo_GetValue(0, "GNUTLS_LOGLEVEL", buf, sizeof(buf), 0);
+ CORE_LOCK_READ;
+--- ncbi-tools6-6.1.20170106+dfsg1.orig/connect/ncbi_http_connector.c
++++ ncbi-tools6-6.1.20170106+dfsg1/connect/ncbi_http_connector.c
+@@ -240,8 +240,14 @@ static int/*bool*/ x_UnsafeRedirectOK(SH
+ if (uuu->unsafe_redir == eDefault) {
+ if (!(uuu->flags & fHTTP_UnsafeRedirects)) {
+ char val[32];
++ const char* dflt = NULL;
++ if (uuu->net_info->scheme == eURL_Https
++ && (strspn(uuu->net_info->host, "0123456789.")
++ == strlen(uuu->net_info->host))) {
++ dflt = "TRUE";
++ }
+ ConnNetInfo_GetValue(0, "HTTP_UNSAFE_REDIRECTS",
+- val, sizeof(val), 0);
++ val, sizeof(val), dflt);
+ uuu->unsafe_redir = ConnNetInfo_Boolean(val) ? eOn : eOff;
+ } else
+ uuu->unsafe_redir = eOn;
+--- ncbi-tools6-6.1.20170106+dfsg1.orig/connect/ncbi_util.c
++++ ncbi-tools6-6.1.20170106+dfsg1/connect/ncbi_util.c
+@@ -49,7 +49,9 @@
+ # ifndef NCBI_OS_SOLARIS
+ # include <limits.h>
+ # endif /*!NCBI_OS_SOLARIS*/
+-# ifdef NCBI_OS_LINUX
++# ifdef __MACH__
++# include <mach/vm_param.h>
++# elif defined(NCBI_OS_LINUX)
+ # include <sys/user.h>
+ # endif /*NCBI_OS_LINUX*/
+ # include <pwd.h>
+--- ncbi-tools6-6.1.20170106+dfsg1.orig/connect/urlquery.c
++++ ncbi-tools6-6.1.20170106+dfsg1/connect/urlquery.c
+@@ -128,7 +128,10 @@ NLM_EXTERN CONN QUERY_OpenUrlQuery (
+ }
+ if ( host_port ) {
+ net_info->port = host_port;
++ } else {
++ net_info->scheme = eURL_Https;
+ }
++
+ StringNCpy_0 (net_info->path, host_path, sizeof (net_info->path));
+ if (StringDoesHaveText (arguments)) {
+ StringNCpy_0 (net_info->args, arguments, sizeof (net_info->args));
+--- ncbi-tools6-6.1.20170106+dfsg1.orig/corelib/ncbimain.c
++++ ncbi-tools6-6.1.20170106+dfsg1/corelib/ncbimain.c
+@@ -67,6 +67,7 @@
+ #pragma segment NlmSegA
+ #endif
+
++extern Nlm_Int2 Nlm_Main(void) __attribute__((weak));
+
+ /*****************************************************************************
+ *
+@@ -95,7 +96,12 @@ main(int argc, char *argv[])
+ /* Initialize connection library's logger, registry and lock */
+ CONNECT_Init(0);
+
+- retval = Nlm_Main();
++ if (Nlm_Main) {
++ retval = Nlm_Main();
++ } else {
++ ErrPost(0, 0, "Neither main nor Nlm_Main defined by program.");
++ retval = -1;
++ }
+
+ NlmThreadJoinAll();
+
+--- ncbi-tools6-6.1.20170106+dfsg1.orig/corelib/ncbitime.c
++++ ncbi-tools6-6.1.20170106+dfsg1/corelib/ncbitime.c
+@@ -77,6 +77,7 @@
+ #include <ncbi.h>
+ #include <ncbithr.h>
+ #include <ncbiwin.h>
++#include <stdlib.h>
+
+ #ifdef OS_UNIX
+ #include <sys/times.h>
+@@ -108,8 +109,18 @@ NLM_EXTERN time_t LIBCALL Nlm_GetSecs (
+ *****************************************************************************/
+ NLM_EXTERN Nlm_Boolean LIBCALL Nlm_GetDayTime (Nlm_DayTimePtr dtp)
+ {
++ /* This function honors the SOURCE_DATE_EPOCH specificatin
++ (https://reproducible-builds.org/specs/source-date-epoch/) */
++ const char *sde = getenv("SOURCE_DATE_EPOCH");
+ #if (defined(SOLARIS_THREADS_AVAIL) || defined(POSIX_THREADS_AVAIL) || defined(WIN32)) && !defined(OS_UNIX_DARWIN)
+- time_t t = time( NULL );
++ time_t t;
++ if (sde) {
++ t = strtoul(sde, NULL, 0);
++ if (t == 0)
++ return FALSE;
++ } else {
++ t = time( NULL );
++ }
+ #ifdef WIN32
+ static TNlmMutex localtime_lock;
+ if (NlmMutexLockEx( &localtime_lock ) != 0)
+@@ -125,7 +136,13 @@ NLM_EXTERN Nlm_Boolean LIBCALL Nlm_GetD
+ time_t ltime;
+ struct tm *dt;
+ Nlm_MemFill ((Nlm_VoidPtr) dtp, 0, sizeof(Nlm_DayTime));
+- time(&ltime);
++ if (sde) {
++ ltime = strtoul(sde, NULL, 0);
++ if (ltime == 0)
++ return FALSE;
++ } else {
++ time(&ltime);
++ }
+ if ((dt = localtime (&ltime)) != NULL)
+ {
+ Nlm_MemCopy ((Nlm_VoidPtr) dtp, (Nlm_VoidPtr) dt, sizeof (struct tm));
+--- ncbi-tools6-6.1.20170106+dfsg1.orig/demo/asndisc.c
++++ ncbi-tools6-6.1.20170106+dfsg1/demo/asndisc.c
+@@ -65,6 +65,7 @@
+ #include <objmacro.h>
+ #include <macroapi.h>
+
++#include <connect/ncbi_gnutls.h>
+
+ #define ASNDISC_APP_VER "2.3"
+
+@@ -1264,6 +1265,8 @@ Int2 Main (void)
+ UseLocalAsnloadDataAndErrMsg ();
+ ErrPathReset ();
+
++ SOCK_SetupSSL(NcbiSetupGnuTls);
++
+ if (! AllObjLoad ()) {
+ Message (MSG_FATAL, "AllObjLoad failed");
+ return 1;
+--- ncbi-tools6-6.1.20170106+dfsg1.orig/demo/entrez2.c
++++ ncbi-tools6-6.1.20170106+dfsg1/demo/entrez2.c
+@@ -61,6 +61,8 @@
+
+ #include <entrez2.h>
+
++#include <connect/ncbi_gnutls.h>
++
+ #define ENTREZ_APP_VERSION "12.1"
+
+ #define MAX_QUERY_FORMS 256
+@@ -884,6 +886,8 @@ Int2 Main (void)
+ UseLocalAsnloadDataAndErrMsg ();
+ ErrPathReset ();
+
++ SOCK_SetupSSL(NcbiSetupGnuTls);
++
+ /*--------------------------------*/
+ /* Initialize the global settings */
+ /*--------------------------------*/
+@@ -1026,7 +1030,7 @@ Int2 Main (void)
+ /*--------------------------------------*/
+
+ if (useNormalServ) {
+- EntrezSetService ("Entrez2");
++ EntrezSetService ("Entrez2s");
+ } else if (useTestServ) {
+ EntrezSetService ("Entrez2Test");
+ } else if (useURL) {
+--- ncbi-tools6-6.1.20170106+dfsg1.orig/demo/findspl.c
++++ ncbi-tools6-6.1.20170106+dfsg1/demo/findspl.c
+@@ -62,6 +62,8 @@
+ #include <accentr.h>
+ #include <sequtil.h>
+
++#include <connect/ncbi_gnutls.h>
++
+ #define NUMARGS 3
+ Args myargs[NUMARGS] = {
+ {"Gi number of protein","0","1","99999999",FALSE,'g',ARG_INT,0.0,0,NULL},
+@@ -98,6 +100,8 @@ Int2 Main(void)
+ FILE *ofp;
+ FILE *ifp = NULL;
+
++ SOCK_SetupSSL(NcbiSetupGnuTls);
++
+ if ( !GetArgs("findspl", NUMARGS, myargs) ) return 1;
+
+ gi = myargs[0].intvalue;
+--- ncbi-tools6-6.1.20170106+dfsg1.orig/demo/gbseqget.c
++++ ncbi-tools6-6.1.20170106+dfsg1/demo/gbseqget.c
+@@ -54,6 +54,8 @@
+ #include <pmfapi.h>
+ #include <asn2gnbp.h>
+
++#include <connect/ncbi_gnutls.h>
++
+ static CharPtr ReadALine (
+ CharPtr str,
+ size_t size,
+@@ -417,6 +419,8 @@ Int2 Main (void)
+ UseLocalAsnloadDataAndErrMsg ();
+ ErrPathReset ();
+
++ SOCK_SetupSSL(NcbiSetupGnuTls);
++
+ if (! AllObjLoad ()) {
+ Message (MSG_FATAL, "AllObjLoad failed");
+ return 1;
+--- ncbi-tools6-6.1.20170106+dfsg1.orig/demo/insdseqget.c
++++ ncbi-tools6-6.1.20170106+dfsg1/demo/insdseqget.c
+@@ -55,6 +55,8 @@
+ #include <pmfapi.h>
+ #include <asn2gnbp.h>
+
++#include <connect/ncbi_gnutls.h>
++
+ #define INSDSEQGET_APP_VER "1.1"
+
+ CharPtr INSDSEQGET_APPLICATION = INSDSEQGET_APP_VER;
+@@ -423,6 +425,8 @@ Int2 Main (void)
+ UseLocalAsnloadDataAndErrMsg ();
+ ErrPathReset ();
+
++ SOCK_SetupSSL(NcbiSetupGnuTls);
++
+ if (! AllObjLoad ()) {
+ Message (MSG_FATAL, "AllObjLoad failed");
+ return 1;
+--- ncbi-tools6-6.1.20170106+dfsg1.orig/demo/nps2gps.c
++++ ncbi-tools6-6.1.20170106+dfsg1/demo/nps2gps.c
+@@ -50,6 +50,8 @@
+ #include <toasn3.h>
+ #include <pmfapi.h>
+
++#include <connect/ncbi_gnutls.h>
++
+ #define NPS2GPSAPP_VER "3.6"
+
+ CharPtr NPS2GPSAPPLICATION = NPS2GPSAPP_VER;
+@@ -2439,6 +2441,8 @@ Int2 Main (void)
+ UseLocalAsnloadDataAndErrMsg ();
+ ErrPathReset ();
+
++ SOCK_SetupSSL(NcbiSetupGnuTls);
++
+ if (! AllObjLoad ()) {
+ Message (MSG_FATAL, "AllObjLoad failed");
+ return 1;
+--- ncbi-tools6-6.1.20170106+dfsg1.orig/demo/taxblast_main.c
++++ ncbi-tools6-6.1.20170106+dfsg1/demo/taxblast_main.c
+@@ -41,6 +41,8 @@ static char const rcsid[] = "$Id: taxbla
+ #include <objgen.h>
+ #include <taxblast.h>
+
++#include <connect/ncbi_gnutls.h>
++
+
+ #define NUMARG (sizeof(myargs)/sizeof(myargs[0]))
+
+@@ -63,6 +65,8 @@ Int2 Main (void)
+ FILE *outfile;
+ Char ofile[128];
+
++ SOCK_SetupSSL(NcbiSetupGnuTls);
++
+ if (!GetArgs("txblast", NUMARG, myargs)) {
+ return 1;
+ }
+--- ncbi-tools6-6.1.20170106+dfsg1.orig/demo/tbl2asn.c
++++ ncbi-tools6-6.1.20170106+dfsg1/demo/tbl2asn.c
+@@ -8911,10 +8911,12 @@ Int2 Main (void)
+ return 1;
+ }
+
++ /*
+ if (MoreThanYearOld ()) {
+ too_old = TRUE;
+ Message (MSG_POST, "This copy of tbl2asn is more than a year old. Please download the current version.");
+ }
++ */
+
+ /* process command line arguments */
+
+@@ -9668,6 +9670,9 @@ Int2 Main (void)
+ }
+
+ if (tbl.other_failure) {
++ if (MoreThanYearOld ()) {
++ Message (MSG_POST, "This copy of tbl2asn is more than a year old. Please try again with the current version.");
++ }
+ return 1;
+ }
+
+--- ncbi-tools6-6.1.20170106+dfsg1.orig/desktop/bspview.c
++++ ncbi-tools6-6.1.20170106+dfsg1/desktop/bspview.c
+@@ -2549,13 +2549,13 @@ NLM_EXTERN void Nlm_LaunchWebPage (Char
+ }
+ #endif
+ #ifdef WIN_MOTIF
+- argv [0] = "netscape";
++ argv [0] = "sensible-browser";
+ argv [1] = url;
+ argv [2] = NULL;
+ child = fork();
+ if(child == 0) {
+- if (execvp ("netscape", argv) == -1) {
+- Message (MSG_POST, "Unable to launch netscape");
++ if (execvp ("sensible-browser", argv) == -1) {
++ Message (MSG_POST, "Unable to launch browser");
+ exit(-1);
+ }
+ }
+--- ncbi-tools6-6.1.20170106+dfsg1.orig/doc/dispatcher.html
++++ ncbi-tools6-6.1.20170106+dfsg1/doc/dispatcher.html
+@@ -9,15 +9,15 @@
+ -->
+ <META NAME="keywords" CONTENT="dispatcher toolkit">
+ <META NAME="description" CONTENT="NCBI dispatcher">
+- <link rel="stylesheet" href="http://www.ncbi.nlm.nih.gov/corehtml/ncbi2.css">
++ <link rel="stylesheet" href="ncbi2.css">
+ </head>
+
+
+-<body bgcolor="#FFFFFF" background="http://www.ncbi.nlm.nih.gov/corehtml/bkgd.gif" text="#000000" link="#CC6600" vlink="#CC6600">
++<body bgcolor="#FFFFFF" background="bkgd.gif" text="#000000" link="#CC6600" vlink="#CC6600">
+ <!-- the header -->
+ <table border="0" width="600" cellspacing="0" cellpadding="0">
+ <tr>
+- <td width="140"><a href="http://www.ncbi.nlm.nih.gov"> <img src="http://www.ncbi.nlm.nih.gov/corehtml/left.GIF" width="130" height="45" border="0"></a></td>
++ <td width="140"><a href="http://www.ncbi.nlm.nih.gov"> <img src="left.gif" width="130" height="45" border="0"></a></td>
+ <td width="360" class="head1" valign="BOTTOM"> <span class="H1">Network Configuration</span></td>
+ <td width="100" valign="BOTTOM"></td>
+ </tr>
+@@ -37,7 +37,7 @@
+ <table border="0" width="600" cellspacing="0" cellpadding="0">
+ <tr valign="TOP"> <!-- left column -->
+ <td width="125">
+- <img src="http://www.ncbi.nlm.nih.gov/corehtml/spacer10.GIF" width="125" height="1" border="0">
++ <img src="spacer10.gif" width="125" height="1" border="0">
+ <p>
+ <a href="#Switch" class="GUTTER">The Switch</a>
+ <p>
+@@ -52,7 +52,7 @@
+ <a href="#Addendum" class="GUTTER">Additional Info</a>
+ </td>
+ <!-- extra column to force things over the gif border -->
+- <td width="15"><img src="http://www.ncbi.nlm.nih.gov/corehtml/spacer10.GIF" width="15" height="1" border="0"> </td>
++ <td width="15"><img src="spacer10.gif" width="15" height="1" border="0"> </td>
+ <!-- right content column -->
+ <td width="460">
+ <p>&nbsp;</p>
+--- ncbi-tools6-6.1.20170106+dfsg1.orig/doc/firewall.html
++++ ncbi-tools6-6.1.20170106+dfsg1/doc/firewall.html
+@@ -9,15 +9,15 @@
+ <META NAME="keywords" CONTENT="insert your keywords for the search engine">
+ <META NAME="description" CONTENT="insert the description to be displayed by the search engine. Also searched by the search engine.">
+ -->
+- <link rel="stylesheet" href="http://www.ncbi.nlm.nih.gov/corehtml/ncbi2.css">
++ <link rel="stylesheet" href="ncbi2.css">
+ </head>
+
+
+-<body bgcolor="#FFFFFF" background="http://www.ncbi.nlm.nih.gov/corehtml/bkgd.gif" text="#000000" link="#CC6600" vlink="#CC6600">
++<body bgcolor="#FFFFFF" background="bkgd.gif" text="#000000" link="#CC6600" vlink="#CC6600">
+ <!-- the header -->
+ <table border="0" width="600" cellspacing="0" cellpadding="0">
+ <tr>
+- <td width="140"><a href="http://www.ncbi.nlm.nih.gov"> <img src="http://www.ncbi.nlm.nih.gov/corehtml/left.GIF" width="130" height="45" border="0"></a></td>
++ <td width="140"><a href="http://www.ncbi.nlm.nih.gov"> <img src="left.gif" width="130" height="45" border="0"></a></td>
+ <td width="360" class="head1" valign="BOTTOM"> <span class="H1">Network Configuration</span></td>
+ <td width="100" valign="BOTTOM"></td>
+ </tr>
+@@ -37,12 +37,12 @@
+ <table border="0" width="600" cellspacing="0" cellpadding="0">
+ <tr valign="TOP"> <!-- left column -->
+ <td width="125">
+-<img src="http://www.ncbi.nlm.nih.gov/corehtml/spacer10.GIF" width="125" height="1" border="0">
++<img src="spacer10.gif" width="125" height="1" border="0">
+
+
+ </td>
+ <!-- extra column to force things over the gif border -->
+- <td width="15"><img src="http://www.ncbi.nlm.nih.gov/corehtml/spacer10.GIF" width="15" height="1" border="0"> </td>
++ <td width="15"><img src="spacer10.gif" width="15" height="1" border="0"> </td>
+ <!-- right content column -->
+ <td width="460">
+ <p>&nbsp;</p>
+@@ -133,7 +133,7 @@ in case the public access will eventuall
+
+ <p>
+ To see what ports are currently on, and their status, as reported within
+-NCBI, please refer to the following <a href="fwd_check.cgi">Firewall Daemon Presence
++NCBI, please refer to the following <a href="http://www.ncbi.nlm.nih.gov/IEB/ToolBox/NETWORK/fwd_check.cgi">Firewall Daemon Presence
+ Check</a> page. Ports marked <b>INTERNAL</b> are solely for NCBI own use, and may be
+ inaccessible from your site. That, however, does not affect availability of any
+ services that NCBI provides through other (open) firewall ports.
