delete vendor tree

author: Reinhard Tartler <siretart@tauware.de> 2020-12-02 09:24:47 -0500
committer: Reinhard Tartler <siretart@tauware.de> 2020-12-02 09:24:58 -0500
commit: 29cc1453eab24cbbfcdd21b9b86a36ff3183a840 (patch)
tree: 6a8ea32fea737936384e95e2ba2109dfc373697c /vendor/golang.org/x/text/language
parent: 8086b728c2d5c06e05010693cdbe64e972a31128 (diff)
13 files changed, 0 insertions, 8087 deletions
diff --git a/vendor/golang.org/x/text/language/Makefile b/vendor/golang.org/x/text/language/Makefile
deleted file mode 100644
index 79f0057..0000000
--- a/vendor/golang.org/x/text/language/Makefile
+++ /dev/null
@@ -1,16 +0,0 @@
-# Copyright 2013 The Go Authors. All rights reserved.
-# Use of this source code is governed by a BSD-style
-# license that can be found in the LICENSE file.
-
-CLEANFILES+=maketables
-
-maketables: maketables.go
-	go build $^
-
-tables:	maketables
-	./maketables > tables.go
-	gofmt -w -s tables.go
-
-# Build (but do not run) maketables during testing,
-# just to make sure it still compiles.
-testshort: maketables
diff --git a/vendor/golang.org/x/text/language/common.go b/vendor/golang.org/x/text/language/common.go
deleted file mode 100644
index 9d86e18..0000000
--- a/vendor/golang.org/x/text/language/common.go
+++ /dev/null
@@ -1,16 +0,0 @@
-// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
-
-package language
-
-// This file contains code common to the maketables.go and the package code.
-
-// langAliasType is the type of an alias in langAliasMap.
-type langAliasType int8
-
-const (
-	langDeprecated langAliasType = iota
-	langMacro
-	langLegacy
-
-	langAliasTypeUnknown langAliasType = -1
-)
diff --git a/vendor/golang.org/x/text/language/coverage.go b/vendor/golang.org/x/text/language/coverage.go
deleted file mode 100644
index 101fd23..0000000
--- a/vendor/golang.org/x/text/language/coverage.go
+++ /dev/null
@@ -1,197 +0,0 @@
-// Copyright 2014 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-package language
-
-import (
-	"fmt"
-	"sort"
-)
-
-// The Coverage interface is used to define the level of coverage of an
-// internationalization service. Note that not all types are supported by all
-// services. As lists may be generated on the fly, it is recommended that users
-// of a Coverage cache the results.
-type Coverage interface {
-	// Tags returns the list of supported tags.
-	Tags() []Tag
-
-	// BaseLanguages returns the list of supported base languages.
-	BaseLanguages() []Base
-
-	// Scripts returns the list of supported scripts.
-	Scripts() []Script
-
-	// Regions returns the list of supported regions.
-	Regions() []Region
-}
-
-var (
-	// Supported defines a Coverage that lists all supported subtags. Tags
-	// always returns nil.
-	Supported Coverage = allSubtags{}
-)
-
-// TODO:
-// - Support Variants, numbering systems.
-// - CLDR coverage levels.
-// - Set of common tags defined in this package.
-
-type allSubtags struct{}
-
-// Regions returns the list of supported regions. As all regions are in a
-// consecutive range, it simply returns a slice of numbers in increasing order.
-// The "undefined" region is not returned.
-func (s allSubtags) Regions() []Region {
-	reg := make([]Region, numRegions)
-	for i := range reg {
-		reg[i] = Region{regionID(i + 1)}
-	}
-	return reg
-}
-
-// Scripts returns the list of supported scripts. As all scripts are in a
-// consecutive range, it simply returns a slice of numbers in increasing order.
-// The "undefined" script is not returned.
-func (s allSubtags) Scripts() []Script {
-	scr := make([]Script, numScripts)
-	for i := range scr {
-		scr[i] = Script{scriptID(i + 1)}
-	}
-	return scr
-}
-
-// BaseLanguages returns the list of all supported base languages. It generates
-// the list by traversing the internal structures.
-func (s allSubtags) BaseLanguages() []Base {
-	base := make([]Base, 0, numLanguages)
-	for i := 0; i < langNoIndexOffset; i++ {
-		// We included "und" already for the value 0.
-		if i != nonCanonicalUnd {
-			base = append(base, Base{langID(i)})
-		}
-	}
-	i := langNoIndexOffset
-	for _, v := range langNoIndex {
-		for k := 0; k < 8; k++ {
-			if v&1 == 1 {
-				base = append(base, Base{langID(i)})
-			}
-			v >>= 1
-			i++
-		}
-	}
-	return base
-}
-
-// Tags always returns nil.
-func (s allSubtags) Tags() []Tag {
-	return nil
-}
-
-// coverage is used used by NewCoverage which is used as a convenient way for
-// creating Coverage implementations for partially defined data. Very often a
-// package will only need to define a subset of slices. coverage provides a
-// convenient way to do this. Moreover, packages using NewCoverage, instead of
-// their own implementation, will not break if later new slice types are added.
-type coverage struct {
-	tags    func() []Tag
-	bases   func() []Base
-	scripts func() []Script
-	regions func() []Region
-}
-
-func (s *coverage) Tags() []Tag {
-	if s.tags == nil {
-		return nil
-	}
-	return s.tags()
-}
-
-// bases implements sort.Interface and is used to sort base languages.
-type bases []Base
-
-func (b bases) Len() int {
-	return len(b)
-}
-
-func (b bases) Swap(i, j int) {
-	b[i], b[j] = b[j], b[i]
-}
-
-func (b bases) Less(i, j int) bool {
-	return b[i].langID < b[j].langID
-}
-
-// BaseLanguages returns the result from calling s.bases if it is specified or
-// otherwise derives the set of supported base languages from tags.
-func (s *coverage) BaseLanguages() []Base {
-	if s.bases == nil {
-		tags := s.Tags()
-		if len(tags) == 0 {
-			return nil
-		}
-		a := make([]Base, len(tags))
-		for i, t := range tags {
-			a[i] = Base{langID(t.lang)}
-		}
-		sort.Sort(bases(a))
-		k := 0
-		for i := 1; i < len(a); i++ {
-			if a[k] != a[i] {
-				k++
-				a[k] = a[i]
-			}
-		}
-		return a[:k+1]
-	}
-	return s.bases()
-}
-
-func (s *coverage) Scripts() []Script {
-	if s.scripts == nil {
-		return nil
-	}
-	return s.scripts()
-}
-
-func (s *coverage) Regions() []Region {
-	if s.regions == nil {
-		return nil
-	}
-	return s.regions()
-}
-
-// NewCoverage returns a Coverage for the given lists. It is typically used by
-// packages providing internationalization services to define their level of
-// coverage. A list may be of type []T or func() []T, where T is either Tag,
-// Base, Script or Region. The returned Coverage derives the value for Bases
-// from Tags if no func or slice for []Base is specified. For other unspecified
-// types the returned Coverage will return nil for the respective methods.
