Seq-submit ::= { sub { contact { name "R. Taussig" , address { "Room 123, Bldg 82" , "Univ of x" , "City EH 23 OR" , "Country" } , phone "1-222-122-22-2-2-2" , email "rt@123.xyz" } , cit { authors { names std { { name name { last "Taussig" , initials "R" } , affil std { affil "Univ of x" , div "Dept of Y" , city "YourCity" , sub "YourState" , country "Your country" , street "123 Your Street" } , is-corr TRUE } , { name name { last "Scheller" , initials "R.H." } } } } , imp { date std { year 1986 , month 4 , day 22 } } } , reldate std { year 1986 , month 10 , day 1 } } , data entrys { set { class nuc-prot , descr { title "Aplysia californica FMRFamide mRNA, 3' end, clone FMRF-2. and translated products" , comment "FMRF-2 lacks a 192 bp region spanning residues 1787-1978 on the genomic sequence (M14958), which would come after position 191. This clone lacks the consensus acceptor site 'ag'. The dinucleotide 'at' is present at the 3' border of the deleted region, and therefore, this sequence probably does not arise from an RNA processing event. The highly repetitive nature of much of the gene coupled with sequence polymorphisms leaves open the possibility of an organization which would conform to the splicing consensus rules. Alternatively, the deletion may represent a cloning artifact." , pub { pub { article { title { name "The Aplysia FMRFamide gene encodes sequences related to mammalian brain peptides" } , authors { names str { "Taussig,R." , "Scheller,R.H." } } , from journal { title { iso-jta "DNA" } , imp { date std { year 1986 } , volume "5" , pages "453-461" } } } } } , org { taxname "Aplysia californica" } } , seq-set { seq { id { local id 1 } , descr { title "Aplysia californica FMRFamide mRNA, 3' end, clone FMRF-2." , genbank { source "Aplysia californica abdominal ganglion, cDNA to mRNA, clone FMRF-2." , keywords { "FMRFamide" , "neuropeptide" } , origin "About 192 bp after segment [DNA 5, 453-461 (1986)]." , date "31-AUG-1987" , div "INV" , taxonomy "Eukaryota; Animalia; Eumetazoa; Mollusca; Gastropoda; Opisthobranchia; Anaspidea; Aplysiidae." } } , inst { repr raw , mol rna , length 484 , topology linear , strand ss , seq-data ncbi2na 'D84023F38AFEA00BB2826182E8C02BF38AFEA009BE81E38EE8406BD 388FE900B7E81638EE8406BD398FEA00B7E81E08EE8406BD388FE900B7E81E08EC8406BD388FEA 01AFCE23FAD82EFAA3D40CDAA64249801B4E1048740101848109840C2D700C412E33FBC106EEBB 8FDF5F4CCF3F9F840EE3FA8C0B100EF'H } , annot { { data ftable { { data rna { type mRNA } , location int { from 0 , to 483 , id local id 1 , fuzz-from lim lt } , qual { { qual "note" , val "FMRF2 mRNA" } } } , { data imp { key "mat_peptide" , loc "12..23" } , location int { from 11 , to 22 , id local id 1 } , qual { { qual "note" , val "FMRFamide copy X" } , { qual "codon_start" , val "1" } } } , { data imp { key "mat_peptide" , loc "60..71" } , location int { from 59 , to 70 , id local id 1 } , qual { { qual "note" , val "FMRFamide copy X+1" } , { qual "codon_start" , val "1" } } } , { data imp { key "mat_peptide" , loc "108..119" } , location int { from 107 , to 118 , id local id 1 } , qual { { qual "note" , val "FMRFamide copy X+2" } , { qual "codon_start" , val "1" } } } , { data imp { key "mat_peptide" , loc "156..167" } , location int { from 155 , to 166 , id local id 1 } , qual { { qual "note" , val "FMRFamide copy X+3" } , { qual "codon_start" , val "1" } } } , { data imp { key "mat_peptide" , loc "204..215" } , location int { from 203 , to 214 , id local id 1 } , qual { { qual "note" , val "FMRFamide copy X+4" } , { qual "codon_start" , val "1" } } } , { data imp { key "mat_peptide" , loc "252..263" } , location int { from 251 , to 262 , id local id 1 } , qual { { qual "note" , val "FMRFamide copy X+5" } , { qual "codon_start" , val "1" } } } , { data imp { key "mat_peptide" , loc "273..284" } , location int { from 272 , to 283 , id local id 1 } , qual { { qual "note" , val "FMRFamide copy X+6" } , { qual "codon_start" , val "1" } } } } } } } , seq { id { local id 2 } , descr { title "FMRFamide precursor" , method concept-trans } , inst { repr raw , mol aa , length 127 , seq-data iupacaa "DKRFMRFGKSVGSDEVDKRFMRFGKSVGTDDVDKRFMRFGKSLGTDDVDKRFMRF GKSLGTEDVDKRFMRFGKSLGTEDVDKRFMRFGKRFMRFGRSVGDSKYRGASSENVMTTDSKQTTEQATNKS" } , annot { { data ftable { { data prot { desc "FMRFamide precursor" } , location whole local id 2 } } } } } } , annot { { data ftable { { data cdregion { frame three , code { id 1 } } , product whole local id 2 , location int { from 0 , to 385 , id local id 1 , fuzz-from lim lt } , qual { { qual "note" , val "(AA at 3)" } } } } } } } } }