+@@ -143,7 +143,7 @@ TROUBLESHOOTING: You can test whether t
+ your host just by running simple <tt>telnet</tt> command (available on most
+ current systems). To know which ports, at the moment, you should be trying
+ from the list above (see the "Ports to open"), first check their status by visiting
+-<a href="fwd_check.cgi">Firewall Daemon Presence Check</a> link, then select any
++<a href="http://www.ncbi.nlm.nih.gov/IEB/ToolBox/NETWORK/fwd_check.cgi">Firewall Daemon Presence Check</a> link, then select any
+ up-and-running port and do the following (the example assumes port 5861 has
+ been shown in operational state):
+ <pre>
+@@ -175,7 +175,7 @@ functions of NCBI dispatching facilities
+
+ <p>
+ There is also an auxiliary automated UNIX shell script
+-<a href="fwd_check.sh">fwd_check.sh</a> to check all of
++<a href="../libncbi6/examples/fwd_check.sh">fwd_check.sh</a> to check all of
+ the preset ports, and it is kept in-sync with currently
+ configured open ports (so remember to refresh your download
+ prior to actual use).
+--- ncbi-tools6-6.1.20170106+dfsg1.orig/doc/fwd_check.sh
++++ ncbi-tools6-6.1.20170106+dfsg1/doc/fwd_check.sh
+@@ -8,7 +8,7 @@
+ delay_sec="$1"
+ delay_sec=${delay_sec:="10"}
+ netcat="`which nc 2>/dev/null`"
+-temp="/tmp/`basename $0`.$$.tmp"
++temp=`mktemp`
+ helper="./fwd_failure_helper.exe"
+ test -z "$netcat" && netcat="`whereis nc | sed 's/^[^:]*://;s/ //g'`"
+ test -z "$HTTP_NCBI_EXTERNAL" && HTTP_CAF_EXTERNAL="$HTTP_NCBI_EXTERNAL"
+--- ncbi-tools6-6.1.20170106+dfsg1.orig/doc/man/cleanasn.1
++++ ncbi-tools6-6.1.20170106+dfsg1/doc/man/cleanasn.1
+@@ -1,4 +1,4 @@
+-.TH CLEANASN 1 2016-09-01 NCBI "NCBI Tools User's Manual"
++.TH CLEANASN 1 2017-01-09 NCBI "NCBI Tools User's Manual"
+ .SH NAME
+ cleanasn \- clean up irregularities in NCBI ASN.1 objects
+ .SH SYNOPSIS
+@@ -75,6 +75,10 @@ Exclude nuc\-prot sets
+ Only segmented sequences
+ .IP w
+ Exclude segmented sequences
++.IP x
++Only segmented proteins
++.IP y
++Exclude segmented proteins
+ .PD
+ .RE
+ .TP
+@@ -86,6 +90,8 @@ Sequence operations, per the flags in st
+ Compress
+ .IP d
+ Decompress
++.IP l
++Recalculated segmented sequence length
+ .IP v
+ Virtual gaps inside segmented sequence
+ .IP s
+--- /dev/null
++++ ncbi-tools6-6.1.20170106+dfsg1/doc/man/taxblast.1
+@@ -0,0 +1,31 @@
++.TH TAXBLAST 1 2016-12-05 NCBI "NCBI Tools User's Manual"
++.SH NAME
++taxblast \- annotate BLAST output with taxonomic details
++.SH SYNOPSIS
++.B taxblast
++[\|\fB\-\fP\|]
++[\|\fB\-d\fP\ \fIstr\fP\|]
++\fB\-i\fP\ \fIfilename\fP
++[\|\fB\-o\fP\ \fIfilename\fP\|]
++[\|\fB\-p\fP\|]
++.SH DESCRIPTION
++\fBtaxblast\fP annotates BLAST output with taxonomic details.
++.SH OPTIONS
++A summary of options is included below.
++.TP
++\fB\-\fP
++Print usage message
++.TP
++\fB\-d\fP\ \fIstr\fP
++Database used to get SeqAnnot ASN.1 (\fBnr\fP by default)
++.TP
++\fB\-i\fP\ \fIfilename\fP
++Input ASN.1 File (SeqAnnot)
++.TP
++\fB\-o\fP\ \fIfilename\fP
++Output file name (stdout by default)
++.TP
++\fB\-p\fP
++Sequence is DNA
++.SH AUTHOR
++The National Center for Biotechnology Information.
+--- ncbi-tools6-6.1.20170106+dfsg1.orig/make/makeall.unx
++++ ncbi-tools6-6.1.20170106+dfsg1/make/makeall.unx
+@@ -1,4 +1,4 @@
+-# makefile for asntool and ncbi core routines,
++# -*- makefile -*- for asntool and ncbi core routines,
+ #
+ # $Id: makeall.unx,v 6.321 2016/12/31 22:35:10 ucko Exp $
+ #
+@@ -234,7 +234,7 @@ SRC20 = drawseq.c dotmatrx.c fea2seg.c f
+ dlgutil1.c dlgutil2.c e2trmlst.c e2docsum.c asn2graphic.c \
+ medview.c bspview.c gbfview.c gphview.c gphdraw.c gxydraw.c gtrdraw.c \
+ seqpanel.c ingengraph.c ingenext.c ingenwin.c macrodlg.c \
+- biosrc.c cdrgn.c import.c pubdesc.c seqsub.c mapgene.c prtgene.c salogif.c
++ biosrc.c cdrgn.c import.c pubdesc.c seqsub.c mapgene.c prtgene.c
+
+ SRC45 = ddvclick.c ddvgraph.c ddvopen.c ddvpanel.c
+
+@@ -392,7 +392,7 @@ OBJ20 = drawseq.o dotmatrx.o fea2seg.o f
+ dlgutil1.o dlgutil2.o e2trmlst.o e2docsum.o asn2graphic.o \
+ medview.o bspview.o gbfview.o gphview.o gphdraw.o gxydraw.o gtrdraw.o \
+ seqpanel.o ingengraph.o ingenext.o ingenwin.o macrodlg.o \
+- biosrc.o cdrgn.o import.o pubdesc.o seqsub.o mapgene.o prtgene.o salogif.o
++ biosrc.o cdrgn.o import.o pubdesc.o seqsub.o mapgene.o prtgene.o
+
+ OBJ45 = ddvclick.o ddvgraph.o ddvopen.o ddvpanel.o
+
+@@ -491,14 +491,14 @@ ln-if-absent: ../make/ln-if-absent
+ nocopy : sources $(THR_OBJ) $(LIB1) $(LIBTLS) $(LIB2) $(LIB3) $(DLIB4) $(DLIB400) \
+ $(LIB5) $(DLIB20) $(DLIB45) $(LIB22) $(LIB23) $(LIBCOMPADJ) \
+ $(DLIB28) $(DLIB30) $(DLIB3000) \
+- $(DLIB34) $(DLIB37) $(DLIB38) $(LIB50) $(LIB60) $(LIB61) $(NCBI_SHLIBS)
++ $(DLIB34) $(DLIB37) $(DLIB38) $(LIB60) $(LIB61) $(NCBI_SHLIBS)
+
+ sources : $(SRCALL)
+
+ ## To clean out the directory without removing make
+ ##
+ clean :
+- -rm -f *.[acho]
++ -rm -f *.[acho] *.glo
+
+ .NO_PARALLEL: copy $(ULIB4) $(ULIB30)
+
+@@ -656,10 +656,12 @@ shlib.sol :
+ cd ../shlib; make -f $(MAKESHLIB) `ls *.a | sed "s/\.a/.so/"` NCBI_OTHERLIBS=$(OTHERLIBS)
+ rm -f ../shlib/*.a
+
+-#
+-# Linux shared libs are built the same in the same manner as for SGI
+-#
+-shlib.lnx : shlib.sgi
++shlib.lnx :
++ -mkdir ../shlib
++ -rm -f ../shlib/*.a
++ ln $(NCBI_LIBDIR)/*.a ../shlib
++ cd ../shlib; make -f $(MAKESHLIB) `ls *.a | sed "s/\.a/.so.$(NCBI_VERSION_MAJOR)/"` SH1="$(CC) -o" SH2="-shared *.o"
++ rm -f ../shlib/*.a
+
+ shlib.sgi :
+ -mkdir ../shlib
+@@ -792,7 +794,7 @@ copy :
+ cp -fp ../algo/blast/core/*.h ../include/algo/blast/core
+ - mkdir -p ../include/algo/blast/composition_adjustment
+ $(SRCCOPY) ../algo/blast/composition_adjustment/*.c .
+- $(SRCCOPY) ../algo/blast/composition_adjustment/*.h ../include
++# $(SRCCOPY) ../algo/blast/composition_adjustment/*.h ../include
+ cp -fp ../algo/blast/composition_adjustment/*.h \
+ ../include/algo/blast/composition_adjustment
+ - mkdir -p ../include/algo/blast/api
+--- ncbi-tools6-6.1.20170106+dfsg1.orig/make/makedemo.unx
++++ ncbi-tools6-6.1.20170106+dfsg1/make/makedemo.unx
+@@ -1,4 +1,4 @@
+-# makefile for demo programs
++# -*- makefile -*- for demo programs
+ #
+ # $Id: makedemo.unx,v 6.96 2016/08/31 19:05:26 ucko Exp $
+ #
+@@ -228,7 +228,8 @@ cdscan : cdscan.c
+ # findspl
+
+ findspl : findspl.c
+- $(CC) -o findspl $(LDFLAGS) findspl.c $(ENTREZLIBS) $(LIB2) $(LIB1) $(OTHERLIBS)
++ $(CC) -o findspl $(LDFLAGS) findspl.c $(ENTREZLIBS) $(LIB2) $(LIB1) \
++ $(LIBTLS) $(OTHERLIBS)
+
+ # errhdr
+
+--- ncbi-tools6-6.1.20170106+dfsg1.orig/make/makenet.unx
++++ ncbi-tools6-6.1.20170106+dfsg1/make/makenet.unx
+@@ -1,4 +1,4 @@
+-# makefile for network demo programs and network entrez
++# -*- makefile -*- for network demo programs and network entrez
+ #
+ # $Id: makenet.unx,v 6.261 2016/08/25 15:37:04 ucko Exp $
+ # test, ignore
+@@ -330,6 +330,8 @@ OBJ46 = id2.o id2sgen.o
+
+ # objects & sources needed for versions of network demo programs
+
++OBJCN3D = cn3dmain.o
++
+ OBJDDV = ddvmain.o
+
+ OBJUDV = udvmain.o
+@@ -445,10 +447,12 @@ shlib.sol :
+ cd ../shlib; make -f $(MAKESHLIB) `ls *.a | sed "s/\.a/.so/"` NCBI_OTHERLIBS=$(OTHERLIBS)
+ rm -f ../shlib/*.a
+
+-#
+-# Linux shared libs are built the same in the same manner as for SGI
+-#
+-shlib.lnx : shlib.sgi
++shlib.lnx :
++ -mkdir ../shlib
++ -rm -f ../shlib/*.a
++ ln $(NCBI_LIBDIR)/*.a ../shlib
++ cd ../shlib; make -f $(MAKESHLIB) `ls *.a | sed "s/\.a/.so.$(NCBI_VERSION_MAJOR)/"` SH1="$(CC) -o" SH2="-shared *.o"
++ rm -f ../shlib/*.a
+
+ shlib.sgi :
+ -mkdir ../shlib
+@@ -518,7 +522,7 @@ copy :
+ $(SRCCOPY) ../network/vibnet/*.h ../include
+ $(SRCCOPY) ../cdromlib/*.h ../include
+ -$(SRCCOPY) ../network/wwwblast/Src/*.c .
+- -$(SRCCOPY) ../network/wwwblast/Src/*.h ../include
++# -$(SRCCOPY) ../network/wwwblast/Src/*.h ../include
+ $(SRCCOPY) ../cdromlib/accentr.c .
+ $(SRCCOPY) ../cdromlib/accutils.c .
+ -$(SRCCOPY) ../sequin/*.* .
+@@ -952,6 +956,11 @@ accvdb.o : accvdb.c
+ ##
+
+
++Cn3D : $(OBJCN3D) $(BENTREZLIBS) netentcf $(BLIB36)
++ $(CC) -o Cn3D $(LDFLAGS) $(OBJCN3D) $(LIB31) $(LIB3000) $(LIB20) \
++ $(LIB45) $(LIB22) $(LIB8) $(LIB7) \
++ $(LIB400) $(LIB2) $(LIB1) $(VIBLIBS) $(OGLLIBS)
++
+ ddv : $(OBJDDV)
+ $(CC) -o ddv $(LDFLAGS) $(OBJDDV) $(LIB41) $(LIB31) $(LIB20) $(LIB61) $(LIB60) $(LIB22) $(LIB45) \
+ $(LIB8) $(LIB7) $(NETCLILIB) $(LIB3) $(LIB4) $(LIB23) \
+@@ -1097,8 +1106,8 @@ asnval_dbx_psf.o : asnval.c
+ # asndisc program (asndisc)
+ asndisc : asndisc.c
+ $(CC) -g -o asndisc $(LDFLAGS) asndisc.c $(THREAD_OBJ) $(LIB41) \
+- $(NETCLILIB) $(LIB23) $(LIBCOMPADJ) $(LIB2) $(LIB1) \
+- $(OTHERLIBS) $(THREAD_OTHERLIBS)
++ $(NETCLILIB) $(LIB23) $(LIBCOMPADJ) $(LIB2) $(LIBTLS) $(LIB1) \
++ $(GNUTLS_LIBS) $(OTHERLIBS) $(THREAD_OTHERLIBS)
+
+ # asndisc_psf, uses PUBSEQBioseqFetchEnable instead of PubSeqFetchEnable
+ # should be used only internally within NCBI.
+@@ -1150,17 +1159,19 @@ diffshift : diffshift.c
+ # gbseqget program (gbseqget)
+ gbseqget : gbseqget.c
+ $(CC) -g -o gbseqget $(LDFLAGS) gbseqget.c $(LIB41) $(NETCLILIB) \
+- $(LIB23) $(LIBCOMPADJ) $(LIB2) $(LIB1) $(OTHERLIBS)
++ $(LIB23) $(LIBCOMPADJ) $(LIB2) $(LIBTLS) $(LIB1) \
++ $(GNUTLS_LIBS) $(OTHERLIBS)
+
+ # insdseqget program (insdseqget)
+ insdseqget : insdseqget.c
+ $(CC) -g -o insdseqget $(LDFLAGS) insdseqget.c $(LIB41) $(NETCLILIB) \
+- $(LIB23) $(LIBCOMPADJ) $(LIB2) $(LIB1) $(OTHERLIBS)
++ $(LIB23) $(LIBCOMPADJ) $(LIB2) $(LIBTLS) $(LIB1) \
++ $(GNUTLS_LIBS) $(OTHERLIBS)
+
+ # nps2gps program (nps2gps)
+ nps2gps : nps2gps.c
+ $(CC) -g -o nps2gps $(LDFLAGS) nps2gps.c $(LIB23) $(LIBCOMPADJ) \
+- $(LIB2) $(LIB1) $(OTHERLIBS)
++ $(LIB2) $(LIBTLS) $(LIB1) $(GNUTLS_LIBS) $(OTHERLIBS)
+
+ # trna2sap program (trna2sap)
+ trna2sap : trna2sap.c
+@@ -1181,7 +1192,8 @@ testent2 : testent2.c
+ entrez2 : entrez2.c
+ $(CC) -g -o entrez2 $(LDFLAGS) entrez2.c $(LIB41) $(LIB6) $(LIB20) \
+ $(LIB61) $(LIB60) $(LIB22) $(LIB23) $(LIBCOMPADJ) \
+- $(LIB2) $(LIB4) $(LIB1) $(VIBLIBS) $(OTHERLIBS)
++ $(LIB2) $(LIB4) $(LIBTLS) $(LIB1) \
++ $(GNUTLS_LIBS) $(VIBLIBS) $(OTHERLIBS)
+ $(VIB_POST_LINK) entrez2
+
+ # demo program (spidey)
+@@ -1285,7 +1297,7 @@ bl2seq : bl2seq.c
+ taxblast: taxblast_main.c $(BLIB41) $(BLIB40)
+ $(CC) -g -o taxblast $(LDFLAGS) taxblast_main.c \
+ $(LIB61) $(LIB60) $(LIB36) $(LIB41) $(LIB40) $(LIB23) $(LIBCOMPADJ) \
+- $(NETCLILIB) $(LIB2) $(LIB1) $(OTHERLIBS)
++ $(NETCLILIB) $(LIB2) $(LIBTLS) $(LIB1) $(GNUTLS_LIBS) $(OTHERLIBS)
+
+ # test client for the suggest network service
+ suggcli: suggcli.c $(BNETCLILIB) $(BLIB24)
+--- ncbi-tools6-6.1.20170106+dfsg1.orig/make/makeshlb.unx
++++ ncbi-tools6-6.1.20170106+dfsg1/make/makeshlb.unx
+@@ -1,4 +1,4 @@
+-#
++# -*- makefile -*-
+ #
+ # $Id: makeshlb.unx,v 6.1 1999/03/18 17:31:11 beloslyu Exp $
+ #
+@@ -12,7 +12,115 @@ SH1 = ld -G -o
+ SH2 = `lorder *.o | tsort` $(NCBI_OTHERLIBS)
+
+ %.so: %.a
+- rm -f *.o __*
++ rm -f *.o *.glo __*
+ ar x $<
++ case $< in \
++ *OGL.a) for f in *.glo; do mv $$f `basename $$f .glo`.o; done ;; \
++ esac
+ $(SH1) $@ $(SH2)
+ rm -f *.o __*
++
++so=so.$(NCBI_VERSION_MAJOR).$(NCBI_VERSION_MINOR)
++
++%.$(so): %.a
++ $(CC) -shared -Wl,-soname=$*.so.$(NCBI_VERSION_MAJOR) -o $@ \
++ -Wl,--whole-archive $< -Wl,--no-whole-archive $(LDFLAGS) \
++ $($*_deps) $($*_sysdeps)
++
++%.so.$(NCBI_VERSION_MAJOR): %.$(so)
++ ln -s $< $@
++ ln -s $< $*.so
++
++# Make libncbiCacc and libncbiacc pointers to libncbiNacc, since it's
++# the most useful variant in the usual (net-only) case. Do the same
++# for libnetentr, and link the static version into libncbiNacc.so, due
++# to a circular dependency.
++libnetentr.$(so) libncbiCacc.$(so) libncbiacc.$(so):
++ ln -s libncbiNacc.$(so) $@
++
++# Standardize on the OpenGL-enabled versions of Vibrant, since there's
++# no longer any real penalty in doing so.