-func NewCoverage(list ...interface{}) Coverage {
-	s := &coverage{}
-	for _, x := range list {
-		switch v := x.(type) {
-		case func() []Base:
-			s.bases = v
-		case func() []Script:
-			s.scripts = v
-		case func() []Region:
-			s.regions = v
-		case func() []Tag:
-			s.tags = v
-		case []Base:
-			s.bases = func() []Base { return v }
-		case []Script:
-			s.scripts = func() []Script { return v }
-		case []Region:
-			s.regions = func() []Region { return v }
-		case []Tag:
-			s.tags = func() []Tag { return v }
-		default:
-			panic(fmt.Sprintf("language: unsupported set type %T", v))
-		}
-	}
-	return s
-}
diff --git a/vendor/golang.org/x/text/language/doc.go b/vendor/golang.org/x/text/language/doc.go
deleted file mode 100644
index 8afecd5..0000000
--- a/vendor/golang.org/x/text/language/doc.go
+++ /dev/null
@@ -1,102 +0,0 @@
-// Copyright 2017 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-// Package language implements BCP 47 language tags and related functionality.
-//
-// The most important function of package language is to match a list of
-// user-preferred languages to a list of supported languages.
-// It alleviates the developer of dealing with the complexity of this process
-// and provides the user with the best experience
-// (see https://blog.golang.org/matchlang).
-//
-//
-// Matching preferred against supported languages
-//
-// A Matcher for an application that supports English, Australian English,
-// Danish, and standard Mandarin can be created as follows:
-//
-//    var matcher = language.NewMatcher([]language.Tag{
-//        language.English,   // The first language is used as fallback.
-//        language.MustParse("en-AU"),
-//        language.Danish,
-//        language.Chinese,
-//    })
-//
-// This list of supported languages is typically implied by the languages for
-// which there exists translations of the user interface.
-//
-// User-preferred languages usually come as a comma-separated list of BCP 47
-// language tags.
-// The MatchString finds best matches for such strings:
-//
-//    handler(w http.ResponseWriter, r *http.Request) {
-//        lang, _ := r.Cookie("lang")
-//        accept := r.Header.Get("Accept-Language")
-//        tag, _ := language.MatchStrings(matcher, lang.String(), accept)
-//
-//        // tag should now be used for the initialization of any
-//        // locale-specific service.
-//    }
-//
-// The Matcher's Match method can be used to match Tags directly.
-//
-// Matchers are aware of the intricacies of equivalence between languages, such
-// as deprecated subtags, legacy tags, macro languages, mutual
-// intelligibility between scripts and languages, and transparently passing
-// BCP 47 user configuration.
-// For instance, it will know that a reader of Bokmål Danish can read Norwegian
-// and will know that Cantonese ("yue") is a good match for "zh-HK".
-//
-//
-// Using match results
-//
-// To guarantee a consistent user experience to the user it is important to
-// use the same language tag for the selection of any locale-specific services.
-// For example, it is utterly confusing to substitute spelled-out numbers
-// or dates in one language in text of another language.
-// More subtly confusing is using the wrong sorting order or casing
-// algorithm for a certain language.
-//
-//    All the packages in x/text that provide locale-specific services
-//    (e.g. collate, cases) should be initialized with the tag that was
-//    obtained at the start of an interaction with the user.
-//
-// Note that Tag that is returned by Match and MatchString may differ from any
-// of the supported languages, as it may contain carried over settings from
-// the user tags.
-// This may be inconvenient when your application has some additional
-// locale-specific data for your supported languages.
-// Match and MatchString both return the index of the matched supported tag
-// to simplify associating such data with the matched tag.
-//
-//
-// Canonicalization
-//
-// If one uses the Matcher to compare languages one does not need to
-// worry about canonicalization.
-//
-// The meaning of a Tag varies per application. The language package
-// therefore delays canonicalization and preserves information as much
-// as possible. The Matcher, however, will always take into account that
-// two different tags may represent the same language.
-//
-// By default, only legacy and deprecated tags are converted into their
-// canonical equivalent. All other information is preserved. This approach makes
-// the confidence scores more accurate and allows matchers to distinguish
-// between variants that are otherwise lost.
-//
-// As a consequence, two tags that should be treated as identical according to
-// BCP 47 or CLDR, like "en-Latn" and "en", will be represented differently. The
-// Matcher handles such distinctions, though, and is aware of the
-// equivalence relations. The CanonType type can be used to alter the
-// canonicalization form.
-//
-// References
-//
-// BCP 47 - Tags for Identifying Languages http://tools.ietf.org/html/bcp47
-//
-package language // import "golang.org/x/text/language"
-
-// TODO: explanation on how to match languages for your own locale-specific
-// service.
diff --git a/vendor/golang.org/x/text/language/go1_1.go b/vendor/golang.org/x/text/language/go1_1.go
deleted file mode 100644
index 380f4c0..0000000
--- a/vendor/golang.org/x/text/language/go1_1.go
+++ /dev/null
@@ -1,38 +0,0 @@
-// Copyright 2013 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-// +build !go1.2
-
-package language
-
-import "sort"
-
-func sortStable(s sort.Interface) {
-	ss := stableSort{
-		s:   s,
-		pos: make([]int, s.Len()),
-	}
-	for i := range ss.pos {
-		ss.pos[i] = i
-	}
-	sort.Sort(&ss)
-}
-
-type stableSort struct {
-	s   sort.Interface
-	pos []int
-}
-
-func (s *stableSort) Len() int {
-	return len(s.pos)
-}
-
-func (s *stableSort) Less(i, j int) bool {
-	return s.s.Less(i, j) || !s.s.Less(j, i) && s.pos[i] < s.pos[j]
-}
-
-func (s *stableSort) Swap(i, j int) {
-	s.s.Swap(i, j)
-	s.pos[i], s.pos[j] = s.pos[j], s.pos[i]
-}
diff --git a/vendor/golang.org/x/text/language/go1_2.go b/vendor/golang.org/x/text/language/go1_2.go
deleted file mode 100644
index 38268c5..0000000
--- a/vendor/golang.org/x/text/language/go1_2.go
+++ /dev/null
@@ -1,11 +0,0 @@
-// Copyright 2013 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-// +build go1.2
-
-package language
-
-import "sort"
-
-var sortStable = sort.Stable
diff --git a/vendor/golang.org/x/text/language/index.go b/vendor/golang.org/x/text/language/index.go
deleted file mode 100644
index 5311e5c..0000000
--- a/vendor/golang.org/x/text/language/index.go
+++ /dev/null
@@ -1,783 +0,0 @@
-// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
-
-package language
-
-// NumCompactTags is the number of common tags. The maximum tag is
-// NumCompactTags-1.
