diff options
Diffstat (limited to 'debian/tests/test-data/idfetch_g1234.npset')
-rw-r--r-- | debian/tests/test-data/idfetch_g1234.npset | 457 |
1 files changed, 457 insertions, 0 deletions
diff --git a/debian/tests/test-data/idfetch_g1234.npset b/debian/tests/test-data/idfetch_g1234.npset new file mode 100644 index 00000000..b06221de --- /dev/null +++ b/debian/tests/test-data/idfetch_g1234.npset @@ -0,0 +1,457 @@ +Seq-entry ::= set { + level 1 , + class nuc-prot , + descr { + source { + org { + taxname "Ovis aries" , + common "sheep" , + db { + { + db "taxon" , + tag + id 9940 } } , + orgname { + name + binomial { + genus "Ovis" , + species "aries" } , + mod { + { + subtype strain , + subname "domestic" } } , + lineage "Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; + Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; + Ruminantia; Pecora; Bovidae; Caprinae; Ovis" , + gcode 1 , + mgcode 2 , + div "MAM" } } , + subtype { + { + subtype other , + name "Allele: C4-2H.1" } } } , + pub { + pub { + sub { + authors { + names + std { + { + name + name { + last "Ren" , + initials "X." } } } , + affil + str "X. Ren, The MRC Immunochemistry Unit, Dept of Biochemistry, + University of Oxford, South Parks Road, Oxford OX1 3QU, UK" } , + medium other , + date + std { + year 1992 , + month 6 , + day 22 } } } } , + pub { + pub { + pmid 8423050 , + article { + title { + name "The thioester and isotypic sites of complement component C4 + in sheep and cattle." } , + authors { + names + std { + { + name + name { + last "Ren" , + initials "X.D." } } , + { + name + name { + last "Dodds" , + initials "A.W." } } , + { + name + name { + last "Law" , + initials "S.K." } } } , + affil + str "Department of Biochemistry, University of Oxford, UK." } , + from + journal { + title { + iso-jta "Immunogenetics" , + ml-jta "Immunogenetics" , + issn "0093-7711" , + name "Immunogenetics" } , + imp { + date + std { + year 1993 } , + volume "37" , + issue "2" , + pages "120-128" , + language "eng" , + pubstatus ppublish , + history { + { + pubstatus pubmed , + date + std { + year 1993 , + month 1 , + day 1 } } , + { + pubstatus medline , + date + std { + year 1993 , + month 1 , + day 1 , + hour 0 , + minute 1 } } , + { + pubstatus other , + date + std { + year 1993 , + month 1 , + day 1 , + hour 0 , + minute 0 } } } } } , + ids { + doi "10.1007/BF00216835" , + pubmed 8423050 } } } } , + comment "See also X66994-99" , + update-date + std { + year 2016 , + month 7 , + day 14 } } , + seq-set { + seq { + id { + embl { + accession "X66994" , + version 1 } , + gi 1234 } , + descr { + title "O.aries (C4-2H.1) C4 gene" , + molinfo { + biomol genomic } , + embl { + div mam , + creation-date + std { + year 1992 , + month 7 , + day 10 } , + update-date + std { + year 2006 , + month 11 , + day 14 } , + keywords { + "complement component" , + "complement component C4" } } , + create-date + std { + year 1992 , + month 7 , + day 10 } } , + inst { + repr raw , + mol dna , + length 945 , + seq-data + ncbi2na '50A79AA040538577E9D411E9E7D59C5E8421624BA25E7955E214285996E +8DD35202BDE2E49A624A2EA94A22A4BC3A09EA497ABAD224A8222392D54BA00AAF17FD45ECEBB8 +5D2793F5FD429C4668D4A0FD80088EBD73AA7EBC4DA84B245EB8BFA28BB5EAEEEA2A94AFEB8492 +25273CEA2240CA1592CFAD53B91ECBB7229CD509CE5FDDD7729D1A5FEE78231E2FE9528D2BA9A7 +71C009C4A21253BA79FD5241A8E3A74F51855ED7BCD44A8CE4ACE89EA29EA52A9128AA22D15E55 +D9476EBE79E79E70B6F12DBB5077B9855321A49514A759ED5EABDD4A42047A2EAF94FD7DD43939 +0BBFDE547D052A29F2EA098C0'H } , + annot { + { + data + ftable { + { + data + rna { + type mRNA } , + partial TRUE , + location + mix { + int { + from 0 , + to 133 , + id + gi 1234 , + fuzz-from + lim lt } , + int { + from 298 , + to 373 , + id + gi 1234 } , + int { + from 530 , + to 686 , + id + gi 1234 } , + int { + from 924 , + to 944 , + id + gi 1234 , + fuzz-to + lim gt } } } , + { + data + imp { + key "exon" } , + partial TRUE , + location + int { + from 0 , + to 133 , + id + gi 1234 , + fuzz-from + lim lt } , + qual { + { + qual "number" , + val "24" } } } , + { + data + imp { + key "misc_feature" } , + comment "thioester site" , + location + int { + from 7 , + to 18 , + id + gi 1234 } } , + { + data + imp { + key "intron" } , + location + int { + from 134 , + to 297 , + id + gi 1234 } , + qual { + { + qual "number" , + val "24" } } } , + { + data + imp { + key "exon" } , + location + int { + from 298 , + to 373 , + id + gi 1234 } , + qual { + { + qual "number" , + val "25" } } } , + { + data + imp { + key "intron" } , + location + int { + from 374 , + to 529 , + id + gi 1234 } , + qual { + { + qual "number" , + val "25" } } } , + { + data + imp { + key "exon" } , + location + int { + from 530 , + to 686 , + id + gi 1234 } , + qual { + { + qual "number" , + val "26" } } } , + { + data + imp { + key "misc_feature" } , + comment "isotypic site" , + location + int { + from 657 , + to 674 , + id + gi 1234 } } , + { + data + imp { + key "intron" } , + location + int { + from 687 , + to 923 , + id + gi 1234 } , + qual { + { + qual "number" , + val "26" } } } , + { + data + imp { + key "exon" } , + partial TRUE , + location + int { + from 924 , + to 944 , + id + gi 1234 , + fuzz-to + lim gt } , + qual { + { + qual "number" , + val "27" } } } , + { + data + gene { + locus "C4" } , + partial TRUE , + location + int { + from 0 , + to 944 , + id + gi 1234 , + fuzz-from + lim lt , + fuzz-to + lim gt } } } } } } , + seq { + id { + embl { + accession "CAA47393" , + version 1 } , + gi 1235 } , + descr { + title "complement component C4, partial [Ovis aries]" , + molinfo { + biomol peptide , + completeness no-ends } , + create-date + std { + year 1992 , + month 7 , + day 10 } } , + inst { + repr raw , + mol aa , + length 129 , + seq-data + ncbieaa "QGCGEQTMTLLAPTLAASRYLDKTEQWSLLPPETKDRAVDLIQKGYTRIQEFRKRDGSY +GAWLHRDSSTWLTAFVLKILSLAQDQVGGSTKKLQETAMWLLSQQRDDGSFHDPCPVIHRDMQGGLVGSD" } , + annot { + { + data + ftable { + { + data + prot { + name { + "complement component C4" } } , + partial TRUE , + location + int { + from 0 , + to 128 , + id + gi 1235 , + fuzz-from + lim lt , + fuzz-to + lim gt } } } } } } } , + annot { + { + data + ftable { + { + data + cdregion { + frame two , + code { + id 1 } } , + partial TRUE , + product + whole + gi 1235 , + location + mix { + int { + from 0 , + to 133 , + id + gi 1234 , + fuzz-from + lim lt } , + int { + from 298 , + to 373 , + id + gi 1234 } , + int { + from 530 , + to 686 , + id + gi 1234 } , + int { + from 924 , + to 944 , + id + gi 1234 , + fuzz-to + lim gt } } , + dbxref { + { + db "GOA" , + tag + str "Q29410" } , + { + db "HSSP" , + tag + str "1HZF" } , + { + db "InterPro" , + tag + str "IPR008930" } , + { + db "InterPro" , + tag + str "IPR011626" } , + { + db "InterPro" , + tag + str "IPR019565" } , + { + db "UniProtKB/TrEMBL" , + tag + str "Q29410" } } } } } } } |