++libvibrant.$(so):
++ ln -s libvibrantOGL.$(so) $@
++libncbicn3d.$(so):
++ ln -s libncbicn3dOGL.$(so) $@
++
++libblast_deps = libblastcompadj.$(so) libncbi.$(so)
++libblast_sysdeps = -lm
++libblastapi_deps = libblast.$(so) libncbitool.$(so) libncbiobj.$(so) \
++ libncbi.$(so)
++libblastapi_sysdeps = -lm
++libblastcompadj_sysdeps = -lm
++libconnssl_deps = libncbi.$(so)
++libconnssl_sysdeps = -lgnutls
++libncbi_sysdeps = -lm
++# libncbiCacc_deps = libncbicdr.$(so) libnetentr.a libnetcli.$(so)
++libncbiNacc_deps = libncbicdr.$(so) libnetentr.a libnetcli.$(so) \
++ libncbiobj.$(so) libncbi.$(so)
++libncbiNacc_sysdeps = -lm
++# libncbiacc_deps = libncbicdr.$(so)
++libncbicdr_deps = libncbiobj.$(so) libncbi.$(so)
++libncbiid1_deps = libncbiobj.$(so) libnetcli.$(so) libncbi.$(so)
++libncbimla_deps = libncbiobj.$(so) libnetcli.$(so) libncbi.$(so)
++libncbimmdb_deps = libncbiid1.$(so) libncbitool.$(so) libncbiobj.$(so) \
++ libncbi.$(so)
++libncbimmdb_sysdeps = -lm
++libncbiobj_deps = libncbi.$(so)
++libncbiobj_sysdeps = -lm
++libncbitool_deps = libblastcompadj.$(so) libncbiobj.$(so) libncbi.$(so)
++libncbitool_sysdeps = -lm
++libncbitxc2_deps = libncbitool.$(so) libnetcli.$(so) libncbiobj.$(so) \
++ libncbi.$(so)
++libncbitxc2_sysdeps = -lm
++libnetblast_deps = libncbitool.$(so) libnetcli.$(so) libncbiobj.$(so) \
++ libncbi.$(so)
++libnetcli_deps = libncbi.$(so)
++# libnetentr_deps = libncbiacc.$(so) libnetcli.$(so)
++libvibgif_deps = libncbi.$(so)
++libvibgif_sysdeps = -lm
++
++libddvlib_deps = libncbidesk.$(so) libvibrantOGL.$(so) \
++ libncbitool.$(so) libncbiobj.$(so) libncbi.$(so)
++libncbicn3d_deps = libncbiNacc.$(so) libddvlib.$(so) libncbidesk.$(so) \
++ libncbimmdb.$(so) libncbitool.$(so) libncbiobj.$(so) \
++ libncbi.$(so)
++libncbicn3dOGL_deps = $(libncbicn3d_deps) libvibrantOGL.$(so)
++libncbicn3dOGL_sysdeps = -lm
++libncbidesk_deps = libblastapi.$(so) libncbimmdb.$(so) libncbitool.$(so) \
++ libvibrantOGL.$(so) libncbiobj.$(so) libncbi.$(so)
++libncbidesk_sysdeps = -lm
++libvibnet_deps = libncbiNacc.$(so) libncbidesk.$(so) libncbimmdb.$(so) \
++ libvibrantOGL.$(so) libncbitool.$(so) \
++ libncbicdr.$(so) libncbiobj.$(so) libncbi.$(so)
++# libvibrant_deps = libncbi.$(so)
++# libvibrant_sysdeps = $(VIBLIBS)
++# for ddvcolor stuff
++libvibrantOGL_deps = libncbiobj.$(so) libncbi.$(so)
++libvibrantOGL_sysdeps = $(OGLLIBS) $(VIBLIBS) -lm
++
++# XXX - is there a way to express these programmatically?
++libblast.$(so): $(libblast_deps)
++libblastapi.$(so): $(libblastapi_deps)
++libconnssl.$(so): $(libconnssl_deps)
++# libncbiCacc.$(so): $(libncbiCacc_deps)
++libncbiNacc.$(so): $(libncbiNacc_deps)
++# libncbiacc.$(so): $(libncbiacc_deps)
++libncbicdr.$(so): $(libncbicdr_deps)
++libncbiid1.$(so): $(libncbiid1_deps)
++libncbimla.$(so): $(libncbimla_deps)
++libncbimmdb.$(so): $(libncbimmdb_deps)
++libncbiobj.$(so): $(libncbiobj_deps)
++libncbitool.$(so): $(libncbitool_deps)
++libncbitxc2.$(so): $(libncbitxc2_deps)
++libnetblast.$(so): $(libnetblast_deps)
++libnetcli.$(so): $(libnetcli_deps)
++# libnetentr.$(so): $(libnetentr_deps)
++
++libddvlib.$(so): $(libddvlib_deps)
++# libncbicn3d.$(so): $(libncbicn3d_deps)
++libncbicn3dOGL.$(so): $(libncbicn3dOGL_deps)
++libncbidesk.$(so): $(libncbidesk_deps)
++libvibgif.$(so): $(libvibgif_deps)
++libvibnet.$(so): $(libvibnet_deps)
++# libvibrant.$(so): $(libvibrant_deps)
++libvibrantOGL.$(so): $(libvibrantOGL_deps)
+--- ncbi-tools6-6.1.20170106+dfsg1.orig/tools/readdb.c
++++ ncbi-tools6-6.1.20170106+dfsg1/tools/readdb.c
+@@ -10167,7 +10167,10 @@ static Int2 FDBFinish (FormatDBPtr
+ return 1;
+
+ MemSet(dateTime, 0, DATETIME_LENGTH);
+- Nlm_DayTimeStr(dateTime, TRUE, TRUE);
++ /* SOURCE_DATE_EPOCH specification: "If the value is malformed, the
++ build process SHOULD exit with a non-zero error code." */
++ if (!Nlm_DayTimeStr(dateTime, TRUE, TRUE))
++ return 1;
+
+ /* write db_title and date-time stamp eigth bytes aligned */
+ tmp = title_len + StringLen(dateTime);
+--- ncbi-tools6-6.1.20170106+dfsg1.orig/vibrant/netscape.c
++++ ncbi-tools6-6.1.20170106+dfsg1/vibrant/netscape.c
+@@ -548,9 +548,8 @@ static Boolean NS_LoadNetscape(const cha
+ }
+
+ /* ---------- child process ------------ */
+- if (execlp("netscape", "netscape", url, NULL) < 0 &&
+- execl(NETSCAPE_PATH, NETSCAPE_PATH, url, NULL) < 0) {
+- Message(MSG_ERROR, "Failure to open URL in netscape window");
++ if (execlp("sensible-browser", "sensible-browser", url, NULL) < 0) {
++ Message(MSG_ERROR, "Failure to open URL in browser window");
+ exit(1);
+ }
+
+--- ncbi-tools6-6.1.20170106+dfsg1.orig/vibrant/shim3d.c
++++ ncbi-tools6-6.1.20170106+dfsg1/vibrant/shim3d.c
+@@ -321,6 +321,7 @@
+
+ #ifdef _PNG
+ #include <png.h> /* must go berore ncbi headers */
++#include <zlib.h>
+ #ifndef png_jmpbuf
+ #define png_jmpbuf(x) ((x)->jmpbuf)
+ #endif
+@@ -339,7 +340,8 @@ NLM_EXTERN void LIBCALL Nlm_HeapSort PRO
+ #include <ddvcolor.h>
+
+ #if defined(_OPENGL) && defined(_PNG)
+-TOGL_Data *Cn3D_GetCurrentOGLData(void); /* in cn3dxprt.c */
++/* In cn3dxprt.c; declared weak here to avoid dependency loops. */
++extern TOGL_Data *Cn3D_GetCurrentOGLData(void) __attribute__((weak));
+ #endif
+
+
+@@ -2939,7 +2941,15 @@ void Nlm_SaveImagePNG(Nlm_Char *fname)
+ png_structp png_ptr = NULL;
+ png_infop info_ptr = NULL;
+ Nlm_Boolean doInterlacing = TRUE;
+- TOGL_Data *OGL_Data = (TOGL_Data *)(Cn3D_GetCurrentOGLData());
++ TOGL_Data *OGL_Data;
++
++ if (!Cn3D_GetCurrentOGLData) {
++ Message(MSG_ERROR, "PNG output unavailable; "
++ "please relink application with -lncbicn3d.");
++ return;
++ }
++
++ OGL_Data = (TOGL_Data *)(Cn3D_GetCurrentOGLData());
+
+ #if defined(WIN_MOTIF)
+ GLint glSize;
+@@ -3720,4 +3730,3 @@ void Nlm_AddHalfWorm3D(Nlm_Picture3D pic
+ if (fblock)
+ MemFree(fblock);
+ }
+-
+--- ncbi-tools6-6.1.20170106+dfsg1.orig/vibrant/vibmain.c
++++ ncbi-tools6-6.1.20170106+dfsg1/vibrant/vibmain.c
+@@ -44,6 +44,21 @@
+
+
+
++extern Nlm_Int2 Nlm_Main(void) __attribute__((weak));
++
++static Nlm_Int2 s_CallNlmMain(void)
++{
++ if (Nlm_Main) {
++ return Nlm_Main();
++ } else {
++ ErrPost(0, 0, "Neither main nor Nlm_Main defined by program.");
++ return -1;
++ }
++}
++
++#define Nlm_Main s_CallNlmMain
++
++
+ #ifdef WIN_MAC
+ #ifdef OS_UNIX_DARWIN
+ int main (int argc, char *argv[])
+--- ncbi-tools6-6.1.20170106+dfsg1.orig/vibrant/vibwndws.c
++++ ncbi-tools6-6.1.20170106+dfsg1/vibrant/vibwndws.c
+@@ -6818,7 +6818,7 @@ extern void Nlm_VibMainPrelude (int argc
+ Nlm_InitPrompt ();
+ Nlm_InitSlate ();
+ Nlm_InitTexts ();
+- if (! Nlm_SetupWindows ()) return;
++ if (! Nlm_SetupWindows ()) exit(1);
+ Nlm_RegisterWindows ();
+ Nlm_RegisterTexts ();
+ Nlm_RegisterSlates ();
diff --git a/debian/patches/series b/debian/patches/series
new file mode 100644
index 00000000..7bb82529
--- /dev/null
+++ b/debian/patches/series
@@ -0,0 +1 @@
+debian-changes
diff --git a/debian/rules b/debian/rules
new file mode 100755
index 00000000..ec229776
--- /dev/null
+++ b/debian/rules
@@ -0,0 +1,225 @@
+#!/usr/bin/make -f
+DEB_VERSION=$(shell dpkg-parsechangelog | awk '/^Version:/ { print $$2 }')
+export NCBI_VERSION_FULL=$(DEB_VERSION)
+export NCBI_VERSION=$(word 1, $(subst -, ,$(NCBI_VERSION_FULL)))
+export NCBI_VERSION_MAJOR=$(word 1, $(subst ., ,$(NCBI_VERSION)))
+export NCBI_VERSION_MINOR=$(NCBI_VERSION:$(NCBI_VERSION_MAJOR).%=%)
+export NCBI_VERSION_DATE =$(word 3, $(subst ., ,$(NCBI_VERSION)))
+export NCBI_VERSION_DEBREL=$(word 2, $(subst -, ,$(NCBI_VERSION_FULL)))
+
+testversions:
+ env | fgrep NCBI_VERSION
+
+# Set these here, rather than using the csh hackage that passes for an
+# upstream build system. Mostly taken from ../platform/{ppc,}linux.ncbi.mk.
+include /usr/share/dpkg/buildtools.mk
+VIBFLAG = -DWIN_MOTIF
+VIBLIBS = -lXm -lXmu -lXt -lX11 # -lXext # -lXp
+OTHERLIBS = -lm
+RANLIB = ranlib
+MT_OTHERLIBS = -lpthread
+THREAD_OBJ = ncbithr.o
+NETENTREZVERSION = 2.02c2ASN1SPEC6
+
+export DEB_BUILD_MAINT_OPTIONS=hardening=+all
+
+CFLAGS := $(shell dpkg-buildflags --get CFLAGS) -Wall \
+ $(shell dpkg-buildflags --get CPPFLAGS)
+ifeq ($(DEB_HOST_ARCH),alpha)
+CFLAGS += -mieee
+endif
+CFLAGS_PIC = $(filter-out -fPIE,$(CFLAGS)) -fPIC
+LDFLAGS := $(shell dpkg-buildflags --get LDFLAGS)
+LDFLAGS1 := $(CFLAGS) $(LDFLAGS) -Wl,--as-needed -Wl,-rpath-link,../shlib
+
+OGL_TARGETS = Cn3D
+OGL_LIBVARS = LIB400=libvibrantOGL.a LIB3000=libncbicn3dOGL.a
+OGLLIBS = -lGLU -lGL
+
+PNG_INCLUDE = -D_PNG
+PNG_LIBS = -lpng # -lz
+
+USESHLIB = NCBI_LINKINGLIBDIR="../shlib"
+MAKESHLIB = $(USESHLIB) NCBI_SHLIBS=shlib
+# Controls how shared libraries are built; appropriate for ELF w/GNU tools.
+
+export NCBI_LBSM_SRC=ncbi_lbsmd_stub.c
+export NCBI_LBSM_OBJ=ncbi_lbsmd_stub.o
+
+VIB = Psequin sbtedit udv ddv taxblast idfetch asn2gb tbl2asn gene2xml \
+ entrez2 gbseqget asn2all asn2asn asn2fsa asn2xml asndisc asnmacro \
+ asnval cleanasn insdseqget nps2gps spidey trna2sap trna2tbl \
+ $(OGL_TARGETS)
+
+#OTHERS = others
+OTHERS = libncbimla.a libnetblast.a libncbitxc2.a libncbiid1.a shlib
+
+COMMON_FLAGS = LCL=lnx CC="$(CC)" LDFLAGS1="$(LDFLAGS1)" RAN="$(RANLIB)"
+COMMON_FLAGS += OTHERLIBS="$(OTHERLIBS)" VIBLIBS="$(VIBLIBS)"
+COMMON_FLAGS += VIBFLAG="$(VIBFLAG)" GNUTLS_INCLUDE=-DHAVE_LIBGNUTLS
+
+ICONS = debian/asntool.xpm debian/ncbilogo.xpm
+
+MAKE_IN_BUILD = $(MAKE) -C build
+
+%:
+ dh $@
+
+# Explicit rule to avoid an infinite loop
+build:
+ dh $@
+
+override_dh_auto_build-arch:
+ cd build && ln -s ../make/*.unx .
+ ln -s ../make/ln-if-absent build
+ mv build/makeall.unx build/makefile
+ $(MAKE_IN_BUILD) all $(COMMON_FLAGS) $(USESHLIB) \
+ CFLAGS1="-c $(CFLAGS_PIC) $(PNG_INCLUDE)" \
+ LIB4=libvibrant.a LIB20=libncbidesk.a LIB28=libvibgif.a \
+ LIB30=libncbicn3d.a LIB45=libddvlib.a $(OGL_LIBVARS)
+ $(MAKE_IN_BUILD) -f makenet.unx $(COMMON_FLAGS) $(USESHLIB) \
+ CFLAGS1="-c $(CFLAGS_PIC)" \
+ LDFLAGS="$(filter-out -fPIE -pie,$(LDFLAGS))" \
+ NETENTREZVERSION="$(NETENTREZVERSION)" \
+ BLIB31=libvibnet.a OGLLIBS="$(OGLLIBS) $(PNG_LIBS)" all $(OTHERS)
+# Clear out the PIC objects
+ $(MAKE_IN_BUILD) clean
+
+ $(MAKE_IN_BUILD) all $(COMMON_FLAGS) $(USESHLIB) \
+ CFLAGS1="-c $(CFLAGS) $(PNG_INCLUDE)" \
+ LIB4=libvibrant.a LIB20=libncbidesk.a LIB28=libvibgif.a \
+ LIB30=libncbicn3d.a LIB45=libddvlib.a $(OGL_LIBVARS)
+# Build demos without vibrant to avoid unnecessary dependencies;
+# users who want the Vibrant UI can use vibrate(1).
+ $(MAKE_IN_BUILD) -f makedemo.unx $(COMMON_FLAGS) $(USESHLIB) \
+ CFLAGS1="-c $(CFLAGS)" VIBLIBS= VIBFLAG= LIB50=-lpcre
+# Don't bother passing OGLLIBS or VIBLIBS, which apps don't use directly.