-const NumCompactTags = 768
-
-var specialTags = []Tag{ // 2 elements
-	0: {lang: 0xd7, region: 0x6e, script: 0x0, pVariant: 0x5, pExt: 0xe, str: "ca-ES-valencia"},
-	1: {lang: 0x139, region: 0x135, script: 0x0, pVariant: 0x5, pExt: 0x5, str: "en-US-u-va-posix"},
-} // Size: 72 bytes
-
-var coreTags = map[uint32]uint16{
-	0x0:        0,   // und
-	0x01600000: 3,   // af
-	0x016000d2: 4,   // af-NA
-	0x01600161: 5,   // af-ZA
-	0x01c00000: 6,   // agq
-	0x01c00052: 7,   // agq-CM
-	0x02100000: 8,   // ak
-	0x02100080: 9,   // ak-GH
-	0x02700000: 10,  // am
-	0x0270006f: 11,  // am-ET
-	0x03a00000: 12,  // ar
-	0x03a00001: 13,  // ar-001
-	0x03a00023: 14,  // ar-AE
-	0x03a00039: 15,  // ar-BH
-	0x03a00062: 16,  // ar-DJ
-	0x03a00067: 17,  // ar-DZ
-	0x03a0006b: 18,  // ar-EG
-	0x03a0006c: 19,  // ar-EH
-	0x03a0006d: 20,  // ar-ER
-	0x03a00097: 21,  // ar-IL
-	0x03a0009b: 22,  // ar-IQ
-	0x03a000a1: 23,  // ar-JO
-	0x03a000a8: 24,  // ar-KM
-	0x03a000ac: 25,  // ar-KW
-	0x03a000b0: 26,  // ar-LB
-	0x03a000b9: 27,  // ar-LY
-	0x03a000ba: 28,  // ar-MA
-	0x03a000c9: 29,  // ar-MR
-	0x03a000e1: 30,  // ar-OM
-	0x03a000ed: 31,  // ar-PS
-	0x03a000f3: 32,  // ar-QA
-	0x03a00108: 33,  // ar-SA
-	0x03a0010b: 34,  // ar-SD
-	0x03a00115: 35,  // ar-SO
-	0x03a00117: 36,  // ar-SS
-	0x03a0011c: 37,  // ar-SY
-	0x03a00120: 38,  // ar-TD
-	0x03a00128: 39,  // ar-TN
-	0x03a0015e: 40,  // ar-YE
-	0x04000000: 41,  // ars
-	0x04300000: 42,  // as
-	0x04300099: 43,  // as-IN
-	0x04400000: 44,  // asa
-	0x0440012f: 45,  // asa-TZ
-	0x04800000: 46,  // ast
-	0x0480006e: 47,  // ast-ES
-	0x05800000: 48,  // az
-	0x0581f000: 49,  // az-Cyrl
-	0x0581f032: 50,  // az-Cyrl-AZ
-	0x05857000: 51,  // az-Latn
-	0x05857032: 52,  // az-Latn-AZ
-	0x05e00000: 53,  // bas
-	0x05e00052: 54,  // bas-CM
-	0x07100000: 55,  // be
-	0x07100047: 56,  // be-BY
-	0x07500000: 57,  // bem
-	0x07500162: 58,  // bem-ZM
-	0x07900000: 59,  // bez
-	0x0790012f: 60,  // bez-TZ
-	0x07e00000: 61,  // bg
-	0x07e00038: 62,  // bg-BG
-	0x08200000: 63,  // bh
-	0x0a000000: 64,  // bm
-	0x0a0000c3: 65,  // bm-ML
-	0x0a500000: 66,  // bn
-	0x0a500035: 67,  // bn-BD
-	0x0a500099: 68,  // bn-IN
-	0x0a900000: 69,  // bo
-	0x0a900053: 70,  // bo-CN
-	0x0a900099: 71,  // bo-IN
-	0x0b200000: 72,  // br
-	0x0b200078: 73,  // br-FR
-	0x0b500000: 74,  // brx
-	0x0b500099: 75,  // brx-IN
-	0x0b700000: 76,  // bs
-	0x0b71f000: 77,  // bs-Cyrl
-	0x0b71f033: 78,  // bs-Cyrl-BA
-	0x0b757000: 79,  // bs-Latn
-	0x0b757033: 80,  // bs-Latn-BA
-	0x0d700000: 81,  // ca
-	0x0d700022: 82,  // ca-AD
-	0x0d70006e: 83,  // ca-ES
-	0x0d700078: 84,  // ca-FR
-	0x0d70009e: 85,  // ca-IT
-	0x0db00000: 86,  // ccp
-	0x0db00035: 87,  // ccp-BD
-	0x0db00099: 88,  // ccp-IN
-	0x0dc00000: 89,  // ce
-	0x0dc00106: 90,  // ce-RU
-	0x0df00000: 91,  // cgg
-	0x0df00131: 92,  // cgg-UG
-	0x0e500000: 93,  // chr
-	0x0e500135: 94,  // chr-US
-	0x0e900000: 95,  // ckb
-	0x0e90009b: 96,  // ckb-IQ
-	0x0e90009c: 97,  // ckb-IR
-	0x0fa00000: 98,  // cs
-	0x0fa0005e: 99,  // cs-CZ
-	0x0fe00000: 100, // cu
-	0x0fe00106: 101, // cu-RU
-	0x10000000: 102, // cy
-	0x1000007b: 103, // cy-GB
-	0x10100000: 104, // da
-	0x10100063: 105, // da-DK
-	0x10100082: 106, // da-GL
-	0x10800000: 107, // dav
-	0x108000a4: 108, // dav-KE
-	0x10d00000: 109, // de
-	0x10d0002e: 110, // de-AT
-	0x10d00036: 111, // de-BE
-	0x10d0004e: 112, // de-CH
-	0x10d00060: 113, // de-DE
-	0x10d0009e: 114, // de-IT
-	0x10d000b2: 115, // de-LI
-	0x10d000b7: 116, // de-LU
-	0x11700000: 117, // dje
-	0x117000d4: 118, // dje-NE
-	0x11f00000: 119, // dsb
-	0x11f00060: 120, // dsb-DE
-	0x12400000: 121, // dua
-	0x12400052: 122, // dua-CM
-	0x12800000: 123, // dv
-	0x12b00000: 124, // dyo
-	0x12b00114: 125, // dyo-SN
-	0x12d00000: 126, // dz
-	0x12d00043: 127, // dz-BT
-	0x12f00000: 128, // ebu
-	0x12f000a4: 129, // ebu-KE
-	0x13000000: 130, // ee
-	0x13000080: 131, // ee-GH
-	0x13000122: 132, // ee-TG
-	0x13600000: 133, // el
-	0x1360005d: 134, // el-CY
-	0x13600087: 135, // el-GR
-	0x13900000: 136, // en
-	0x13900001: 137, // en-001
-	0x1390001a: 138, // en-150
-	0x13900025: 139, // en-AG
-	0x13900026: 140, // en-AI
-	0x1390002d: 141, // en-AS
-	0x1390002e: 142, // en-AT
-	0x1390002f: 143, // en-AU
-	0x13900034: 144, // en-BB
-	0x13900036: 145, // en-BE
-	0x1390003a: 146, // en-BI
-	0x1390003d: 147, // en-BM
-	0x13900042: 148, // en-BS
-	0x13900046: 149, // en-BW
-	0x13900048: 150, // en-BZ
-	0x13900049: 151, // en-CA
-	0x1390004a: 152, // en-CC
-	0x1390004e: 153, // en-CH
-	0x13900050: 154, // en-CK
-	0x13900052: 155, // en-CM
-	0x1390005c: 156, // en-CX
-	0x1390005d: 157, // en-CY
-	0x13900060: 158, // en-DE
-	0x13900061: 159, // en-DG
-	0x13900063: 160, // en-DK
-	0x13900064: 161, // en-DM
-	0x1390006d: 162, // en-ER
-	0x13900072: 163, // en-FI
-	0x13900073: 164, // en-FJ
-	0x13900074: 165, // en-FK
-	0x13900075: 166, // en-FM
-	0x1390007b: 167, // en-GB
-	0x1390007c: 168, // en-GD
-	0x1390007f: 169, // en-GG
-	0x13900080: 170, // en-GH
-	0x13900081: 171, // en-GI
-	0x13900083: 172, // en-GM
-	0x1390008a: 173, // en-GU
-	0x1390008c: 174, // en-GY
-	0x1390008d: 175, // en-HK
-	0x13900096: 176, // en-IE
-	0x13900097: 177, // en-IL
-	0x13900098: 178, // en-IM
-	0x13900099: 179, // en-IN
-	0x1390009a: 180, // en-IO
-	0x1390009f: 181, // en-JE
-	0x139000a0: 182, // en-JM
-	0x139000a4: 183, // en-KE
-	0x139000a7: 184, // en-KI
-	0x139000a9: 185, // en-KN
-	0x139000ad: 186, // en-KY
-	0x139000b1: 187, // en-LC
-	0x139000b4: 188, // en-LR
-	0x139000b5: 189, // en-LS
-	0x139000bf: 190, // en-MG
-	0x139000c0: 191, // en-MH
-	0x139000c6: 192, // en-MO
-	0x139000c7: 193, // en-MP
-	0x139000ca: 194, // en-MS
-	0x139000cb: 195, // en-MT
-	0x139000cc: 196, // en-MU
-	0x139000ce: 197, // en-MW
-	0x139000d0: 198, // en-MY
-	0x139000d2: 199, // en-NA
-	0x139000d5: 200, // en-NF
-	0x139000d6: 201, // en-NG
-	0x139000d9: 202, // en-NL
-	0x139000dd: 203, // en-NR
-	0x139000df: 204, // en-NU
-	0x139000e0: 205, // en-NZ
-	0x139000e6: 206, // en-PG
-	0x139000e7: 207, // en-PH
-	0x139000e8: 208, // en-PK
-	0x139000eb: 209, // en-PN
-	0x139000ec: 210, // en-PR
-	0x139000f0: 211, // en-PW
-	0x13900107: 212, // en-RW
-	0x13900109: 213, // en-SB
-	0x1390010a: 214, // en-SC
-	0x1390010b: 215, // en-SD
-	0x1390010c: 216, // en-SE
-	0x1390010d: 217, // en-SG
-	0x1390010e: 218, // en-SH
-	0x1390010f: 219, // en-SI
-	0x13900112: 220, // en-SL
-	0x13900117: 221, // en-SS
-	0x1390011b: 222, // en-SX
-	0x1390011d: 223, // en-SZ
-	0x1390011f: 224, // en-TC
-	0x13900125: 225, // en-TK
-	0x13900129: 226, // en-TO
-	0x1390012c: 227, // en-TT
-	0x1390012d: 228, // en-TV
-	0x1390012f: 229, // en-TZ
-	0x13900131: 230, // en-UG
-	0x13900133: 231, // en-UM
-	0x13900135: 232, // en-US
-	0x13900139: 233, // en-VC
-	0x1390013c: 234, // en-VG
-	0x1390013d: 235, // en-VI
-	0x1390013f: 236, // en-VU
-	0x13900142: 237, // en-WS
-	0x13900161: 238, // en-ZA
-	0x13900162: 239, // en-ZM
-	0x13900164: 240, // en-ZW
-	0x13c00000: 241, // eo
-	0x13c00001: 242, // eo-001
-	0x13e00000: 243, // es
-	0x13e0001f: 244, // es-419
-	0x13e0002c: 245, // es-AR
-	0x13e0003f: 246, // es-BO
-	0x13e00041: 247, // es-BR
-	0x13e00048: 248, // es-BZ
-	0x13e00051: 249, // es-CL
-	0x13e00054: 250, // es-CO
-	0x13e00056: 251, // es-CR
-	0x13e00059: 252, // es-CU
-	0x13e00065: 253, // es-DO
-	0x13e00068: 254, // es-EA
-	0x13e00069: 255, // es-EC
-	0x13e0006e: 256, // es-ES
-	0x13e00086: 257, // es-GQ
-	0x13e00089: 258, // es-GT
-	0x13e0008f: 259, // es-HN
-	0x13e00094: 260, // es-IC
-	0x13e000cf: 261, // es-MX
-	0x13e000d8: 262, // es-NI
-	0x13e000e2: 263, // es-PA
-	0x13e000e4: 264, // es-PE
-	0x13e000e7: 265, // es-PH
-	0x13e000ec: 266, // es-PR
-	0x13e000f1: 267, // es-PY
-	0x13e0011a: 268, // es-SV
-	0x13e00135: 269, // es-US
-	0x13e00136: 270, // es-UY
-	0x13e0013b: 271, // es-VE
-	0x14000000: 272, // et
-	0x1400006a: 273, // et-EE
-	0x14500000: 274, // eu
-	0x1450006e: 275, // eu-ES
-	0x14600000: 276, // ewo
-	0x14600052: 277, // ewo-CM
-	0x14800000: 278, // fa
-	0x14800024: 279, // fa-AF
-	0x1480009c: 280, // fa-IR
-	0x14e00000: 281, // ff
-	0x14e00052: 282, // ff-CM
-	0x14e00084: 283, // ff-GN
-	0x14e000c9: 284, // ff-MR
-	0x14e00114: 285, // ff-SN
-	0x15100000: 286, // fi
-	0x15100072: 287, // fi-FI
-	0x15300000: 288, // fil
-	0x153000e7: 289, // fil-PH
-	0x15800000: 290, // fo
-	0x15800063: 291, // fo-DK
-	0x15800076: 292, // fo-FO
-	0x15e00000: 293, // fr
-	0x15e00036: 294, // fr-BE
-	0x15e00037: 295, // fr-BF
-	0x15e0003a: 296, // fr-BI
-	0x15e0003b: 297, // fr-BJ
-	0x15e0003c: 298, // fr-BL
-	0x15e00049: 299, // fr-CA
-	0x15e0004b: 300, // fr-CD
-	0x15e0004c: 301, // fr-CF
-	0x15e0004d: 302, // fr-CG
-	0x15e0004e: 303, // fr-CH
-	0x15e0004f: 304, // fr-CI
-	0x15e00052: 305, // fr-CM
-	0x15e00062: 306, // fr-DJ
-	0x15e00067: 307, // fr-DZ
-	0x15e00078: 308, // fr-FR