+ $(MAKE_IN_BUILD) -f makenet.unx $(COMMON_FLAGS) $(USESHLIB) \
+ CFLAGS1="-c $(CFLAGS)" THREAD_OBJ="$(THREAD_OBJ)" \
+ THREAD_OTHERLIBS="$(MT_OTHERLIBS)" \
+ NETENTREZVERSION="$(NETENTREZVERSION)" BLIB31=libvibnet.a \
+ OGLLIBS= VIBLIBS= VIB="$(VIB)"
+# date > VERSION
+
+override_dh_auto_clean:
+ -rm -rf build/* bin/* include/* lib/* shlib
+ mkdir -p build bin include lib
+ -rm -f debian/*.menu $(ICONS)
+ chmod -x debian/makemenu debian/installman
+
+DEB_HOST_MULTIARCH ?= $(shell dpkg-architecture -qDEB_HOST_MULTIARCH)
+destlibdir=debian/tmp/usr/lib/$(DEB_HOST_MULTIARCH)
+icon_in = link/mswin/ncbilogo.ico
+hi = debian/ncbi-data/usr/share/icons/hicolor
+
+override_dh_auto_install-arch:
+ install -d $(destlibdir)
+ install -m 644 lib/* shlib/*.so.$(NCBI_VERSION) $(destlibdir)
+ for x in ncbiacc ncbiCacc netentr; do \
+ rm -f $(destlibdir)/lib$$x.so.$(NCBI_VERSION) && \
+ ln -s libncbiNacc.so.$(NCBI_VERSION_MAJOR) \
+ $(destlibdir)/lib$$x.so.$(NCBI_VERSION_MAJOR) && \
+ ln -s libncbiNacc.so $(destlibdir)/lib$$x.so; \
+ done
+ for x in ncbicn3d vibrant; do \
+ rm -f $(destlibdir)/lib$$x.so.$(NCBI_VERSION) && \
+ ln -s lib$${x}OGL.so.$(NCBI_VERSION_MAJOR) \
+ $(destlibdir)/lib$$x.so.$(NCBI_VERSION_MAJOR) && \
+ ln -s lib$${x}OGL.so $(destlibdir)/lib$$x.so; \
+ done
+ rm -f $(destlibdir)/libregexp.*
+ cd $(destlibdir) && \
+ for f in *.so.$(NCBI_VERSION); do \
+ base=`basename $$f .so.$(NCBI_VERSION)` && \
+ ln -s $$f $$base.so.$(NCBI_VERSION_MAJOR) && \
+ ln -s $$f $$base.so; \
+ done
+
+ install -d debian/tmp/usr/include/ncbi
+ cp -LRp include/* debian/tmp/usr/include/ncbi
+ cd debian/tmp/usr/include/ncbi && \
+ rm -f FSpCompat.h FullPath.h More*.h Optimization*.h pcre*.h
+ find debian/tmp/usr/include -type f | xargs chmod 644
+
+ install -d debian/tmp/usr/bin
+ install `find build -type f -perm /111 -print` debian/tmp/usr/bin
+ rm -f debian/tmp/usr/bin/*test*
+ rm -f debian/tmp/usr/bin/*demo*
+# Useless as a binary, and seems to be broken anyway
+ rm -f debian/tmp/usr/bin/dosimple
+# Seems to be a functional version of sort(1) with no special features
+# (but lacking some features of GNU sort)
+ rm -f debian/tmp/usr/bin/ncbisort
+# Obsolete
+ rm -f debian/tmp/usr/bin/cdscan
+ rm -f debian/tmp/usr/bin/entrcmd
+# install -d debian/tmp/usr/lib/cgi-bin
+ mv debian/tmp/usr/bin/Cn3D debian/tmp/usr/bin/Cn3D-3.0
+# mv debian/tmp/usr/bin/fmerge debian/tmp/usr/bin/fastamerge
+
+override_dh_auto_install-indep:
+ convert link/mswin/asntool.ico debian/asntool.xpm
+ icotool -x -w 32 -b 32 -o - $(icon_in) | \
+ convert png:- debian/ncbilogo.xpm
+ install -d debian/ncbi-data/etc/ncbi
+ install -m 644 debian/.*rc debian/ncbi-data/etc/ncbi
+ install -d debian/ncbi-data/usr/bin
+ install debian/vibrate debian/ncbi-data/usr/bin
+ install -d debian/ncbi-data/usr/share/ncbi/data
+ install -m 644 data/* debian/ncbi-data/usr/share/ncbi/data
+ install -d debian/ncbi-rrna-data/usr/share/ncbi/data
+ mv debian/ncbi-data/usr/share/ncbi/data/*_[n9]*.n?? \
+ debian/ncbi-data/usr/share/ncbi/data/rRNA*.nal \
+ debian/ncbi-data/usr/share/ncbi/data/Combined16SrRNA.n?? \
+ debian/ncbi-rrna-data/usr/share/ncbi/data/
+ install -d debian/ncbi-data/usr/share/pixmaps
+ install -m 644 $(ICONS) debian/ncbi-data/usr/share/pixmaps
+ for w in 16 32 48 256; do \
+ d=$${w}x$${w} && \
+ install -d $(hi)/$$d && \
+ icotool -x -w $$w -b 32 -o $(hi)/$$d/ncbilogo.png $(icon_in) \
+ || exit 1 ; \
+ done
+
+override_dh_installchangelogs:
+ dh_installchangelogs -k README
+
+override_dh_installmenu-arch:
+ chmod +x debian/makemenu
+ debian/makemenu debian/ncbi-cn3d.install
+ debian/makemenu debian/ncbi-tools-x11.install
+# debian/makemenu -v debian/ncbi-tools-bin.install
+ dh_installmenu
+
+override_dh_installdocs-arch:
+ dh_installdocs
+ install -m 644 config/README \
+ debian/libncbi6/usr/share/doc/libncbi6/README.config
+ install -m 644 network/nsclilib/readme \
+ debian/libncbi6/usr/share/doc/libncbi6/README.net-cfg
+ install -m 644 doc/fa2htgs/README \
+ debian/ncbi-tools-bin/usr/share/doc/ncbi-tools-bin/README.fa2htgs
+ install -m 644 sequin/README \
+ debian/ncbi-tools-x11/usr/share/doc/ncbi-tools-x11/README.sequin
+
+override_dh_installman:
+ dh_link # otherwise runs too late to influence debian/installman
+ chmod +x debian/installman
+ifneq "" "$(filter ncbi-tools-bin, $(shell dh_listpackages))"
+ debian/installman ncbi-cn3d
+ debian/installman ncbi-tools-bin
+ debian/installman ncbi-tools-x11
+endif
+ifneq "" "$(filter ncbi-data, $(shell dh_listpackages))"
+ debian/installman ncbi-data
+endif
+ dh_installman
+
+override_dh_makeshlibs-arch:
+ dh_makeshlibs -V
+
+override_dh_builddeb:
+ dh_builddeb -pncbi-rrna-data -- -Zxz -z7 -Sextreme
+ dh_builddeb -Nncbi-rrna-data
+
+.PHONY: build
diff --git a/debian/sbtedit.desktop.in b/debian/sbtedit.desktop.in
new file mode 100644
index 00000000..a553c789
--- /dev/null
+++ b/debian/sbtedit.desktop.in
@@ -0,0 +1,3 @@
+Name=GenBank Submission Template Editor
+GenericName=Template Editor
+Comment=Edit GenBank submission templates, as used by Sequin.
diff --git a/debian/source/format b/debian/source/format
new file mode 100644
index 00000000..163aaf8d
--- /dev/null
+++ b/debian/source/format
@@ -0,0 +1 @@
+3.0 (quilt)
diff --git a/debian/source/include-binaries b/debian/source/include-binaries
new file mode 100644
index 00000000..4773c5d7
--- /dev/null
+++ b/debian/source/include-binaries
@@ -0,0 +1,7 @@
+debian/bkgd.gif
+debian/left.gif
+debian/spacer10.gif
+debian/tests/test-data/nc0225.aso.gz
+debian/tests/test-data/dsRNA_viruses.ags.gz
+debian/tests/test-data/dsRNA_viruses.gene_info.gz
+debian/tests/test-data/spidey_genome.fasta.gz
diff --git a/debian/source/options b/debian/source/options
new file mode 100644
index 00000000..7423a2df
--- /dev/null
+++ b/debian/source/options
@@ -0,0 +1 @@
+single-debian-patch
diff --git a/debian/source/patch-header b/debian/source/patch-header
new file mode 100644
index 00000000..d0dfb956
--- /dev/null
+++ b/debian/source/patch-header
@@ -0,0 +1 @@
+Combined patches from git.
diff --git a/debian/spacer10.gif b/debian/spacer10.gif
new file mode 100644
index 00000000..b606a217
--- /dev/null
+++ b/debian/spacer10.gif
Binary files differ
diff --git a/debian/tests/control b/debian/tests/control
new file mode 100644
index 00000000..2d33ca5e
--- /dev/null
+++ b/debian/tests/control
@@ -0,0 +1,3 @@
+Tests: run-unit-test
+Depends: netcat, @
+Restrictions: allow-stderr
diff --git a/debian/tests/run-unit-test b/debian/tests/run-unit-test
new file mode 100644
index 00000000..acf9916b
--- /dev/null
+++ b/debian/tests/run-unit-test
@@ -0,0 +1,220 @@
+#!/bin/bash
+set -e
+
+pkg="ncbi-tools-bin"
+
+if [ "$AUTOPKGTEST_TMP" = "" ] ; then
+ AUTOPKGTEST_TMP=$(mktemp -d /tmp/${pkg}-test.XXXXXX)
+ trap "rm -rf $AUTOPKGTEST_TMP" 0 INT QUIT ABRT PIPE TERM
+fi
+cd $AUTOPKGTEST_TMP
+cp -a /usr/share/doc/${pkg}/test-data/* .
+cp /usr/share/doc/${pkg}/{asnpub.all.gz,medline.prt.gz} .
+cp /usr/share/ncbi/data/autofix.prt .
+cp /usr/share/ncbi/data/UniVec.* .
+gunzip *.gz
+
+check_GI()
+{
+ while read GI; do
+ grep -q $GI $1
+ done < $2
+}
+
+##################################################################
+echo '---asn2asn test---'
+##################################################################
+/usr/bin/asn2asn -i nc0225.aso -b -o nc0225.text
+[ -s nc0225.text ]
+/usr/bin/asn2asn -i nc0225.text -s -o nc0225_new.aso
+[ -s nc0225_new.aso ]
+diff nc0225.aso nc0225_new.aso
+rm nc0225.aso nc0225_new.aso
+
+##################################################################
+echo '---asn2all test---'
+##################################################################
+/usr/bin/asn2all -i nc0225.text -f g -o nc0225.nuc -v nc0225.prt
+[ -s nc0225.nuc ]
+genes_dna="$(grep -c " mol dna ," nc0225.text)"
+genes_rna="$(grep -c " mol rna ," nc0225.text)"
+genes=$(expr $genes_dna + $genes_rna)
+nuc="$(grep -c "^LOCUS " nc0225.nuc)"
+[ $genes -eq $nuc ]
+[ -s nc0225.prt ]
+proteins="$(grep -c " mol aa ," nc0225.text)"
+prt="$(grep -c "^LOCUS " nc0225.prt)"
+[ $proteins -eq $prt ]
+
+##################################################################
+echo '---asn2fsa test---'
+##################################################################
+/usr/bin/asn2fsa -i nc0225.text -a t -o nc0225.fna -v nc0225.faa
+[ -s nc0225.fna ]
+fna="$(grep -c "^>" nc0225.fna)"
+[ $genes -eq $fna ]
+[ -s nc0225.faa ]
+faa="$(grep -c "^>" nc0225.faa)"
+[ $proteins -eq $faa ]
+
+##################################################################
+echo '---asn2gb test---'
+##################################################################
+/usr/bin/asn2gb -i nc0225.text -a t -o nc0225.gbk
+[ -s nc0225.gbk ]
+gbk="$(grep -c "^LOCUS " nc0225.gbk)"
+[ $genes -eq $gbk ]
+
+##################################################################
+echo '---asn2idx test---'
+##################################################################
+/usr/bin/asn2idx -p . -x .text < nc0225.text
+[ -s nc0225.idx ]
+[ -s master.idx ]
+awk 'NR == 1 || NR % 50 == 0 {print $1}' nc0225.idx | sed 's/\.1//' > indexed_GIs
+check_GI nc0225.text indexed_GIs
+
+##################################################################
+echo '---asn2xml test---'
+##################################################################
+/usr/bin/asn2xml -i nc0225.text -b F -o nc0225.xml
+[ -s nc0225.xml ]
+dna_xml="$(grep -c '<Seq-inst_mol value="dna"/>' nc0225.xml)"
+rna_xml="$(grep -c '<Seq-inst_mol value="rna"/>' nc0225.xml)"
+proteins_xml="$(grep -c '<Seq-inst_mol value="aa"/>' nc0225.xml)"
+[ $genes -eq $(expr $dna_xml + $rna_xml) ]
+[ $proteins -eq $proteins_xml ]
+
+##################################################################
+echo '---cleanasn test---'
+##################################################################
+/usr/bin/cleanasn -a t -D t -i nc0225.text -o nc0225_cleaned.text
+[ -s nc0225_cleaned.text ]
+titles="$(grep -c " title \"" nc0225.text)"
+titles_to_clean="$(grep -A 1 " descr {$" nc0225.text | grep -c " title \"")"
+titles_left="$(grep -c " title \"" nc0225_cleaned.text)"
+[ $(expr $titles - $titles_to_clean) -eq $titles_left ]
+
+##################################################################
+echo '---gene2xml test---'
+##################################################################
+/usr/bin/gene2xml -b -i dsRNA_viruses.ags -o dsRNA_viruses.xgs
+[ -s dsRNA_viruses.xgs ]
+# The content in dsRNA_viruses.gene_info mirrors the content in dsRNA_viruses.ags
+first_id="$(awk 'NR==2{print $1}' dsRNA_viruses.gene_info)"
+last_id="$(awk 'END{print $1}' dsRNA_viruses.gene_info)"
+# check the beginning of the output
+start_in="$(grep -c "^${first_id}" dsRNA_viruses.gene_info)"
+start_out="$(grep -c "<Object-id_id>${first_id}</Object-id_id>" dsRNA_viruses.xgs)"
+[ $start_in -eq $start_out ]
+#check the ending of the output
+end_in="$(grep -c "^${last_id}" dsRNA_viruses.gene_info)"
+end_out="$(grep -c "<Object-id_id>${last_id}</Object-id_id>" dsRNA_viruses.xgs)"
+[ $end_in -eq $end_out ]
+
+grep 'GI:' nc0225.gbk | head | sed 's/.*GI://' > GIs.txt
+
+if nc -z -w 1 www.ncbi.nlm.nih.gov 80; then
+ ##################################################################
+ echo '---gbseqget test---'
+ ##################################################################
+ /usr/bin/gbseqget -i GIs.txt -o gbseqget.xml
+ [ -s gbseqget.xml ]
+ check_GI gbseqget.xml GIs.txt
+ ##################################################################
+ echo '---insdseqget test---'
+ ##################################################################
+ /usr/bin/insdseqget -i GIs.txt > insdset.xml
+ [ -s insdset.xml ]
+ check_GI insdset.xml GIs.txt
+ ##################################################################
+ echo '---idfetch test---'
+ ##################################################################
+ /usr/bin/idfetch -G GIs.txt -o idfetch.text
+ [ -s idfetch.text ]
+ check_GI idfetch.text GIs.txt
+fi
+
+
+##################################################################
+echo '---vecscreen test---'
+##################################################################
+/usr/bin/vecscreen -f 3 < nc0225.fna > vecscreen.output
+[ -s vecscreen.output ]
+last_in="$(grep ">" nc0225.fna | tail -1 | sed 's/>//' | sed 's/ .*//')"
+last_out="$(grep ">" vecscreen.output | tail -1 | sed 's/>Vector //' | sed 's/ .*//')"
+[ $last_in==$last_out ]
+
+
+echo '---asndisc test---'
+/usr/bin/asndisc -i nc0225.text -a t -o nc0225.disc
+[ -s nc0225.disc ]
+
+echo '---asnval test---'
+/usr/bin/asnval -i nc0225.text -a t -o nc0225.val -Q 2
+[ -s nc0225.val ]
+
+echo '---asnmacro test---'
+/usr/bin/asnmacro -i nc0225.text -m autofix.prt -o asnmacro.output
+[ -s asnmacro.output ]
+
+echo '---asntool test---'
+/usr/bin/asntool -m asnpub.all -v medline.prt -e medline.val
+[ -s medline.val ]
+
+echo '---indexpub test---'
+/usr/bin/indexpub -i medline.val
+[ -s medline.idx ]
+
+echo '---getpub test---'
+/usr/bin/getpub -i medline.val -o getpub.output
+[ -s getpub.output ]
+
+echo '---getmesh test---'
+/usr/bin/getmesh -i getpub.output -o getmesh.output
+[ -s getmesh.output ]
+
+echo '---debruijn test---'
+/usr/bin/debruijn -a ncbistdaa -n 4 > debruijn.output
+[ -s debruijn.output ]
+
+echo '---gil2bin test---'
+/usr/bin/gil2bin -i GIs.txt -o GIs.bin
+[ -s GIs.bin ]
+
+echo '---makeset test---'
+echo 'idfetch_g1234.npset' > files
+/usr/bin/makeset -i files -o makeset.output
+[ -s makeset.output ]
+
+echo '---nps2gps test---'
+/usr/bin/nps2gps -i idfetch_g1234.npset -o nps2gps.output
+[ -s nps2gps.output ]
+
+echo '---tbl2asn test---'
+/usr/bin/tbl2asn -t Sc_16.sbt -i Sc_16.fsa
+[ -s Sc_16.sqn ]
+
+echo '---checksub test---'
+/usr/bin/checksub -i Sc_16.sqn -o checksub.sqn
+diff Sc_16.sqn checksub.sqn
+
+echo '---fa2htgs test---'
+/usr/bin/fa2htgs -i Sc_16.fsa -t Sc_16.sqn -n "Saccharomyces cerevisiae" -g mycenter -s ABC_1234567 -o fa2htgs.output -e fa2htgs.log
+[ -s fa2htgs.output ]
+
+echo '---subfuse test---'
+/usr/bin/subfuse -p ./ -o subfuse.output
+[ -s subfuse.output ]
+
+echo '---trna2sap test---'
+/usr/bin/trna2sap < trnascan-se_sample.output > trna2sap.output
+[ -s trna2sap.output ]
+echo '---trna2tbl test---'
+/usr/bin/trna2tbl < trnascan-se_sample.output > trna2tbl.output
+[ -s trna2tbl.output ]
+
+echo '---spidey test---'
+/usr/bin/spidey -i spidey_genome.fasta -m spidey_mRNA.fasta -p 1 -o spidey.summary
+[ -s spidey.summary ]
+
diff --git a/debian/tests/test-data/Sc_16.fsa b/debian/tests/test-data/Sc_16.fsa
new file mode 100644
index 00000000..498bda2f
--- /dev/null
+++ b/debian/tests/test-data/Sc_16.fsa
@@ -0,0 +1,14 @@
+>Sc_16 [organism=Saccharomyces cerevisiae]
+tataggcgaatcgagtatattattttttctcaacatatgtat
+atgaacatgagaatatatttataggaatgtataaaattgtga
+cctctcctgctattttagttactgattttatgtatgtagggg
+gaataggggctgcctttcttaatgcagttttaattttttctt
+ttaattttttcttagtaaaattatttaaagtaaagattaatg
+gaataaccattgcgcttttttttacagtttttggtttttcat
+tttttggaaaaaatattttaaatattttacctttttatttag
+ggggtattttatatagtatctatacttcaacagatttttctg
+aacatatagttcctattgctttttcaagtgcattagcccctt
+ttgtaagcagtgttgctttttatggagaaatatcctatgaaa
+catcatatataaatgcaattttaattggtattttaattggtt
+ttatagtggttcctttgtctaaaagtctttatgactttcatg
+agggatatgatttatataatttaggttttacagcaggtt
diff --git a/debian/tests/test-data/Sc_16.sbt b/debian/tests/test-data/Sc_16.sbt
new file mode 100644
index 00000000..38d5ea0c
--- /dev/null
+++ b/debian/tests/test-data/Sc_16.sbt
@@ -0,0 +1,139 @@
+Submit-block ::= {
+ contact {
+ contact {
+ name name {
+ last "Darwin",
+ first "Charles",
+ middle "",
+ initials "",
+ suffix "",
+ title ""
+ },
+ affil std {
+ affil "Oxbridge University",
+ div "Evolutionary Biology Department",
+ city "Camford",
+ country "United Kingdom",
+ street "1859 Tennis Court Lane",
+ email "darwin@beagle.edu.uk",
+ phone "01 44 171-007-1212",
+ postal-code "OX1 2BH"
+ }
+ }
+ },
+ cit {
+ authors {
+ names std {
+ {
+ name name {
+ last "Darwin",
+ first "Charles",
+ middle "",
+ initials "C.R.",
+ suffix "",
+ title ""
+ }
+ }
+ },
+ affil std {
+ affil "Oxbridge University",
+ div "Evolutionary Biology Department",
+ city "Camford",
+ country "United Kingdom",
+ street "1859 Tennis Court Lane",
+ postal-code "OX1 2BH"
+ }
+ }
+ },
+ subtype new
+}
+Seqdesc ::= pub {
+ pub {
+ sub {
+ authors {
+ names std {
+ {
+ name ml "Darwin C",
+ }
+ },
+ affil str "Evolutionary Biology Department, Oxbridge University,
+ Camford, 1859 Tennis Court Lane, OX1 2BH, United Kingdom."