-	0x15e0007a: 309, // fr-GA
-	0x15e0007e: 310, // fr-GF
-	0x15e00084: 311, // fr-GN
-	0x15e00085: 312, // fr-GP
-	0x15e00086: 313, // fr-GQ
-	0x15e00091: 314, // fr-HT
-	0x15e000a8: 315, // fr-KM
-	0x15e000b7: 316, // fr-LU
-	0x15e000ba: 317, // fr-MA
-	0x15e000bb: 318, // fr-MC
-	0x15e000be: 319, // fr-MF
-	0x15e000bf: 320, // fr-MG
-	0x15e000c3: 321, // fr-ML
-	0x15e000c8: 322, // fr-MQ
-	0x15e000c9: 323, // fr-MR
-	0x15e000cc: 324, // fr-MU
-	0x15e000d3: 325, // fr-NC
-	0x15e000d4: 326, // fr-NE
-	0x15e000e5: 327, // fr-PF
-	0x15e000ea: 328, // fr-PM
-	0x15e00102: 329, // fr-RE
-	0x15e00107: 330, // fr-RW
-	0x15e0010a: 331, // fr-SC
-	0x15e00114: 332, // fr-SN
-	0x15e0011c: 333, // fr-SY
-	0x15e00120: 334, // fr-TD
-	0x15e00122: 335, // fr-TG
-	0x15e00128: 336, // fr-TN
-	0x15e0013f: 337, // fr-VU
-	0x15e00140: 338, // fr-WF
-	0x15e0015f: 339, // fr-YT
-	0x16900000: 340, // fur
-	0x1690009e: 341, // fur-IT
-	0x16d00000: 342, // fy
-	0x16d000d9: 343, // fy-NL
-	0x16e00000: 344, // ga
-	0x16e00096: 345, // ga-IE
-	0x17e00000: 346, // gd
-	0x17e0007b: 347, // gd-GB
-	0x19000000: 348, // gl
-	0x1900006e: 349, // gl-ES
-	0x1a300000: 350, // gsw
-	0x1a30004e: 351, // gsw-CH
-	0x1a300078: 352, // gsw-FR
-	0x1a3000b2: 353, // gsw-LI
-	0x1a400000: 354, // gu
-	0x1a400099: 355, // gu-IN
-	0x1a900000: 356, // guw
-	0x1ab00000: 357, // guz
-	0x1ab000a4: 358, // guz-KE
-	0x1ac00000: 359, // gv
-	0x1ac00098: 360, // gv-IM
-	0x1b400000: 361, // ha
-	0x1b400080: 362, // ha-GH
-	0x1b4000d4: 363, // ha-NE
-	0x1b4000d6: 364, // ha-NG
-	0x1b800000: 365, // haw
-	0x1b800135: 366, // haw-US
-	0x1bc00000: 367, // he
-	0x1bc00097: 368, // he-IL
-	0x1be00000: 369, // hi
-	0x1be00099: 370, // hi-IN
-	0x1d100000: 371, // hr
-	0x1d100033: 372, // hr-BA
-	0x1d100090: 373, // hr-HR
-	0x1d200000: 374, // hsb
-	0x1d200060: 375, // hsb-DE
-	0x1d500000: 376, // hu
-	0x1d500092: 377, // hu-HU
-	0x1d700000: 378, // hy
-	0x1d700028: 379, // hy-AM
-	0x1e100000: 380, // id
-	0x1e100095: 381, // id-ID
-	0x1e700000: 382, // ig
-	0x1e7000d6: 383, // ig-NG
-	0x1ea00000: 384, // ii
-	0x1ea00053: 385, // ii-CN
-	0x1f500000: 386, // io
-	0x1f800000: 387, // is
-	0x1f80009d: 388, // is-IS
-	0x1f900000: 389, // it
-	0x1f90004e: 390, // it-CH
-	0x1f90009e: 391, // it-IT
-	0x1f900113: 392, // it-SM
-	0x1f900138: 393, // it-VA
-	0x1fa00000: 394, // iu
-	0x20000000: 395, // ja
-	0x200000a2: 396, // ja-JP
-	0x20300000: 397, // jbo
-	0x20700000: 398, // jgo
-	0x20700052: 399, // jgo-CM
-	0x20a00000: 400, // jmc
-	0x20a0012f: 401, // jmc-TZ
-	0x20e00000: 402, // jv
-	0x21000000: 403, // ka
-	0x2100007d: 404, // ka-GE
-	0x21200000: 405, // kab
-	0x21200067: 406, // kab-DZ
-	0x21600000: 407, // kaj
-	0x21700000: 408, // kam
-	0x217000a4: 409, // kam-KE
-	0x21f00000: 410, // kcg
-	0x22300000: 411, // kde
-	0x2230012f: 412, // kde-TZ
-	0x22700000: 413, // kea
-	0x2270005a: 414, // kea-CV
-	0x23400000: 415, // khq
-	0x234000c3: 416, // khq-ML
-	0x23900000: 417, // ki
-	0x239000a4: 418, // ki-KE
-	0x24200000: 419, // kk
-	0x242000ae: 420, // kk-KZ
-	0x24400000: 421, // kkj
-	0x24400052: 422, // kkj-CM
-	0x24500000: 423, // kl
-	0x24500082: 424, // kl-GL
-	0x24600000: 425, // kln
-	0x246000a4: 426, // kln-KE
-	0x24a00000: 427, // km
-	0x24a000a6: 428, // km-KH
-	0x25100000: 429, // kn
-	0x25100099: 430, // kn-IN
-	0x25400000: 431, // ko
-	0x254000aa: 432, // ko-KP
-	0x254000ab: 433, // ko-KR
-	0x25600000: 434, // kok
-	0x25600099: 435, // kok-IN
-	0x26a00000: 436, // ks
-	0x26a00099: 437, // ks-IN
-	0x26b00000: 438, // ksb
-	0x26b0012f: 439, // ksb-TZ
-	0x26d00000: 440, // ksf
-	0x26d00052: 441, // ksf-CM
-	0x26e00000: 442, // ksh
-	0x26e00060: 443, // ksh-DE
-	0x27400000: 444, // ku
-	0x28100000: 445, // kw
-	0x2810007b: 446, // kw-GB
-	0x28a00000: 447, // ky
-	0x28a000a5: 448, // ky-KG
-	0x29100000: 449, // lag
-	0x2910012f: 450, // lag-TZ
-	0x29500000: 451, // lb
-	0x295000b7: 452, // lb-LU
-	0x2a300000: 453, // lg
-	0x2a300131: 454, // lg-UG
-	0x2af00000: 455, // lkt
-	0x2af00135: 456, // lkt-US
-	0x2b500000: 457, // ln
-	0x2b50002a: 458, // ln-AO
-	0x2b50004b: 459, // ln-CD
-	0x2b50004c: 460, // ln-CF
-	0x2b50004d: 461, // ln-CG
-	0x2b800000: 462, // lo
-	0x2b8000af: 463, // lo-LA
-	0x2bf00000: 464, // lrc
-	0x2bf0009b: 465, // lrc-IQ
-	0x2bf0009c: 466, // lrc-IR
-	0x2c000000: 467, // lt
-	0x2c0000b6: 468, // lt-LT
-	0x2c200000: 469, // lu
-	0x2c20004b: 470, // lu-CD