+ },
+ date std {
+ year 2018,
+ month 5,
+ day 19
+ },
+ },
+ article {
+ title {
+ name "In-depth analysis of one mysterious hypothetical protein of
+ Saccharomyces cerevisiae."
+ },
+ authors {
+ names std {
+ {
+ name ml "Darwin C",
+ affil str "Evolutionary Biology Department, Oxbridge University,
+ Camford, 1859 Tennis Court Lane, OX1 2BH, United Kingdom."
+ },
+ }
+ },
+ from journal {
+ title {
+ iso-jta "Nature",
+ ml-jta "Nature",
+ issn "1476-4687",
+ name "Nature"
+ },
+ imp {
+ date std {
+ year 2018,
+ month 5,
+ day 19
+ },
+ language "eng",
+ pubstatus aheadofprint,
+ history {
+ {
+ pubstatus other,
+ date std {
+ year 2018,
+ month 5,
+ day 21,
+ hour 6,
+ minute 0
+ }
+ }
+ }
+ }
+ },
+ ids {
+ pubmed 87654321,
+ doi "10.0000/tpj.12345",
+ other {
+ db "ELocationID doi",
+ tag str "10.0000/tpj.12345"
+ }
+ }
+ }
+ }
+}
+Seqdesc ::= user {
+ type str "Submission",
+ data {
+ {
+ label str "AdditionalComment",
+ data str "ALT EMAIL:darwin@beagle.edu.uk"
+ }
+ }
+}
+Seqdesc ::= user {
+ type str "Submission",
+ data {
+ {
+ label str "AdditionalComment",
+ data str "Submission Title:None"
+ }
+ }
+}
diff --git a/debian/tests/test-data/Sc_16.tbl b/debian/tests/test-data/Sc_16.tbl
new file mode 100644
index 00000000..a526a189
--- /dev/null
+++ b/debian/tests/test-data/Sc_16.tbl
@@ -0,0 +1,6 @@
+>Feature Sc_16 Table1
+69 543 gene
+ gene sde3p
+69 >543 CDS
+ product SDE3P
+ protein_id WS1030
diff --git a/debian/tests/test-data/dsRNA_viruses.ags.gz b/debian/tests/test-data/dsRNA_viruses.ags.gz
new file mode 100644
index 00000000..2057d54d
--- /dev/null
+++ b/debian/tests/test-data/dsRNA_viruses.ags.gz
Binary files differ
diff --git a/debian/tests/test-data/dsRNA_viruses.gene_info.gz b/debian/tests/test-data/dsRNA_viruses.gene_info.gz
new file mode 100644
index 00000000..649cad09
--- /dev/null
+++ b/debian/tests/test-data/dsRNA_viruses.gene_info.gz
Binary files differ
diff --git a/debian/tests/test-data/idfetch_g1234.npset b/debian/tests/test-data/idfetch_g1234.npset
new file mode 100644
index 00000000..b06221de
--- /dev/null
+++ b/debian/tests/test-data/idfetch_g1234.npset
@@ -0,0 +1,457 @@
+Seq-entry ::= set {
+ level 1 ,
+ class nuc-prot ,
+ descr {
+ source {
+ org {
+ taxname "Ovis aries" ,
+ common "sheep" ,
+ db {
+ {
+ db "taxon" ,
+ tag
+ id 9940 } } ,
+ orgname {
+ name
+ binomial {
+ genus "Ovis" ,
+ species "aries" } ,
+ mod {
+ {
+ subtype strain ,
+ subname "domestic" } } ,
+ lineage "Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;
+ Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla;
+ Ruminantia; Pecora; Bovidae; Caprinae; Ovis" ,
+ gcode 1 ,
+ mgcode 2 ,
+ div "MAM" } } ,
+ subtype {
+ {
+ subtype other ,
+ name "Allele: C4-2H.1" } } } ,
+ pub {
+ pub {
+ sub {
+ authors {
+ names
+ std {
+ {
+ name
+ name {
+ last "Ren" ,
+ initials "X." } } } ,
+ affil
+ str "X. Ren, The MRC Immunochemistry Unit, Dept of Biochemistry,
+ University of Oxford, South Parks Road, Oxford OX1 3QU, UK" } ,
+ medium other ,
+ date
+ std {
+ year 1992 ,
+ month 6 ,
+ day 22 } } } } ,
+ pub {
+ pub {
+ pmid 8423050 ,
+ article {
+ title {
+ name "The thioester and isotypic sites of complement component C4
+ in sheep and cattle." } ,
+ authors {
+ names
+ std {
+ {
+ name
+ name {
+ last "Ren" ,
+ initials "X.D." } } ,
+ {
+ name
+ name {
+ last "Dodds" ,
+ initials "A.W." } } ,
+ {
+ name
+ name {
+ last "Law" ,
+ initials "S.K." } } } ,
+ affil
+ str "Department of Biochemistry, University of Oxford, UK." } ,
+ from
+ journal {
+ title {
+ iso-jta "Immunogenetics" ,
+ ml-jta "Immunogenetics" ,
+ issn "0093-7711" ,
+ name "Immunogenetics" } ,
+ imp {
+ date
+ std {
+ year 1993 } ,
+ volume "37" ,
+ issue "2" ,
+ pages "120-128" ,
+ language "eng" ,
+ pubstatus ppublish ,
+ history {
+ {
+ pubstatus pubmed ,
+ date
+ std {
+ year 1993 ,
+ month 1 ,
+ day 1 } } ,
+ {
+ pubstatus medline ,
+ date
+ std {
+ year 1993 ,
+ month 1 ,
+ day 1 ,
+ hour 0 ,
+ minute 1 } } ,
+ {
+ pubstatus other ,
+ date
+ std {
+ year 1993 ,
+ month 1 ,
+ day 1 ,
+ hour 0 ,
+ minute 0 } } } } } ,
+ ids {
+ doi "10.1007/BF00216835" ,
+ pubmed 8423050 } } } } ,
+ comment "See also X66994-99" ,
+ update-date
+ std {
+ year 2016 ,
+ month 7 ,
+ day 14 } } ,
+ seq-set {
+ seq {
+ id {
+ embl {
+ accession "X66994" ,
+ version 1 } ,
+ gi 1234 } ,
+ descr {
+ title "O.aries (C4-2H.1) C4 gene" ,
+ molinfo {
+ biomol genomic } ,
+ embl {
+ div mam ,
+ creation-date
+ std {
+ year 1992 ,
+ month 7 ,
+ day 10 } ,
+ update-date
+ std {
+ year 2006 ,
+ month 11 ,
+ day 14 } ,
+ keywords {
+ "complement component" ,
+ "complement component C4" } } ,
+ create-date
+ std {
+ year 1992 ,
+ month 7 ,
+ day 10 } } ,
+ inst {
+ repr raw ,
+ mol dna ,
+ length 945 ,
+ seq-data
+ ncbi2na '50A79AA040538577E9D411E9E7D59C5E8421624BA25E7955E214285996E
+8DD35202BDE2E49A624A2EA94A22A4BC3A09EA497ABAD224A8222392D54BA00AAF17FD45ECEBB8
+5D2793F5FD429C4668D4A0FD80088EBD73AA7EBC4DA84B245EB8BFA28BB5EAEEEA2A94AFEB8492
+25273CEA2240CA1592CFAD53B91ECBB7229CD509CE5FDDD7729D1A5FEE78231E2FE9528D2BA9A7
+71C009C4A21253BA79FD5241A8E3A74F51855ED7BCD44A8CE4ACE89EA29EA52A9128AA22D15E55
+D9476EBE79E79E70B6F12DBB5077B9855321A49514A759ED5EABDD4A42047A2EAF94FD7DD43939
+0BBFDE547D052A29F2EA098C0'H } ,
+ annot {
+ {
+ data
+ ftable {
+ {
+ data
+ rna {
+ type mRNA } ,
+ partial TRUE ,
+ location
+ mix {
+ int {
+ from 0 ,
+ to 133 ,
+ id
+ gi 1234 ,
+ fuzz-from
+ lim lt } ,
+ int {
+ from 298 ,
+ to 373 ,
+ id
+ gi 1234 } ,
+ int {
+ from 530 ,
+ to 686 ,
+ id
+ gi 1234 } ,
+ int {
+ from 924 ,
+ to 944 ,
+ id
+ gi 1234 ,
+ fuzz-to
+ lim gt } } } ,
+ {
+ data
+ imp {
+ key "exon" } ,
+ partial TRUE ,
+ location
+ int {
+ from 0 ,
+ to 133 ,
+ id
+ gi 1234 ,
+ fuzz-from
+ lim lt } ,
+ qual {
+ {
+ qual "number" ,
+ val "24" } } } ,
+ {
+ data
+ imp {
+ key "misc_feature" } ,
+ comment "thioester site" ,
+ location
+ int {
+ from 7 ,
+ to 18 ,
+ id
+ gi 1234 } } ,
+ {
+ data
+ imp {
+ key "intron" } ,
+ location
+ int {
+ from 134 ,
+ to 297 ,
+ id
+ gi 1234 } ,
+ qual {
+ {
+ qual "number" ,
+ val "24" } } } ,
+ {
+ data
+ imp {
+ key "exon" } ,
+ location
+ int {
+ from 298 ,
+ to 373 ,
+ id
+ gi 1234 } ,
+ qual {
+ {
+ qual "number" ,
+ val "25" } } } ,
+ {
+ data
+ imp {
+ key "intron" } ,
+ location
+ int {
+ from 374 ,
+ to 529 ,
+ id
+ gi 1234 } ,
+ qual {
+ {
+ qual "number" ,
+ val "25" } } } ,
+ {
+ data
+ imp {
+ key "exon" } ,
+ location
+ int {
+ from 530 ,
+ to 686 ,
+ id
+ gi 1234 } ,
+ qual {
+ {
+ qual "number" ,
+ val "26" } } } ,
+ {
+ data
+ imp {
+ key "misc_feature" } ,
+ comment "isotypic site" ,
+ location
+ int {
+ from 657 ,
+ to 674 ,
+ id
+ gi 1234 } } ,
+ {
+ data
+ imp {
+ key "intron" } ,
+ location
+ int {
+ from 687 ,
+ to 923 ,
+ id
+ gi 1234 } ,
+ qual {
+ {
+ qual "number" ,
+ val "26" } } } ,
+ {
+ data
+ imp {
+ key "exon" } ,
+ partial TRUE ,
+ location
+ int {
+ from 924 ,
+ to 944 ,
+ id
+ gi 1234 ,
+ fuzz-to
+ lim gt } ,
+ qual {
+ {
+ qual "number" ,
+ val "27" } } } ,
+ {
+ data
+ gene {
+ locus "C4" } ,
+ partial TRUE ,
+ location
+ int {
+ from 0 ,
+ to 944 ,
+ id
+ gi 1234 ,
+ fuzz-from
+ lim lt ,
+ fuzz-to
+ lim gt } } } } } } ,
+ seq {
+ id {
+ embl {
+ accession "CAA47393" ,
+ version 1 } ,
+ gi 1235 } ,
+ descr {
+ title "complement component C4, partial [Ovis aries]" ,
+ molinfo {
+ biomol peptide ,
+ completeness no-ends } ,
+ create-date
+ std {
+ year 1992 ,
+ month 7 ,
+ day 10 } } ,
+ inst {
+ repr raw ,
+ mol aa ,
+ length 129 ,
+ seq-data
+ ncbieaa "QGCGEQTMTLLAPTLAASRYLDKTEQWSLLPPETKDRAVDLIQKGYTRIQEFRKRDGSY
+GAWLHRDSSTWLTAFVLKILSLAQDQVGGSTKKLQETAMWLLSQQRDDGSFHDPCPVIHRDMQGGLVGSD" } ,
+ annot {
+ {
+ data
+ ftable {
+ {
+ data
+ prot {
+ name {
+ "complement component C4" } } ,
+ partial TRUE ,
+ location
+ int {
+ from 0 ,
+ to 128 ,
+ id
+ gi 1235 ,
+ fuzz-from
+ lim lt ,
+ fuzz-to
+ lim gt } } } } } } } ,
+ annot {
+ {
+ data
+ ftable {
+ {
+ data
+ cdregion {
+ frame two ,
+ code {
+ id 1 } } ,
+ partial TRUE ,
+ product
+ whole
+ gi 1235 ,
+ location
+ mix {
+ int {
+ from 0 ,
+ to 133 ,
+ id
+ gi 1234 ,
+ fuzz-from
+ lim lt } ,
+ int {
+ from 298 ,
+ to 373 ,
+ id
+ gi 1234 } ,
+ int {
+ from 530 ,
+ to 686 ,
+ id
+ gi 1234 } ,
+ int {
+ from 924 ,
+ to 944 ,
+ id
+ gi 1234 ,
+ fuzz-to
+ lim gt } } ,
+ dbxref {
+ {
+ db "GOA" ,
+ tag
+ str "Q29410" } ,
+ {
+ db "HSSP" ,
+ tag
+ str "1HZF" } ,
+ {
+ db "InterPro" ,
+ tag
+ str "IPR008930" } ,
+ {
+ db "InterPro" ,
+ tag
+ str "IPR011626" } ,
+ {
+ db "InterPro" ,
+ tag
+ str "IPR019565" } ,
+ {
+ db "UniProtKB/TrEMBL" ,
+ tag
+ str "Q29410" } } } } } } }
diff --git a/debian/tests/test-data/nc0225.aso.gz b/debian/tests/test-data/nc0225.aso.gz
new file mode 100644
index 00000000..3cccaa53
--- /dev/null
+++ b/debian/tests/test-data/nc0225.aso.gz
Binary files differ
diff --git a/debian/tests/test-data/spidey_genome.fasta.gz b/debian/tests/test-data/spidey_genome.fasta.gz
new file mode 100644
index 00000000..b03928ad
--- /dev/null
+++ b/debian/tests/test-data/spidey_genome.fasta.gz
Binary files differ
diff --git a/debian/tests/test-data/spidey_mRNA.fasta b/debian/tests/test-data/spidey_mRNA.fasta
new file mode 100644
index 00000000..39d3e71b
--- /dev/null
+++ b/debian/tests/test-data/spidey_mRNA.fasta
@@ -0,0 +1,83 @@
+>gi|1327850419|ref|NM_017660.4| Homo sapiens GATA zinc finger domain containing 2A (GATAD2A), transcript variant 2, mRNA
+CTAGCAACCGGGGAAGCCGGGCTGTGAAGCGGGCAATTTCAGTGTGAGACTGAGCCGCGAGACTGAGCTG
+CGGCTCCGAGCGCTGCGCGGCGGCTCCTCCCGCCCAGGGTCAGCGCCCCGGCGCGCGCACGCGCACCCCC
+GCCGCCCGAGCGCGCCCCGCGCCGCCCGCGCAGTCGGTCGGTCGGTCGTCTGTCCTGTCGCCGCTGCCGC
+CGCCGCCACAGCGGCCGCCGCGGGCGCCACCTGAGGGAGTCGCCTCCGCGGGACGCCACAAGACCTGACC
+GGACTGCGCCGCCCGAGGCCGTCGGCCGCCGTCAGCGAGGGCGCCGAGCAACTTCGTTCAGAATGACCGA
+AGAAGCATGCCGAACACGGAGTCAGAAACGAGCGCTTGAACGGGACCCAACAGAGGACGATGTGGAGAGC
+AAGAAAATAAAAATGGAGAGAGGATTGTTGGCTTCAGATTTAAACACTGACGGAGACATGAGGGTGACAC
+CTGAGCCGGGAGCAGGTCCAACCCAAGGATTGCTGAGGGCAACAGAGGCCACGGCCATGGCCATGGGCAG
+AGGCGAAGGGCTGGTGGGCGATGGGCCCGTGGACATGCGCACCTCACACAGTGACATGAAGTCCGAGAGG
+AGACCCCCCTCACCTGACGTGATTGTGCTCTCCGACAACGAGCAGCCCTCGAGCCCGAGAGTGAATGGGC
+TGACCACGGTGGCCTTGAAGGAGACTAGCACCGAGGCCCTCATGAAAAGCAGTCCTGAAGAACGAGAAAG
+GATGATCAAGCAGCTGAAGGAAGAATTGAGGTTAGAAGAAGCAAAACTCGTGTTGTTGAAAAAGTTGCGG
+CAGAGTCAAATACAAAAGGAAGCCACCGCCCAGAAGCCCACAGGTTCTGTTGGGAGCACCGTGACCACCC
+CTCCCCCGCTTGTTCGGGGCACTCAGAACATTCCTGCTGGCAAGCCATCACTCCAGACCTCTTCAGCTCG
+GATGCCCGGCAGTGTCATACCCCCGCCCCTGGTCCGAGGTGGGCAGCAGGCGTCCTCGAAGCTGGGGCCA
+CAGGCGAGCTCACAGGTCGTCATGCCCCCACTCGTCAGGGGGGCTCAGCAAATCCACAGCATTAGGCAAC
+ATTCCAGCACAGGGCCACCGCCCCTCCTCCTGGCCCCCCGGGCGTCGGTGCCCAGTGTGCAGATTCAGGG
+ACAGAGGATCATCCAGCAGGGCCTCATCCGCGTCGCCAATGTTCCCAACACCAGCCTGCTCGTCAACATC
+CCACAGCCCACCCCAGCATCACTGAAGGGGACAACAGCCACCTCCGCTCAGGCCAACTCCACCCCCACTA
+GTGTGGCCTCTGTGGTCACCTCTGCCGAGTCTCCAGCAAGCCGACAGGCGGCCGCCAAGCTGGCGCTGCG
+CAAACAGCTGGAGAAGACGCTACTCGAGATCCCCCCACCCAAGCCCCCAGCCCCAGAGATGAACTTCCTG
+CCCAGCGCCGCCAACAACGAGTTCATCTACCTGGTCGGCCTGGAGGAGGTGGTGCAGAACCTACTGGAGA
+CACAAGGCAGGATGTCGGCCGCCACTGTGCTGTCCCGGGAGCCCTACATGTGTGCACAGTGCAAGACGGA
+CTTCACGTGCCGCTGGCGGGAGGAGAAGAGCGGCGCCATCATGTGTGAGAACTGCATGACAACCAACCAG
+AAGAAGGCGCTCAAGGTGGAGCACACCAGCCGGCTGAAGGCCGCCTTTGTGAAGGCGCTGCAGCAGGAAC
+AGGAGATTGAGCAGCGGCTCCTGCAGCAGGGCACGGCCCCTGCACAGGCCAAGGCCGAGCCCACCGCTGC
+CCCACACCCCGTGCTGAAGCAGGTCATAAAACCCCGGCGTAAGTTGGCGTTCCGCTCAGGAGAGGCCCGC
+GACTGGAGTAACGGGGCTGTGCTACAGGCCTCCAGCCAGCTGTCCCGGGGTTCGGCCACGACGCCCCGAG
+GTGTCCTGCACACGTTCAGTCCGTCACCCAAACTGCAGAACTCAGCCTCGGCCACAGCCCTGGTCAGCAG
+GACCGGCAGACATTCTGAGAGAACCGTGAGCGCCGGCAAGGGCAGCGCCACCTCCAACTGGAAGAAGACG
+CCCCTCAGCACAGGCGGGACCCTTGCGTTTGTCAGCCCAAGCCTGGCGGTGCACAAGAGCTCCTCGGCCG
+TGGACCGCCAGCGAGAGTACCTCCTGGACATGATCCCACCCCGCTCCATCCCCCAGTCAGCCACGTGGAA
+ATAGTGCGAGCCAGGCCCCGTGGAAGACGGGCTCCCTCCTCCCCCACCTGGCCCCTGGTCTAGAAGGACC
+CACTGCACCACCCTCCGCTGGCTCGGGAAGACACCGTGCCCGCCCCAAGAGCAAGCACCGGCCATGCTGC
+AGAGGCAAGACCTCAATTCTTGGCTGCAAAGTTTCATCAGGGCTAGGGGGCTGGTGCCGCCTCATAGGCA
+GACGAGGATCATCGCTGGGGGACCTTTCCCGTGGGCTTTCTTCCTTTCTCTCTTTGCCTTTAGTTTGCCC
+GACACCAGCAGAAAAGTGGACCTTGGGGGCTGGTTCTGCTCCTGGCCCCCTTGTTCAGCCCCTGCCGGCA
+CACGGGCGGCTCACCCTGGACACTGTGATGCGCATGGGCAAGGCCAGCGCCCGGGGCTTCTGAACCGAGC
+GGGGTGTTTCATTTTTTTGCTTTTCCCTGTCTTAGGCTCCCAGTCTTTGACTGCCTTCCCATGGCGATCT
+ATAAGTTGAAAGATTTTTTTTTTTTTTAATCACCTCATGATGATGGAGTTAAAAGTAAACCGTGCAGACC
+CTGGGGTCCCTGTTGTACGCTGCATCATCCCGCTGGCCCTGTGCCCTGGAGGGTGGGCGGCTCATGGTGC
+CACAGCCCCTGGCAGGGACGGCCGGCCCGCCCCCGTGACTGACTGACAGATGCAGGGATGGCCGAGGCAG
+CCCTCGCTCCAGCTGAACGCCTCCATTGCTGCTTGTTCTGGAGACCCCCGCCCCCGCACCTTCCAGACTT
+AGCAGAAGAACAAACTGAAGAACAGACCCAGCCAGAGAAGCAGGGATTCCAGAAGCTGCCCATTAAGGGA
+GAAGGAGAGGATCCGGTCGGCAGCAGCCCTGAGCAGAAAGCTGGAGGGGGGACTGTCGCGGGGTTTTTCT
+GTTGTGGTTTATTTTATTAAATTTTTTCCTTTTTTCTATTCATTTCGATGGACGCAATCTTAAGCCACCC
+TGGCCTTGCTCCTGGGAGGTGAGCGTGCACAGGTGTGTGCAGGTCAGGAGGTGCCGTCCAGGTGTGCGGC
+GAGCCGCTGCGCACAGATGTCAGGATTTCCGTTTGGGTCTAGTTTAGAACCTGTCCTTAAACCTAGGGGT
+TGCTGTCAGGATTTGCTTTCAGACTTTTTTTTTTTTTGTAATTCCCTTTAGAGTCTACAAAAATGTTTTT
+AAAAGGATCAGGTCTGCTTTTAGTTTCATTTTTGTTTCTTTCCCGTCCCACTCTTTAAAAACTGGTTCCG
+TGAGGAAAGGCAGAAGCCGTTCCGTGTCTCTTGCAGGCTGGGCCGGCTTCATGCCAGTGCGAGGGCGTCC
+CGTGCCCACGTACATACGTATGTCTCCATGAGTTCTGGGCTCCACTGGTTCCAATTGAGCTCCAGCCCTG
+GTTTTCCTACCCATGCAGTTAGGGACTTTAATTTAATTTTTTTTTTGTAGGGCCACCGCCTTCAAACACA
+ACTGCTACAACATTCTAATAAAGGCTCATTTAACCCCCAGGCTCCTGTCGTGTGAATATCCTCAGTCTGT
+AGGAAACTTTTTTTGACACAGCATAGAAGACCTAGTTTTGGAAAACATTATCTAATTTTTTGTTGTGCAA
+ATCCCCAAATTTCTCACTAATTTTTGTTTTTTTGTGCATAACTTGGATGGGCTGAAGGAGGTGAGGACAG
+ATTGGGGAAGGGTGGCTTTCATTCCAAGATCCAGGGATTTGGGGAAAAGGAAGGAATTTGATGTTTTTTG
+GGGTGGGAGGGGAGGGTGTGTTTTTTACACCAAAAAAAAAAAAAAAAATCAAGAGTATGCAAGCATTTCT
+ATTCCTCGCATTTTTCTGTGTGCCTGGCAAATAAATACCTGTCTCCTACGACCCTGAGCTGTTAGCCCTC
+TCTGTTCCATGACAGGGGCCAGATCTTCCAGCTCCTCCCAGAAGGAGCACCCAGGCTGGCTTCTTCCCAC
+TGAAAGCCCTCCCCAGCGAACCAACCTCAGTTCTATGCAGTGGCTGGGGATCAGGCATCCAGACCGAAGT
+CACCTCTGCCTGCTCCAGCTTGGGTCAGCTGGGTCTGACCAGGGGGCCAGATCCGAGCCGCACCTGCCGG
+CCCCCAGCCCCAGCTCCAGCTCCTGACCTCTCCCAGCCTGGCCTGGCTGTTCCTCCAGGGCTGATGGCTG
+TCAACCCATCCTTGTGAGTTCATATGGACTGCTGCCCCTCGAAAGGGAGAGGGTCGGCCCCATGTCCCCA
+GGGAGCATTCCATCAGGGACAACGTACATACTGTGATGTAAACTTTTTTTTTTTCCCCCCAGGGGGCAAA
+AGTGTGAGATGCCTTAATCTTTCCTTCATTTCTGCTGTCTCGAACACTCTAGCCCATTATTTCCTTTCAG
+TTCCTTGCAGCATAACCTCTACGATAAGCCCCAAGCGGGTTGTTGTATTATGACGTTTATGATGTTCCAG
+GTGAAGGCATTATTAAGTACCTCTCTGGGTGTGGGGTTTGGACGCACCAGGATAGCTATTGATTAATGTT
+AAGGGTGTTCTACCCACAGCAAAGCACACCCTCTTAAACCAGGCACTGCCTGGGTCCTGGTCCCGAGAGC
+CCTACCAGGATCAGGTTCCTGCAAGCCGTCAGAATGTGGGAGCCCCCAGCCCAACTGATTGTAACTGTCC
+CCTGTTACCTGTGACATGAACCTCCAACAGCACCTGGAAACGGTTCCCTCTGTCAGCTGCTCTGTAGACA
+GGGCTGGGGAGATCTCAGAGTTCACACCTCGCCTGTTGTAGGGGAGGTTGGGGGTAGGGTTTGGAATGGC
+CAAGTGCCCTTGGAACCTCCCACAGCTATGGCCGTCCTGACCTCATCCCAGGAACTCTACGGTGACCAGG
+AACCACCCCTCTGACGAGGTCTGTAGCGGCCCTTCTCAGAGTGGAACAGCCCACAGTGCTAGTTGTGCCT
+GGTCTTACCTGTACTCCACGGACCTCGGTGAAGCAAAAGCTTCAGGGCAGAGGGAATGAGGCAACCCAGT
+GGCAGCCCCGCTGGGCCCCGTGGCTCCTGCTCTCCTATTGGACGTAGAGGCAGGGGAGAGACTTCTCTAT
+ACAAATATTCTCATCACAGAAGGGATGATCCTTGCTGCTCTGCCGTAGGGTTTTTGATGCTGAGCTATGC
+TGCACATGACGTTAACCTAAAGAACTTGGACTGAGCTTTTAAAAAAGGACAGCAAACAATTTTATAATCC
+TTAAAGTGTAATAGACGGTTACACTAGTGCAGGGTATTGGGGAGGCTCTTTGGGTGTGGAGGCTGTCACT
+TGTATTTATTGTGACTCTAAATCTTTGATAGTAAAACAAATGTAAAAAGAAATGTTTGCCACCAGATGGG
+AATAGAAGTTCCAATAAGCAGGCTGGAATGGGTGGCTATACGTTGTATCACGAGGAAGTTTTAGACTCTG
+AAGGATAATAAATGGATGATGTGTCAACTGGAAAAAAAAAAAAAAAAAA
diff --git a/debian/tests/test-data/trnascan-se_sample.output b/debian/tests/test-data/trnascan-se_sample.output
new file mode 100644
index 00000000..d4aa35c0
--- /dev/null
+++ b/debian/tests/test-data/trnascan-se_sample.output
@@ -0,0 +1,49 @@
+tRNAscan-SE v.2.0 (December 2017) - scan sequences for transfer RNAs
+Copyright (C) 2017 Patricia Chan and Todd Lowe
+ University of California Santa Cruz
+Freely distributed under the GNU General Public License (GPLv3)
+
+------------------------------------------------------------
+Sequence file(s) to search: /usr/share/doc/trnascan-se/examples/Example1.fa
+Search Mode: Eukaryotic
+Results written to: trnascan-se_sample.output
+Output format: Tabular
+Searching with: Infernal First Pass->Infernal
+Isotype-specific model scan: Yes
+Covariance model: /usr/share/trnascan-se/models/TRNAinf-euk.cm
+ /usr/share/trnascan-se/models/TRNAinf-euk-SeC.cm
+Infernal first pass cutoff score: 10
+
+Temporary directory: /tmp
+------------------------------------------------------------
+
+Status: Phase I: Searching for tRNAs with HMM-enabled Infernal
+Status: Phase I: Searching for tRNAs with HMM-enabled Infernal
+Scanned seqs: 0 (at CELF22B7)
+/usr/bin/cmsearch -g --mid --notrunc -T 10 /usr/share/trnascan-se/models/TRNAinf-euk.cm /tmp/tscan26061.fa > /tmp/tscan26061_fp_cm_Domain.out
+/usr/bin/cmsearch -g --mid --notrunc -T 10 /usr/share/trnascan-se/models/TRNAinf-euk-SeC.cm /tmp/tscan26061.fa > /tmp/tscan26061_fp_cm_SeC.out
+
+1 seqs scanned, 1 seqs had at least one hit.
+5 total tRNAs predicted in first pass scans
+Status: Phase II: Infernal verification of candidate tRNAs detected with first-pass scan
+Status: Phase II: Infernal verification of candidate tRNAs detected with first-pass scan
+Scanning CELF22B7
+/usr/bin/cmsearch -g --nohmm --toponly --notrunc /usr/share/trnascan-se/models/TRNAinf-euk.cm /tmp/tscan26061.trna > /tmp/tscan26061_cm_Domain.out
+/usr/bin/cmsearch -g --nohmm --toponly --notrunc /usr/share/trnascan-se/models/TRNAinf-euk-SeC.cm /tmp/tscan26061.trna > /tmp/tscan26061_cm_SeC.out
+/usr/bin/cmsearch -g --toponly --notextw /usr/share/trnascan-se/models/TRNAinf-euk.cm /tmp/tscan26061.trna > /tmp/tscan26061_trunc_cm_Domain.out
+/usr/bin/cmscan -g --mid --toponly --notrunc --fmt 2 --tblout /tmp/tscan26061_iso_cm.tab -o /tmp/tscan26061_iso_cm.out /usr/share/trnascan-se/models/TRNAinf-euk-iso /tmp/tscan26061.trna
+CELF22B7.tRNA1-LeuCAA: Infernal type= Leu Score= 74.2
+CELF22B7.tRNA2-SerAGA: Infernal type= Ser Score= 81.6
+CELF22B7.tRNA3-PheGAA: Infernal type= Phe Score= 82.5
+CELF22B7.tRNA4-PheGAA: Infernal type= Phe Score= 82.5
+CELF22B7.tRNA5-ProCGG: Infernal type= Pro Score= 71.5
+
+End Time: Tue Mar 27 23:02:00 2018
+Sequence tRNA Bounds tRNA Anti Intron Bounds Inf Hit
+Name tRNA # Begin End Type Codon Begin End Score Origin Note
+-------- ------ ----- ------ ---- ----- ----- ---- ------ ------ ------
+CELF22B7 1 12619 12738 Leu CAA 12657 12692 74.2 Inf
+CELF22B7 2 19480 19561 Ser AGA 0 0 81.6 Inf
+CELF22B7 3 26367 26439 Phe GAA 0 0 82.5 Inf
+CELF22B7 4 26992 26920 Phe GAA 0 0 82.5 Inf
+CELF22B7 5 23765 23694 Pro CGG 0 0 71.5 Inf
diff --git a/debian/udv.desktop.in b/debian/udv.desktop.in
new file mode 100644
index 00000000..ebdf34c5
--- /dev/null
+++ b/debian/udv.desktop.in
@@ -0,0 +1,3 @@
+Name=OneD Biological Sequence Viewer
+GenericName=Sequence Viewer
+Comment=View single biological sequences
diff --git a/debian/upstream/metadata b/debian/upstream/metadata
new file mode 100644
index 00000000..a7f64b36
--- /dev/null
+++ b/debian/upstream/metadata
@@ -0,0 +1,26 @@
+Reference:
+ - Author: >
+ Yanli Wang and Lewis Y. Geer and Colombe Chappey and Jonathan A. Kans and
+ Stephen H. Bryant and Yanli Wang and Lewis Y. Geer and Colombe Chappey and
+ Jonathan A. Kans and Stephen H. Bryant
+ Title: "Cn3D: sequence and structure views for Entrez"
+ Journal: Trends Biochem Sci.
+ Year: 2000
+ Month: 6
+ Volumne: 25
+ Number: 6
+ Pages: 300-302
+ PMID: 10838572
+ URL: https://linkinghub.elsevier.com/retrieve/pii/S0968-0004(00)01561-9
+ DOI: 10.1016/S0968-0004(00)01561-9
+ Debian-package: ncbi-cn3d
+Registry:
+ - Name: OMICtools
+ Entry: OMICS_05052
+ Debian-package: ncbi-cn3d
+ - Name: bio.tools
+ Entry: cn3d
+ Debian-package: ncbi-cn3d
+ - Name: SciCrunch
+ Entry: SCR_004861
+ Debian-package: ncbi-cn3d
diff --git a/debian/vibrate b/debian/vibrate
new file mode 100644
index 00000000..1266d38c
--- /dev/null
+++ b/debian/vibrate
@@ -0,0 +1,20 @@
+#!/bin/sh
+if [ $# = 0 -o "x$1" = "x--help" ]; then
+ cat <<EOF
+Usage: $0 program [arguments]
+
+Vibrate runs the specified program, which presumably uses the NCBI C
+toolkit, with the Vibrant library preloaded. The main effect of this
+preloading is that omitting arguments produces a dialog box for setting
+parameters rather than a usage message.