-	0x2c400000: 471, // luo
-	0x2c4000a4: 472, // luo-KE
-	0x2c500000: 473, // luy
-	0x2c5000a4: 474, // luy-KE
-	0x2c700000: 475, // lv
-	0x2c7000b8: 476, // lv-LV
-	0x2d100000: 477, // mas
-	0x2d1000a4: 478, // mas-KE
-	0x2d10012f: 479, // mas-TZ
-	0x2e900000: 480, // mer
-	0x2e9000a4: 481, // mer-KE
-	0x2ed00000: 482, // mfe
-	0x2ed000cc: 483, // mfe-MU
-	0x2f100000: 484, // mg
-	0x2f1000bf: 485, // mg-MG
-	0x2f200000: 486, // mgh
-	0x2f2000d1: 487, // mgh-MZ
-	0x2f400000: 488, // mgo
-	0x2f400052: 489, // mgo-CM
-	0x2ff00000: 490, // mk
-	0x2ff000c2: 491, // mk-MK
-	0x30400000: 492, // ml
-	0x30400099: 493, // ml-IN
-	0x30b00000: 494, // mn
-	0x30b000c5: 495, // mn-MN
-	0x31b00000: 496, // mr
-	0x31b00099: 497, // mr-IN
-	0x31f00000: 498, // ms
-	0x31f0003e: 499, // ms-BN
-	0x31f000d0: 500, // ms-MY
-	0x31f0010d: 501, // ms-SG
-	0x32000000: 502, // mt
-	0x320000cb: 503, // mt-MT
-	0x32500000: 504, // mua
-	0x32500052: 505, // mua-CM
-	0x33100000: 506, // my
-	0x331000c4: 507, // my-MM
-	0x33a00000: 508, // mzn
-	0x33a0009c: 509, // mzn-IR
-	0x34100000: 510, // nah
-	0x34500000: 511, // naq
-	0x345000d2: 512, // naq-NA
-	0x34700000: 513, // nb
-	0x347000da: 514, // nb-NO
-	0x34700110: 515, // nb-SJ
-	0x34e00000: 516, // nd
-	0x34e00164: 517, // nd-ZW
-	0x35000000: 518, // nds
-	0x35000060: 519, // nds-DE
-	0x350000d9: 520, // nds-NL
-	0x35100000: 521, // ne
-	0x35100099: 522, // ne-IN
-	0x351000db: 523, // ne-NP
-	0x36700000: 524, // nl
-	0x36700030: 525, // nl-AW
-	0x36700036: 526, // nl-BE
-	0x36700040: 527, // nl-BQ
-	0x3670005b: 528, // nl-CW
-	0x367000d9: 529, // nl-NL
-	0x36700116: 530, // nl-SR
-	0x3670011b: 531, // nl-SX
-	0x36800000: 532, // nmg
-	0x36800052: 533, // nmg-CM
-	0x36a00000: 534, // nn
-	0x36a000da: 535, // nn-NO
-	0x36c00000: 536, // nnh
-	0x36c00052: 537, // nnh-CM
-	0x36f00000: 538, // no
-	0x37500000: 539, // nqo
-	0x37600000: 540, // nr
-	0x37a00000: 541, // nso
-	0x38000000: 542, // nus
-	0x38000117: 543, // nus-SS
-	0x38700000: 544, // ny
-	0x38900000: 545, // nyn
-	0x38900131: 546, // nyn-UG
-	0x39000000: 547, // om
-	0x3900006f: 548, // om-ET
-	0x390000a4: 549, // om-KE
-	0x39500000: 550, // or
-	0x39500099: 551, // or-IN
-	0x39800000: 552, // os
-	0x3980007d: 553, // os-GE
-	0x39800106: 554, // os-RU
-	0x39d00000: 555, // pa
-	0x39d05000: 556, // pa-Arab
-	0x39d050e8: 557, // pa-Arab-PK
-	0x39d33000: 558, // pa-Guru
-	0x39d33099: 559, // pa-Guru-IN
-	0x3a100000: 560, // pap
-	0x3b300000: 561, // pl
-	0x3b3000e9: 562, // pl-PL
-	0x3bd00000: 563, // prg
-	0x3bd00001: 564, // prg-001
-	0x3be00000: 565, // ps
-	0x3be00024: 566, // ps-AF
-	0x3c000000: 567, // pt
-	0x3c00002a: 568, // pt-AO
-	0x3c000041: 569, // pt-BR
-	0x3c00004e: 570, // pt-CH
-	0x3c00005a: 571, // pt-CV
-	0x3c000086: 572, // pt-GQ
-	0x3c00008b: 573, // pt-GW
-	0x3c0000b7: 574, // pt-LU
-	0x3c0000c6: 575, // pt-MO
-	0x3c0000d1: 576, // pt-MZ
-	0x3c0000ee: 577, // pt-PT
-	0x3c000118: 578, // pt-ST
-	0x3c000126: 579, // pt-TL
-	0x3c400000: 580, // qu
-	0x3c40003f: 581, // qu-BO
-	0x3c400069: 582, // qu-EC
-	0x3c4000e4: 583, // qu-PE
-	0x3d400000: 584, // rm
-	0x3d40004e: 585, // rm-CH
-	0x3d900000: 586, // rn
-	0x3d90003a: 587, // rn-BI
-	0x3dc00000: 588, // ro
-	0x3dc000bc: 589, // ro-MD
-	0x3dc00104: 590, // ro-RO
-	0x3de00000: 591, // rof
-	0x3de0012f: 592, // rof-TZ
-	0x3e200000: 593, // ru
-	0x3e200047: 594, // ru-BY
-	0x3e2000a5: 595, // ru-KG
-	0x3e2000ae: 596, // ru-KZ
-	0x3e2000bc: 597, // ru-MD
-	0x3e200106: 598, // ru-RU
-	0x3e200130: 599, // ru-UA
-	0x3e500000: 600, // rw
-	0x3e500107: 601, // rw-RW
-	0x3e600000: 602, // rwk
-	0x3e60012f: 603, // rwk-TZ
-	0x3eb00000: 604, // sah
-	0x3eb00106: 605, // sah-RU
-	0x3ec00000: 606, // saq
-	0x3ec000a4: 607, // saq-KE
-	0x3f300000: 608, // sbp
-	0x3f30012f: 609, // sbp-TZ
-	0x3fa00000: 610, // sd
-	0x3fa000e8: 611, // sd-PK
-	0x3fc00000: 612, // sdh
-	0x3fd00000: 613, // se
-	0x3fd00072: 614, // se-FI
-	0x3fd000da: 615, // se-NO
-	0x3fd0010c: 616, // se-SE
-	0x3ff00000: 617, // seh
-	0x3ff000d1: 618, // seh-MZ
-	0x40100000: 619, // ses
-	0x401000c3: 620, // ses-ML
-	0x40200000: 621, // sg
-	0x4020004c: 622, // sg-CF
-	0x40800000: 623, // shi
-	0x40857000: 624, // shi-Latn
-	0x408570ba: 625, // shi-Latn-MA
-	0x408dc000: 626, // shi-Tfng
-	0x408dc0ba: 627, // shi-Tfng-MA
-	0x40c00000: 628, // si
-	0x40c000b3: 629, // si-LK
-	0x41200000: 630, // sk
-	0x41200111: 631, // sk-SK
-	0x41600000: 632, // sl