+EOF
+ exit 0
+fi
+preload=/usr/lib/libvibrant.so.6
+if [ -n "$LD_PRELOAD" ]; then
+ LD_PRELOAD=$preload:$LD_PRELOAD
+else
+ LD_PRELOAD=$preload
+fi
+export LD_PRELOAD
+exec "$@"
diff --git a/debian/watch b/debian/watch
new file mode 100644
index 00000000..c2b620c6
--- /dev/null
+++ b/debian/watch
@@ -0,0 +1,3 @@
+version=4
+opts="passive,uversionmangle=s|^|6.1.|,downloadurlmangle=s/$/ncbi.tar.gz/" \
+http://ftp.ncbi.nih.gov/toolbox/ncbi_tools/old/ (\d{8}[a-z]*)/ \ No newline at end of file
diff --git a/demo/asndisc.c b/demo/asndisc.c
index 23586980..e65430e4 100644
--- a/demo/asndisc.c
+++ b/demo/asndisc.c
@@ -65,6 +65,7 @@
#include <objmacro.h>
#include <macroapi.h>
+#include <connect/ncbi_gnutls.h>
#define ASNDISC_APP_VER "2.3"
@@ -1264,6 +1265,8 @@ Int2 Main (void)
UseLocalAsnloadDataAndErrMsg ();
ErrPathReset ();
+ SOCK_SetupSSL(NcbiSetupGnuTls);
+
if (! AllObjLoad ()) {
Message (MSG_FATAL, "AllObjLoad failed");
return 1;
diff --git a/demo/entrez2.c b/demo/entrez2.c
index af6a0f24..bd5ab4b4 100644
--- a/demo/entrez2.c
+++ b/demo/entrez2.c
@@ -61,6 +61,8 @@
#include <entrez2.h>
+#include <connect/ncbi_gnutls.h>
+
#define ENTREZ_APP_VERSION "12.1"
#define MAX_QUERY_FORMS 256
@@ -884,6 +886,8 @@ Int2 Main (void)
UseLocalAsnloadDataAndErrMsg ();
ErrPathReset ();
+ SOCK_SetupSSL(NcbiSetupGnuTls);
+
/*--------------------------------*/
/* Initialize the global settings */
/*--------------------------------*/
@@ -1026,7 +1030,7 @@ Int2 Main (void)
/*--------------------------------------*/
if (useNormalServ) {
- EntrezSetService ("Entrez2");
+ EntrezSetService ("Entrez2s");
} else if (useTestServ) {
EntrezSetService ("Entrez2Test");
} else if (useURL) {
diff --git a/demo/findspl.c b/demo/findspl.c
index 98d19632..e1a675af 100644
--- a/demo/findspl.c
+++ b/demo/findspl.c
@@ -62,6 +62,8 @@
#include <accentr.h>
#include <sequtil.h>
+#include <connect/ncbi_gnutls.h>
+
#define NUMARGS 3
Args myargs[NUMARGS] = {
{"Gi number of protein","0","1","99999999",FALSE,'g',ARG_INT,0.0,0,NULL},
@@ -98,6 +100,8 @@ Int2 Main(void)
FILE *ofp;
FILE *ifp = NULL;
+ SOCK_SetupSSL(NcbiSetupGnuTls);
+
if ( !GetArgs("findspl", NUMARGS, myargs) ) return 1;
gi = myargs[0].intvalue;
diff --git a/demo/gbseqget.c b/demo/gbseqget.c
index 8765c6dc..e4549ee8 100644
--- a/demo/gbseqget.c
+++ b/demo/gbseqget.c
@@ -54,6 +54,8 @@
#include <pmfapi.h>
#include <asn2gnbp.h>
+#include <connect/ncbi_gnutls.h>
+
static CharPtr ReadALine (
CharPtr str,
size_t size,
@@ -417,6 +419,8 @@ Int2 Main (void)
UseLocalAsnloadDataAndErrMsg ();
ErrPathReset ();
+ SOCK_SetupSSL(NcbiSetupGnuTls);
+
if (! AllObjLoad ()) {
Message (MSG_FATAL, "AllObjLoad failed");
return 1;
diff --git a/demo/insdseqget.c b/demo/insdseqget.c
index 7ca9686f..5f03d579 100644
--- a/demo/insdseqget.c
+++ b/demo/insdseqget.c
@@ -55,6 +55,8 @@
#include <pmfapi.h>
#include <asn2gnbp.h>
+#include <connect/ncbi_gnutls.h>
+
#define INSDSEQGET_APP_VER "1.1"
CharPtr INSDSEQGET_APPLICATION = INSDSEQGET_APP_VER;
@@ -423,6 +425,8 @@ Int2 Main (void)
UseLocalAsnloadDataAndErrMsg ();
ErrPathReset ();
+ SOCK_SetupSSL(NcbiSetupGnuTls);
+
if (! AllObjLoad ()) {
Message (MSG_FATAL, "AllObjLoad failed");
return 1;
diff --git a/demo/nps2gps.c b/demo/nps2gps.c
index 42411bd1..a9264f01 100644
--- a/demo/nps2gps.c
+++ b/demo/nps2gps.c
@@ -50,6 +50,8 @@
#include <toasn3.h>
#include <pmfapi.h>
+#include <connect/ncbi_gnutls.h>
+
#define NPS2GPSAPP_VER "3.6"
CharPtr NPS2GPSAPPLICATION = NPS2GPSAPP_VER;
@@ -2439,6 +2441,8 @@ Int2 Main (void)
UseLocalAsnloadDataAndErrMsg ();
ErrPathReset ();
+ SOCK_SetupSSL(NcbiSetupGnuTls);
+
if (! AllObjLoad ()) {
Message (MSG_FATAL, "AllObjLoad failed");
return 1;
diff --git a/demo/taxblast_main.c b/demo/taxblast_main.c
index b4aa65c7..757550f3 100644
--- a/demo/taxblast_main.c
+++ b/demo/taxblast_main.c
@@ -41,6 +41,8 @@ static char const rcsid[] = "$Id: taxblast_main.c,v";
#include <objgen.h>
#include <taxblast.h>
+#include <connect/ncbi_gnutls.h>
+
#define NUMARG (sizeof(myargs)/sizeof(myargs[0]))
@@ -63,6 +65,8 @@ Int2 Main (void)
FILE *outfile;
Char ofile[128];
+ SOCK_SetupSSL(NcbiSetupGnuTls);
+
if (!GetArgs("txblast", NUMARG, myargs)) {
return 1;
}
diff --git a/demo/tbl2asn.c b/demo/tbl2asn.c
index 6580d026..8d5e3f1a 100644
--- a/demo/tbl2asn.c
+++ b/demo/tbl2asn.c
@@ -8911,10 +8911,12 @@ Int2 Main (void)
return 1;
}
+ /*
if (MoreThanYearOld ()) {
too_old = TRUE;
Message (MSG_POST, "This copy of tbl2asn is more than a year old. Please download the current version.");
}
+ */
/* process command line arguments */
@@ -9668,6 +9670,9 @@ Int2 Main (void)
}
if (tbl.other_failure) {
+ if (MoreThanYearOld ()) {
+ Message (MSG_POST, "This copy of tbl2asn is more than a year old. Please try again with the current version.");
+ }
return 1;
}
diff --git a/desktop/bspview.c b/desktop/bspview.c
index bb2e82a6..0597024d 100644
--- a/desktop/bspview.c
+++ b/desktop/bspview.c
@@ -2549,13 +2549,13 @@ NLM_EXTERN void Nlm_LaunchWebPage (Char *url)
}
#endif
#ifdef WIN_MOTIF
- argv [0] = "netscape";
+ argv [0] = "sensible-browser";
argv [1] = url;
argv [2] = NULL;
child = fork();
if(child == 0) {
- if (execvp ("netscape", argv) == -1) {
- Message (MSG_POST, "Unable to launch netscape");
+ if (execvp ("sensible-browser", argv) == -1) {
+ Message (MSG_POST, "Unable to launch browser");
exit(-1);
}
}
diff --git a/doc/dispatcher.html b/doc/dispatcher.html
index 1d6b57a3..f8af639a 100644
--- a/doc/dispatcher.html
+++ b/doc/dispatcher.html
@@ -9,15 +9,15 @@
-->
<META NAME="keywords" CONTENT="dispatcher toolkit">
<META NAME="description" CONTENT="NCBI dispatcher">
- <link rel="stylesheet" href="http://www.ncbi.nlm.nih.gov/corehtml/ncbi2.css">
+ <link rel="stylesheet" href="ncbi2.css">
</head>
-<body bgcolor="#FFFFFF" background="http://www.ncbi.nlm.nih.gov/corehtml/bkgd.gif" text="#000000" link="#CC6600" vlink="#CC6600">
+<body bgcolor="#FFFFFF" background="bkgd.gif" text="#000000" link="#CC6600" vlink="#CC6600">
<!-- the header -->
<table border="0" width="600" cellspacing="0" cellpadding="0">
<tr>
- <td width="140"><a href="http://www.ncbi.nlm.nih.gov"> <img src="http://www.ncbi.nlm.nih.gov/corehtml/left.GIF" width="130" height="45" border="0"></a></td>
+ <td width="140"><a href="http://www.ncbi.nlm.nih.gov"> <img src="left.gif" width="130" height="45" border="0"></a></td>
<td width="360" class="head1" valign="BOTTOM"> <span class="H1">Network Configuration</span></td>
<td width="100" valign="BOTTOM"></td>
</tr>
@@ -37,7 +37,7 @@
<table border="0" width="600" cellspacing="0" cellpadding="0">
<tr valign="TOP"> <!-- left column -->
<td width="125">
- <img src="http://www.ncbi.nlm.nih.gov/corehtml/spacer10.GIF" width="125" height="1" border="0">
+ <img src="spacer10.gif" width="125" height="1" border="0">
<p>
<a href="#Switch" class="GUTTER">The Switch</a>
<p>
@@ -52,7 +52,7 @@
<a href="#Addendum" class="GUTTER">Additional Info</a>
</td>
<!-- extra column to force things over the gif border -->
- <td width="15"><img src="http://www.ncbi.nlm.nih.gov/corehtml/spacer10.GIF" width="15" height="1" border="0"> </td>
+ <td width="15"><img src="spacer10.gif" width="15" height="1" border="0"> </td>
<!-- right content column -->
<td width="460">
<p>&nbsp;</p>
diff --git a/doc/firewall.html b/doc/firewall.html
index 7f9c8d86..4036210a 100644
--- a/doc/firewall.html
+++ b/doc/firewall.html
@@ -9,15 +9,15 @@
<META NAME="keywords" CONTENT="insert your keywords for the search engine">
<META NAME="description" CONTENT="insert the description to be displayed by the search engine. Also searched by the search engine.">
-->
- <link rel="stylesheet" href="http://www.ncbi.nlm.nih.gov/corehtml/ncbi2.css">
+ <link rel="stylesheet" href="ncbi2.css">
</head>
-<body bgcolor="#FFFFFF" background="http://www.ncbi.nlm.nih.gov/corehtml/bkgd.gif" text="#000000" link="#CC6600" vlink="#CC6600">
+<body bgcolor="#FFFFFF" background="bkgd.gif" text="#000000" link="#CC6600" vlink="#CC6600">
<!-- the header -->
<table border="0" width="600" cellspacing="0" cellpadding="0">
<tr>
- <td width="140"><a href="http://www.ncbi.nlm.nih.gov"> <img src="http://www.ncbi.nlm.nih.gov/corehtml/left.GIF" width="130" height="45" border="0"></a></td>
+ <td width="140"><a href="http://www.ncbi.nlm.nih.gov"> <img src="left.gif" width="130" height="45" border="0"></a></td>
<td width="360" class="head1" valign="BOTTOM"> <span class="H1">Network Configuration</span></td>
<td width="100" valign="BOTTOM"></td>
</tr>
@@ -37,12 +37,12 @@
<table border="0" width="600" cellspacing="0" cellpadding="0">
<tr valign="TOP"> <!-- left column -->
<td width="125">
-<img src="http://www.ncbi.nlm.nih.gov/corehtml/spacer10.GIF" width="125" height="1" border="0">
+<img src="spacer10.gif" width="125" height="1" border="0">
</td>
<!-- extra column to force things over the gif border -->
- <td width="15"><img src="http://www.ncbi.nlm.nih.gov/corehtml/spacer10.GIF" width="15" height="1" border="0"> </td>
+ <td width="15"><img src="spacer10.gif" width="15" height="1" border="0"> </td>
<!-- right content column -->
<td width="460">
<p>&nbsp;</p>
@@ -133,7 +133,7 @@ in case the public access will eventually be enabled on this port as well.
<p>
To see what ports are currently on, and their status, as reported within
-NCBI, please refer to the following <a href="fwd_check.cgi">Firewall Daemon Presence
+NCBI, please refer to the following <a href="http://www.ncbi.nlm.nih.gov/IEB/ToolBox/NETWORK/fwd_check.cgi">Firewall Daemon Presence
Check</a> page. Ports marked <b>INTERNAL</b> are solely for NCBI own use, and may be
inaccessible from your site. That, however, does not affect availability of any
services that NCBI provides through other (open) firewall ports.
@@ -143,7 +143,7 @@ TROUBLESHOOTING: You can test whether these special ports are connectable from
your host just by running simple <tt>telnet</tt> command (available on most
current systems). To know which ports, at the moment, you should be trying
from the list above (see the "Ports to open"), first check their status by visiting
-<a href="fwd_check.cgi">Firewall Daemon Presence Check</a> link, then select any
+<a href="http://www.ncbi.nlm.nih.gov/IEB/ToolBox/NETWORK/fwd_check.cgi">Firewall Daemon Presence Check</a> link, then select any
up-and-running port and do the following (the example assumes port 5861 has
been shown in operational state):
<pre>
@@ -175,7 +175,7 @@ functions of NCBI dispatching facilities.
<p>
There is also an auxiliary automated UNIX shell script
-<a href="fwd_check.sh">fwd_check.sh</a> to check all of
+<a href="../libncbi6/examples/fwd_check.sh">fwd_check.sh</a> to check all of
the preset ports, and it is kept in-sync with currently
configured open ports (so remember to refresh your download
prior to actual use).
diff --git a/doc/fwd_check.sh b/doc/fwd_check.sh
index abe751c9..477b885c 100755
--- a/doc/fwd_check.sh
+++ b/doc/fwd_check.sh
@@ -8,7 +8,7 @@
delay_sec="$1"
delay_sec=${delay_sec:="10"}
netcat="`which nc 2>/dev/null`"
-temp="/tmp/`basename $0`.$$.tmp"
+temp=`mktemp`
helper="./fwd_failure_helper.exe"
test -z "$netcat" && netcat="`whereis nc | sed 's/^[^:]*://;s/ //g'`"
test -z "$HTTP_NCBI_EXTERNAL" && HTTP_CAF_EXTERNAL="$HTTP_NCBI_EXTERNAL"
diff --git a/doc/man/cleanasn.1 b/doc/man/cleanasn.1
index a5bd23eb..afa5c347 100644
--- a/doc/man/cleanasn.1
+++ b/doc/man/cleanasn.1
@@ -1,4 +1,4 @@
-.TH CLEANASN 1 2016-09-01 NCBI "NCBI Tools User's Manual"
+.TH CLEANASN 1 2017-01-09 NCBI "NCBI Tools User's Manual"
.SH NAME
cleanasn \- clean up irregularities in NCBI ASN.1 objects
.SH SYNOPSIS
@@ -75,6 +75,10 @@ Exclude nuc\-prot sets
Only segmented sequences
.IP w
Exclude segmented sequences
+.IP x
+Only segmented proteins
+.IP y
+Exclude segmented proteins
.PD
.RE
.TP
@@ -86,6 +90,8 @@ Sequence operations, per the flags in str:
Compress
.IP d
Decompress
+.IP l
+Recalculated segmented sequence length
.IP v
Virtual gaps inside segmented sequence
.IP s
diff --git a/doc/man/taxblast.1 b/doc/man/taxblast.1
new file mode 100644
index 00000000..acdb2dc1
--- /dev/null
+++ b/doc/man/taxblast.1
@@ -0,0 +1,31 @@
+.TH TAXBLAST 1 2016-12-05 NCBI "NCBI Tools User's Manual"
+.SH NAME
+taxblast \- annotate BLAST output with taxonomic details
+.SH SYNOPSIS
+.B taxblast
+[\|\fB\-\fP\|]
+[\|\fB\-d\fP\ \fIstr\fP\|]
+\fB\-i\fP\ \fIfilename\fP
+[\|\fB\-o\fP\ \fIfilename\fP\|]
+[\|\fB\-p\fP\|]
+.SH DESCRIPTION
+\fBtaxblast\fP annotates BLAST output with taxonomic details.
+.SH OPTIONS
+A summary of options is included below.
+.TP
+\fB\-\fP
+Print usage message
+.TP
+\fB\-d\fP\ \fIstr\fP
+Database used to get SeqAnnot ASN.1 (\fBnr\fP by default)
+.TP
+\fB\-i\fP\ \fIfilename\fP
+Input ASN.1 File (SeqAnnot)
+.TP
+\fB\-o\fP\ \fIfilename\fP
+Output file name (stdout by default)
+.TP
+\fB\-p\fP
+Sequence is DNA
+.SH AUTHOR
+The National Center for Biotechnology Information.
diff --git a/make/makeall.unx b/make/makeall.unx
index 0c6be27b..17eee351 100644
--- a/make/makeall.unx
+++ b/make/makeall.unx
@@ -1,4 +1,4 @@
-# makefile for asntool and ncbi core routines,
+# -*- makefile -*- for asntool and ncbi core routines,
#
# $Id: makeall.unx,v 6.321 2016/12/31 22:35:10 ucko Exp $
#
@@ -234,7 +234,7 @@ SRC20 = drawseq.c dotmatrx.c fea2seg.c fstyle.c smdlg1.c smdlg2.c smdlg3.c \
dlgutil1.c dlgutil2.c e2trmlst.c e2docsum.c asn2graphic.c \
medview.c bspview.c gbfview.c gphview.c gphdraw.c gxydraw.c gtrdraw.c \
seqpanel.c ingengraph.c ingenext.c ingenwin.c macrodlg.c \
- biosrc.c cdrgn.c import.c pubdesc.c seqsub.c mapgene.c prtgene.c salogif.c
+ biosrc.c cdrgn.c import.c pubdesc.c seqsub.c mapgene.c prtgene.c
SRC45 = ddvclick.c ddvgraph.c ddvopen.c ddvpanel.c
@@ -392,7 +392,7 @@ OBJ20 = drawseq.o dotmatrx.o fea2seg.o fstyle.o smdlg1.o smdlg2.o smdlg3.o \
dlgutil1.o dlgutil2.o e2trmlst.o e2docsum.o asn2graphic.o \
medview.o bspview.o gbfview.o gphview.o gphdraw.o gxydraw.o gtrdraw.o \
seqpanel.o ingengraph.o ingenext.o ingenwin.o macrodlg.o \
- biosrc.o cdrgn.o import.o pubdesc.o seqsub.o mapgene.o prtgene.o salogif.o
+ biosrc.o cdrgn.o import.o pubdesc.o seqsub.o mapgene.o prtgene.o
OBJ45 = ddvclick.o ddvgraph.o ddvopen.o ddvpanel.o
@@ -491,14 +491,14 @@ ln-if-absent: ../make/ln-if-absent
nocopy : sources $(THR_OBJ) $(LIB1) $(LIBTLS) $(LIB2) $(LIB3) $(DLIB4) $(DLIB400) \
$(LIB5) $(DLIB20) $(DLIB45) $(LIB22) $(LIB23) $(LIBCOMPADJ) \
$(DLIB28) $(DLIB30) $(DLIB3000) \
- $(DLIB34) $(DLIB37) $(DLIB38) $(LIB50) $(LIB60) $(LIB61) $(NCBI_SHLIBS)
+ $(DLIB34) $(DLIB37) $(DLIB38) $(LIB60) $(LIB61) $(NCBI_SHLIBS)
sources : $(SRCALL)
## To clean out the directory without removing make
##
clean :
- -rm -f *.[acho]
+ -rm -f *.[acho] *.glo
.NO_PARALLEL: copy $(ULIB4) $(ULIB30)
@@ -656,10 +656,12 @@ shlib.sol :
cd ../shlib; make -f $(MAKESHLIB) `ls *.a | sed "s/\.a/.so/"` NCBI_OTHERLIBS=$(OTHERLIBS)
rm -f ../shlib/*.a
-#
-# Linux shared libs are built the same in the same manner as for SGI
-#
-shlib.lnx : shlib.sgi
+shlib.lnx :
+ -mkdir ../shlib
+ -rm -f ../shlib/*.a
+ ln $(NCBI_LIBDIR)/*.a ../shlib
+ cd ../shlib; make -f $(MAKESHLIB) `ls *.a | sed "s/\.a/.so.$(NCBI_VERSION_MAJOR)/"` SH1="$(CC) -o" SH2="-shared *.o"
+ rm -f ../shlib/*.a
shlib.sgi :
-mkdir ../shlib
@@ -792,7 +794,7 @@ copy :
cp -fp ../algo/blast/core/*.h ../include/algo/blast/core
- mkdir -p ../include/algo/blast/composition_adjustment
$(SRCCOPY) ../algo/blast/composition_adjustment/*.c .