-	0x4160010f: 633, // sl-SI
-	0x41c00000: 634, // sma
-	0x41d00000: 635, // smi
-	0x41e00000: 636, // smj
-	0x41f00000: 637, // smn
-	0x41f00072: 638, // smn-FI
-	0x42200000: 639, // sms
-	0x42300000: 640, // sn
-	0x42300164: 641, // sn-ZW
-	0x42900000: 642, // so
-	0x42900062: 643, // so-DJ
-	0x4290006f: 644, // so-ET
-	0x429000a4: 645, // so-KE
-	0x42900115: 646, // so-SO
-	0x43100000: 647, // sq
-	0x43100027: 648, // sq-AL
-	0x431000c2: 649, // sq-MK
-	0x4310014d: 650, // sq-XK
-	0x43200000: 651, // sr
-	0x4321f000: 652, // sr-Cyrl
-	0x4321f033: 653, // sr-Cyrl-BA
-	0x4321f0bd: 654, // sr-Cyrl-ME
-	0x4321f105: 655, // sr-Cyrl-RS
-	0x4321f14d: 656, // sr-Cyrl-XK
-	0x43257000: 657, // sr-Latn
-	0x43257033: 658, // sr-Latn-BA
-	0x432570bd: 659, // sr-Latn-ME
-	0x43257105: 660, // sr-Latn-RS
-	0x4325714d: 661, // sr-Latn-XK
-	0x43700000: 662, // ss
-	0x43a00000: 663, // ssy
-	0x43b00000: 664, // st
-	0x44400000: 665, // sv
-	0x44400031: 666, // sv-AX
-	0x44400072: 667, // sv-FI
-	0x4440010c: 668, // sv-SE
-	0x44500000: 669, // sw
-	0x4450004b: 670, // sw-CD
-	0x445000a4: 671, // sw-KE
-	0x4450012f: 672, // sw-TZ
-	0x44500131: 673, // sw-UG
-	0x44e00000: 674, // syr
-	0x45000000: 675, // ta
-	0x45000099: 676, // ta-IN
-	0x450000b3: 677, // ta-LK
-	0x450000d0: 678, // ta-MY
-	0x4500010d: 679, // ta-SG
-	0x46100000: 680, // te
-	0x46100099: 681, // te-IN
-	0x46400000: 682, // teo
-	0x464000a4: 683, // teo-KE
-	0x46400131: 684, // teo-UG
-	0x46700000: 685, // tg
-	0x46700124: 686, // tg-TJ
-	0x46b00000: 687, // th
-	0x46b00123: 688, // th-TH
-	0x46f00000: 689, // ti
-	0x46f0006d: 690, // ti-ER
-	0x46f0006f: 691, // ti-ET
-	0x47100000: 692, // tig
-	0x47600000: 693, // tk
-	0x47600127: 694, // tk-TM
-	0x48000000: 695, // tn
-	0x48200000: 696, // to
-	0x48200129: 697, // to-TO
-	0x48a00000: 698, // tr
-	0x48a0005d: 699, // tr-CY
-	0x48a0012b: 700, // tr-TR
-	0x48e00000: 701, // ts
-	0x49400000: 702, // tt
-	0x49400106: 703, // tt-RU
-	0x4a400000: 704, // twq
-	0x4a4000d4: 705, // twq-NE
-	0x4a900000: 706, // tzm
-	0x4a9000ba: 707, // tzm-MA
-	0x4ac00000: 708, // ug
-	0x4ac00053: 709, // ug-CN
-	0x4ae00000: 710, // uk
-	0x4ae00130: 711, // uk-UA
-	0x4b400000: 712, // ur
-	0x4b400099: 713, // ur-IN
-	0x4b4000e8: 714, // ur-PK
-	0x4bc00000: 715, // uz
-	0x4bc05000: 716, // uz-Arab
-	0x4bc05024: 717, // uz-Arab-AF
-	0x4bc1f000: 718, // uz-Cyrl
-	0x4bc1f137: 719, // uz-Cyrl-UZ
-	0x4bc57000: 720, // uz-Latn
-	0x4bc57137: 721, // uz-Latn-UZ
-	0x4be00000: 722, // vai
-	0x4be57000: 723, // vai-Latn
-	0x4be570b4: 724, // vai-Latn-LR
-	0x4bee3000: 725, // vai-Vaii
-	0x4bee30b4: 726, // vai-Vaii-LR
-	0x4c000000: 727, // ve
-	0x4c300000: 728, // vi
-	0x4c30013e: 729, // vi-VN
-	0x4c900000: 730, // vo
-	0x4c900001: 731, // vo-001
-	0x4cc00000: 732, // vun
-	0x4cc0012f: 733, // vun-TZ
-	0x4ce00000: 734, // wa
-	0x4cf00000: 735, // wae
-	0x4cf0004e: 736, // wae-CH
-	0x4e500000: 737, // wo
-	0x4e500114: 738, // wo-SN
-	0x4f200000: 739, // xh
-	0x4fb00000: 740, // xog
-	0x4fb00131: 741, // xog-UG
-	0x50900000: 742, // yav
-	0x50900052: 743, // yav-CM
-	0x51200000: 744, // yi
-	0x51200001: 745, // yi-001
-	0x51800000: 746, // yo
-	0x5180003b: 747, // yo-BJ
-	0x518000d6: 748, // yo-NG
-	0x51f00000: 749, // yue
-	0x51f38000: 750, // yue-Hans
-	0x51f38053: 751, // yue-Hans-CN
-	0x51f39000: 752, // yue-Hant
-	0x51f3908d: 753, // yue-Hant-HK
-	0x52800000: 754, // zgh
-	0x528000ba: 755, // zgh-MA
-	0x52900000: 756, // zh
-	0x52938000: 757, // zh-Hans
-	0x52938053: 758, // zh-Hans-CN
-	0x5293808d: 759, // zh-Hans-HK
-	0x529380c6: 760, // zh-Hans-MO
-	0x5293810d: 761, // zh-Hans-SG
-	0x52939000: 762, // zh-Hant
-	0x5293908d: 763, // zh-Hant-HK
-	0x529390c6: 764, // zh-Hant-MO
-	0x5293912e: 765, // zh-Hant-TW
-	0x52f00000: 766, // zu
-	0x52f00161: 767, // zu-ZA
-}
-
-// Total table size 4676 bytes (4KiB); checksum: 17BE3673
diff --git a/vendor/golang.org/x/text/language/language.go b/vendor/golang.org/x/text/language/language.go
deleted file mode 100644
index b65e213..0000000
--- a/vendor/golang.org/x/text/language/language.go
+++ /dev/null
@@ -1,907 +0,0 @@
-// Copyright 2013 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-//go:generate go run gen.go gen_common.go -output tables.go
-//go:generate go run gen_index.go
-
-package language
-
-// TODO: Remove above NOTE after:
-// - verifying that tables are dropped correctly (most notably matcher tables).