- $(SRCCOPY) ../algo/blast/composition_adjustment/*.h ../include
+# $(SRCCOPY) ../algo/blast/composition_adjustment/*.h ../include
cp -fp ../algo/blast/composition_adjustment/*.h \
../include/algo/blast/composition_adjustment
- mkdir -p ../include/algo/blast/api
diff --git a/make/makedemo.unx b/make/makedemo.unx
index 3d187c94..b354981b 100644
--- a/make/makedemo.unx
+++ b/make/makedemo.unx
@@ -1,4 +1,4 @@
-# makefile for demo programs
+# -*- makefile -*- for demo programs
#
# $Id: makedemo.unx,v 6.96 2016/08/31 19:05:26 ucko Exp $
#
@@ -228,7 +228,8 @@ cdscan : cdscan.c
# findspl
findspl : findspl.c
- $(CC) -o findspl $(LDFLAGS) findspl.c $(ENTREZLIBS) $(LIB2) $(LIB1) $(OTHERLIBS)
+ $(CC) -o findspl $(LDFLAGS) findspl.c $(ENTREZLIBS) $(LIB2) $(LIB1) \
+ $(LIBTLS) $(OTHERLIBS)
# errhdr
diff --git a/make/makenet.unx b/make/makenet.unx
index f5fb528c..a26ad1c1 100644
--- a/make/makenet.unx
+++ b/make/makenet.unx
@@ -1,4 +1,4 @@
-# makefile for network demo programs and network entrez
+# -*- makefile -*- for network demo programs and network entrez
#
# $Id: makenet.unx,v 6.261 2016/08/25 15:37:04 ucko Exp $
# test, ignore
@@ -330,6 +330,8 @@ OBJ46 = id2.o id2sgen.o
# objects & sources needed for versions of network demo programs
+OBJCN3D = cn3dmain.o
+
OBJDDV = ddvmain.o
OBJUDV = udvmain.o
@@ -445,10 +447,12 @@ shlib.sol :
cd ../shlib; make -f $(MAKESHLIB) `ls *.a | sed "s/\.a/.so/"` NCBI_OTHERLIBS=$(OTHERLIBS)
rm -f ../shlib/*.a
-#
-# Linux shared libs are built the same in the same manner as for SGI
-#
-shlib.lnx : shlib.sgi
+shlib.lnx :
+ -mkdir ../shlib
+ -rm -f ../shlib/*.a
+ ln $(NCBI_LIBDIR)/*.a ../shlib
+ cd ../shlib; make -f $(MAKESHLIB) `ls *.a | sed "s/\.a/.so.$(NCBI_VERSION_MAJOR)/"` SH1="$(CC) -o" SH2="-shared *.o"
+ rm -f ../shlib/*.a
shlib.sgi :
-mkdir ../shlib
@@ -518,7 +522,7 @@ copy :
$(SRCCOPY) ../network/vibnet/*.h ../include
$(SRCCOPY) ../cdromlib/*.h ../include
-$(SRCCOPY) ../network/wwwblast/Src/*.c .
- -$(SRCCOPY) ../network/wwwblast/Src/*.h ../include
+# -$(SRCCOPY) ../network/wwwblast/Src/*.h ../include
$(SRCCOPY) ../cdromlib/accentr.c .
$(SRCCOPY) ../cdromlib/accutils.c .
-$(SRCCOPY) ../sequin/*.* .
@@ -952,6 +956,11 @@ accvdb.o : accvdb.c
##
+Cn3D : $(OBJCN3D) $(BENTREZLIBS) netentcf $(BLIB36)
+ $(CC) -o Cn3D $(LDFLAGS) $(OBJCN3D) $(LIB31) $(LIB3000) $(LIB20) \
+ $(LIB45) $(LIB22) $(LIB8) $(LIB7) \
+ $(LIB400) $(LIB2) $(LIB1) $(VIBLIBS) $(OGLLIBS)
+
ddv : $(OBJDDV)
$(CC) -o ddv $(LDFLAGS) $(OBJDDV) $(LIB41) $(LIB31) $(LIB20) $(LIB61) $(LIB60) $(LIB22) $(LIB45) \
$(LIB8) $(LIB7) $(NETCLILIB) $(LIB3) $(LIB4) $(LIB23) \
@@ -1097,8 +1106,8 @@ asnval_dbx_psf.o : asnval.c
# asndisc program (asndisc)
asndisc : asndisc.c
$(CC) -g -o asndisc $(LDFLAGS) asndisc.c $(THREAD_OBJ) $(LIB41) \
- $(NETCLILIB) $(LIB23) $(LIBCOMPADJ) $(LIB2) $(LIB1) \
- $(OTHERLIBS) $(THREAD_OTHERLIBS)
+ $(NETCLILIB) $(LIB23) $(LIBCOMPADJ) $(LIB2) $(LIBTLS) $(LIB1) \
+ $(GNUTLS_LIBS) $(OTHERLIBS) $(THREAD_OTHERLIBS)
# asndisc_psf, uses PUBSEQBioseqFetchEnable instead of PubSeqFetchEnable
# should be used only internally within NCBI.
@@ -1150,17 +1159,19 @@ diffshift : diffshift.c
# gbseqget program (gbseqget)
gbseqget : gbseqget.c
$(CC) -g -o gbseqget $(LDFLAGS) gbseqget.c $(LIB41) $(NETCLILIB) \
- $(LIB23) $(LIBCOMPADJ) $(LIB2) $(LIB1) $(OTHERLIBS)
+ $(LIB23) $(LIBCOMPADJ) $(LIB2) $(LIBTLS) $(LIB1) \
+ $(GNUTLS_LIBS) $(OTHERLIBS)
# insdseqget program (insdseqget)
insdseqget : insdseqget.c
$(CC) -g -o insdseqget $(LDFLAGS) insdseqget.c $(LIB41) $(NETCLILIB) \
- $(LIB23) $(LIBCOMPADJ) $(LIB2) $(LIB1) $(OTHERLIBS)
+ $(LIB23) $(LIBCOMPADJ) $(LIB2) $(LIBTLS) $(LIB1) \
+ $(GNUTLS_LIBS) $(OTHERLIBS)
# nps2gps program (nps2gps)
nps2gps : nps2gps.c
$(CC) -g -o nps2gps $(LDFLAGS) nps2gps.c $(LIB23) $(LIBCOMPADJ) \
- $(LIB2) $(LIB1) $(OTHERLIBS)
+ $(LIB2) $(LIBTLS) $(LIB1) $(GNUTLS_LIBS) $(OTHERLIBS)
# trna2sap program (trna2sap)
trna2sap : trna2sap.c
@@ -1181,7 +1192,8 @@ testent2 : testent2.c
entrez2 : entrez2.c
$(CC) -g -o entrez2 $(LDFLAGS) entrez2.c $(LIB41) $(LIB6) $(LIB20) \
$(LIB61) $(LIB60) $(LIB22) $(LIB23) $(LIBCOMPADJ) \
- $(LIB2) $(LIB4) $(LIB1) $(VIBLIBS) $(OTHERLIBS)
+ $(LIB2) $(LIB4) $(LIBTLS) $(LIB1) \
+ $(GNUTLS_LIBS) $(VIBLIBS) $(OTHERLIBS)
$(VIB_POST_LINK) entrez2
# demo program (spidey)
@@ -1285,7 +1297,7 @@ bl2seq : bl2seq.c
taxblast: taxblast_main.c $(BLIB41) $(BLIB40)
$(CC) -g -o taxblast $(LDFLAGS) taxblast_main.c \
$(LIB61) $(LIB60) $(LIB36) $(LIB41) $(LIB40) $(LIB23) $(LIBCOMPADJ) \
- $(NETCLILIB) $(LIB2) $(LIB1) $(OTHERLIBS)
+ $(NETCLILIB) $(LIB2) $(LIBTLS) $(LIB1) $(GNUTLS_LIBS) $(OTHERLIBS)
# test client for the suggest network service
suggcli: suggcli.c $(BNETCLILIB) $(BLIB24)
diff --git a/make/makeshlb.unx b/make/makeshlb.unx
index e9829cae..b4bc4ca3 100644
--- a/make/makeshlb.unx
+++ b/make/makeshlb.unx
@@ -1,4 +1,4 @@
-#
+# -*- makefile -*-
#
# $Id: makeshlb.unx,v 6.1 1999/03/18 17:31:11 beloslyu Exp $
#
@@ -12,7 +12,115 @@ SH1 = ld -G -o
SH2 = `lorder *.o | tsort` $(NCBI_OTHERLIBS)
%.so: %.a
- rm -f *.o __*
+ rm -f *.o *.glo __*
ar x $<
+ case $< in \
+ *OGL.a) for f in *.glo; do mv $$f `basename $$f .glo`.o; done ;; \
+ esac
$(SH1) $@ $(SH2)
rm -f *.o __*
+
+so=so.$(NCBI_VERSION_MAJOR).$(NCBI_VERSION_MINOR)
+
+%.$(so): %.a
+ $(CC) -shared -Wl,-soname=$*.so.$(NCBI_VERSION_MAJOR) -o $@ \
+ -Wl,--whole-archive $< -Wl,--no-whole-archive $(LDFLAGS) \
+ $($*_deps) $($*_sysdeps)
+
+%.so.$(NCBI_VERSION_MAJOR): %.$(so)
+ ln -s $< $@
+ ln -s $< $*.so
+
+# Make libncbiCacc and libncbiacc pointers to libncbiNacc, since it's
+# the most useful variant in the usual (net-only) case. Do the same
+# for libnetentr, and link the static version into libncbiNacc.so, due
+# to a circular dependency.
+libnetentr.$(so) libncbiCacc.$(so) libncbiacc.$(so):
+ ln -s libncbiNacc.$(so) $@
+
+# Standardize on the OpenGL-enabled versions of Vibrant, since there's
+# no longer any real penalty in doing so.
+libvibrant.$(so):
+ ln -s libvibrantOGL.$(so) $@
+libncbicn3d.$(so):
+ ln -s libncbicn3dOGL.$(so) $@
+
+libblast_deps = libblastcompadj.$(so) libncbi.$(so)
+libblast_sysdeps = -lm
+libblastapi_deps = libblast.$(so) libncbitool.$(so) libncbiobj.$(so) \
+ libncbi.$(so)
+libblastapi_sysdeps = -lm
+libblastcompadj_sysdeps = -lm
+libconnssl_deps = libncbi.$(so)
+libconnssl_sysdeps = -lgnutls
+libncbi_sysdeps = -lm
+# libncbiCacc_deps = libncbicdr.$(so) libnetentr.a libnetcli.$(so)
+libncbiNacc_deps = libncbicdr.$(so) libnetentr.a libnetcli.$(so) \
+ libncbiobj.$(so) libncbi.$(so)
+libncbiNacc_sysdeps = -lm
+# libncbiacc_deps = libncbicdr.$(so)
+libncbicdr_deps = libncbiobj.$(so) libncbi.$(so)
+libncbiid1_deps = libncbiobj.$(so) libnetcli.$(so) libncbi.$(so)
+libncbimla_deps = libncbiobj.$(so) libnetcli.$(so) libncbi.$(so)
+libncbimmdb_deps = libncbiid1.$(so) libncbitool.$(so) libncbiobj.$(so) \
+ libncbi.$(so)
+libncbimmdb_sysdeps = -lm
+libncbiobj_deps = libncbi.$(so)
+libncbiobj_sysdeps = -lm
+libncbitool_deps = libblastcompadj.$(so) libncbiobj.$(so) libncbi.$(so)
+libncbitool_sysdeps = -lm
+libncbitxc2_deps = libncbitool.$(so) libnetcli.$(so) libncbiobj.$(so) \
+ libncbi.$(so)
+libncbitxc2_sysdeps = -lm
+libnetblast_deps = libncbitool.$(so) libnetcli.$(so) libncbiobj.$(so) \
+ libncbi.$(so)
+libnetcli_deps = libncbi.$(so)
+# libnetentr_deps = libncbiacc.$(so) libnetcli.$(so)
+libvibgif_deps = libncbi.$(so)
+libvibgif_sysdeps = -lm
+
+libddvlib_deps = libncbidesk.$(so) libvibrantOGL.$(so) \
+ libncbitool.$(so) libncbiobj.$(so) libncbi.$(so)
+libncbicn3d_deps = libncbiNacc.$(so) libddvlib.$(so) libncbidesk.$(so) \
+ libncbimmdb.$(so) libncbitool.$(so) libncbiobj.$(so) \
+ libncbi.$(so)
+libncbicn3dOGL_deps = $(libncbicn3d_deps) libvibrantOGL.$(so)
+libncbicn3dOGL_sysdeps = -lm
+libncbidesk_deps = libblastapi.$(so) libncbimmdb.$(so) libncbitool.$(so) \
+ libvibrantOGL.$(so) libncbiobj.$(so) libncbi.$(so)
+libncbidesk_sysdeps = -lm
+libvibnet_deps = libncbiNacc.$(so) libncbidesk.$(so) libncbimmdb.$(so) \
+ libvibrantOGL.$(so) libncbitool.$(so) \
+ libncbicdr.$(so) libncbiobj.$(so) libncbi.$(so)
+# libvibrant_deps = libncbi.$(so)
+# libvibrant_sysdeps = $(VIBLIBS)
+# for ddvcolor stuff
+libvibrantOGL_deps = libncbiobj.$(so) libncbi.$(so)
+libvibrantOGL_sysdeps = $(OGLLIBS) $(VIBLIBS) -lm
+
+# XXX - is there a way to express these programmatically?
+libblast.$(so): $(libblast_deps)
+libblastapi.$(so): $(libblastapi_deps)
+libconnssl.$(so): $(libconnssl_deps)
+# libncbiCacc.$(so): $(libncbiCacc_deps)
+libncbiNacc.$(so): $(libncbiNacc_deps)
+# libncbiacc.$(so): $(libncbiacc_deps)
+libncbicdr.$(so): $(libncbicdr_deps)
+libncbiid1.$(so): $(libncbiid1_deps)
+libncbimla.$(so): $(libncbimla_deps)
+libncbimmdb.$(so): $(libncbimmdb_deps)
+libncbiobj.$(so): $(libncbiobj_deps)
+libncbitool.$(so): $(libncbitool_deps)
+libncbitxc2.$(so): $(libncbitxc2_deps)
+libnetblast.$(so): $(libnetblast_deps)
+libnetcli.$(so): $(libnetcli_deps)
+# libnetentr.$(so): $(libnetentr_deps)
+
+libddvlib.$(so): $(libddvlib_deps)
+# libncbicn3d.$(so): $(libncbicn3d_deps)
+libncbicn3dOGL.$(so): $(libncbicn3dOGL_deps)
+libncbidesk.$(so): $(libncbidesk_deps)
+libvibgif.$(so): $(libvibgif_deps)
+libvibnet.$(so): $(libvibnet_deps)
+# libvibrant.$(so): $(libvibrant_deps)
+libvibrantOGL.$(so): $(libvibrantOGL_deps)
diff --git a/tools/readdb.c b/tools/readdb.c
index 4989fdbb..26226bf8 100644
--- a/tools/readdb.c
+++ b/tools/readdb.c
@@ -10167,7 +10167,10 @@ static Int2 FDBFinish (FormatDBPtr fdbp)
return 1;
MemSet(dateTime, 0, DATETIME_LENGTH);
- Nlm_DayTimeStr(dateTime, TRUE, TRUE);
+ /* SOURCE_DATE_EPOCH specification: "If the value is malformed, the
+ build process SHOULD exit with a non-zero error code." */
+ if (!Nlm_DayTimeStr(dateTime, TRUE, TRUE))
+ return 1;
/* write db_title and date-time stamp eigth bytes aligned */
tmp = title_len + StringLen(dateTime);
diff --git a/vibrant/netscape.c b/vibrant/netscape.c
index 79443d3b..2e9545e1 100644
--- a/vibrant/netscape.c
+++ b/vibrant/netscape.c
@@ -548,9 +548,8 @@ static Boolean NS_LoadNetscape(const char *url)
}
/* ---------- child process ------------ */
- if (execlp("netscape", "netscape", url, NULL) < 0 &&
- execl(NETSCAPE_PATH, NETSCAPE_PATH, url, NULL) < 0) {
- Message(MSG_ERROR, "Failure to open URL in netscape window");
+ if (execlp("sensible-browser", "sensible-browser", url, NULL) < 0) {
+ Message(MSG_ERROR, "Failure to open URL in browser window");
exit(1);
}
diff --git a/vibrant/shim3d.c b/vibrant/shim3d.c
index 8a5abe72..5a291297 100644
--- a/vibrant/shim3d.c
+++ b/vibrant/shim3d.c
@@ -321,6 +321,7 @@
#ifdef _PNG
#include <png.h> /* must go berore ncbi headers */
+#include <zlib.h>
#ifndef png_jmpbuf
#define png_jmpbuf(x) ((x)->jmpbuf)
#endif
@@ -339,7 +340,8 @@ NLM_EXTERN void LIBCALL Nlm_HeapSort PROTO((VoidPtr base, size_t nel, size_t wid
#include <ddvcolor.h>
#if defined(_OPENGL) && defined(_PNG)
-TOGL_Data *Cn3D_GetCurrentOGLData(void); /* in cn3dxprt.c */
+/* In cn3dxprt.c; declared weak here to avoid dependency loops. */
+extern TOGL_Data *Cn3D_GetCurrentOGLData(void) __attribute__((weak));
#endif
@@ -2939,7 +2941,15 @@ void Nlm_SaveImagePNG(Nlm_Char *fname)
png_structp png_ptr = NULL;
png_infop info_ptr = NULL;
Nlm_Boolean doInterlacing = TRUE;
- TOGL_Data *OGL_Data = (TOGL_Data *)(Cn3D_GetCurrentOGLData());
+ TOGL_Data *OGL_Data;
+
+ if (!Cn3D_GetCurrentOGLData) {
+ Message(MSG_ERROR, "PNG output unavailable; "
+ "please relink application with -lncbicn3d.");
+ return;
+ }
+
+ OGL_Data = (TOGL_Data *)(Cn3D_GetCurrentOGLData());
#if defined(WIN_MOTIF)
GLint glSize;
@@ -3720,4 +3730,3 @@ void Nlm_AddHalfWorm3D(Nlm_Picture3D pic,
if (fblock)
MemFree(fblock);
}
-
diff --git a/vibrant/vibmain.c b/vibrant/vibmain.c
index 3c5bd9ad..1d010ee3 100644
--- a/vibrant/vibmain.c
+++ b/vibrant/vibmain.c
@@ -44,6 +44,21 @@
+extern Nlm_Int2 Nlm_Main(void) __attribute__((weak));
+
+static Nlm_Int2 s_CallNlmMain(void)
+{
+ if (Nlm_Main) {
+ return Nlm_Main();
+ } else {
+ ErrPost(0, 0, "Neither main nor Nlm_Main defined by program.");
+ return -1;
+ }
+}
+
+#define Nlm_Main s_CallNlmMain
+
+
#ifdef WIN_MAC
#ifdef OS_UNIX_DARWIN
int main (int argc, char *argv[])
diff --git a/vibrant/vibwndws.c b/vibrant/vibwndws.c
index c0f5109b..0b61810d 100644
--- a/vibrant/vibwndws.c
+++ b/vibrant/vibwndws.c
@@ -6818,7 +6818,7 @@ extern void Nlm_VibMainPrelude (int argc, char *argv[])
Nlm_InitPrompt ();
Nlm_InitSlate ();
Nlm_InitTexts ();
- if (! Nlm_SetupWindows ()) return;
+ if (! Nlm_SetupWindows ()) exit(1);
Nlm_RegisterWindows ();
Nlm_RegisterTexts ();
Nlm_RegisterSlates ();