-
-import (
-	"errors"
-	"fmt"
-	"strings"
-)
-
-const (
-	// maxCoreSize is the maximum size of a BCP 47 tag without variants and
-	// extensions. Equals max lang (3) + script (4) + max reg (3) + 2 dashes.
-	maxCoreSize = 12
-
-	// max99thPercentileSize is a somewhat arbitrary buffer size that presumably
-	// is large enough to hold at least 99% of the BCP 47 tags.
-	max99thPercentileSize = 32
-
-	// maxSimpleUExtensionSize is the maximum size of a -u extension with one
-	// key-type pair. Equals len("-u-") + key (2) + dash + max value (8).
-	maxSimpleUExtensionSize = 14
-)
-
-// Tag represents a BCP 47 language tag. It is used to specify an instance of a
-// specific language or locale. All language tag values are guaranteed to be
-// well-formed.
-type Tag struct {
-	lang   langID
-	region regionID
-	// TODO: we will soon run out of positions for script. Idea: instead of
-	// storing lang, region, and script codes, store only the compact index and
-	// have a lookup table from this code to its expansion. This greatly speeds
-	// up table lookup, speed up common variant cases.
-	// This will also immediately free up 3 extra bytes. Also, the pVariant
-	// field can now be moved to the lookup table, as the compact index uniquely
-	// determines the offset of a possible variant.
-	script   scriptID
-	pVariant byte   // offset in str, includes preceding '-'
-	pExt     uint16 // offset of first extension, includes preceding '-'
-
-	// str is the string representation of the Tag. It will only be used if the
-	// tag has variants or extensions.
-	str string
-}
-
-// Make is a convenience wrapper for Parse that omits the error.
-// In case of an error, a sensible default is returned.
-func Make(s string) Tag {
-	return Default.Make(s)
-}
-
-// Make is a convenience wrapper for c.Parse that omits the error.
-// In case of an error, a sensible default is returned.
-func (c CanonType) Make(s string) Tag {
-	t, _ := c.Parse(s)
-	return t
-}
-
-// Raw returns the raw base language, script and region, without making an
-// attempt to infer their values.
-func (t Tag) Raw() (b Base, s Script, r Region) {
-	return Base{t.lang}, Script{t.script}, Region{t.region}
-}
-
-// equalTags compares language, script and region subtags only.
-func (t Tag) equalTags(a Tag) bool {
-	return t.lang == a.lang && t.script == a.script && t.region == a.region
-}
-
-// IsRoot returns true if t is equal to language "und".
-func (t Tag) IsRoot() bool {
-	if int(t.pVariant) < len(t.str) {
-		return false
-	}
-	return t.equalTags(und)
-}
-
-// private reports whether the Tag consists solely of a private use tag.
-func (t Tag) private() bool {
-	return t.str != "" && t.pVariant == 0
-}
-
-// CanonType can be used to enable or disable various types of canonicalization.
-type CanonType int
-
-const (
-	// Replace deprecated base languages with their preferred replacements.
-	DeprecatedBase CanonType = 1 << iota
-	// Replace deprecated scripts with their preferred replacements.
-	DeprecatedScript
-	// Replace deprecated regions with their preferred replacements.
-	DeprecatedRegion
-	// Remove redundant scripts.
-	SuppressScript
-	// Normalize legacy encodings. This includes legacy languages defined in
-	// CLDR as well as bibliographic codes defined in ISO-639.
-	Legacy
-	// Map the dominant language of a macro language group to the macro language
-	// subtag. For example cmn -> zh.
-	Macro
-	// The CLDR flag should be used if full compatibility with CLDR is required.
-	// There are a few cases where language.Tag may differ from CLDR. To follow all
-	// of CLDR's suggestions, use All|CLDR.
-	CLDR
-
-	// Raw can be used to Compose or Parse without Canonicalization.
-	Raw CanonType = 0
-
-	// Replace all deprecated tags with their preferred replacements.
-	Deprecated = DeprecatedBase | DeprecatedScript | DeprecatedRegion
-
-	// All canonicalizations recommended by BCP 47.
-	BCP47 = Deprecated | SuppressScript
-
-	// All canonicalizations.
-	All = BCP47 | Legacy | Macro
-
-	// Default is the canonicalization used by Parse, Make and Compose. To
-	// preserve as much information as possible, canonicalizations that remove
-	// potentially valuable information are not included. The Matcher is
-	// designed to recognize similar tags that would be the same if
-	// they were canonicalized using All.
-	Default = Deprecated | Legacy
-
-	canonLang = DeprecatedBase | Legacy | Macro
-
-	// TODO: LikelyScript, LikelyRegion: suppress similar to ICU.
-)
-
-// canonicalize returns the canonicalized equivalent of the tag and
-// whether there was any change.
-func (t Tag) canonicalize(c CanonType) (Tag, bool) {
-	if c == Raw {
-		return t, false
-	}
-	changed := false
-	if c&SuppressScript != 0 {
-		if t.lang < langNoIndexOffset && uint8(t.script) == suppressScript[t.lang] {
-			t.script = 0
-			changed = true
-		}
-	}
-	if c&canonLang != 0 {
-		for {
-			if l, aliasType := normLang(t.lang); l != t.lang {
-				switch aliasType {
-				case langLegacy:
-					if c&Legacy != 0 {
-						if t.lang == _sh && t.script == 0 {
-							t.script = _Latn
-						}
-						t.lang = l
-						changed = true
-					}
-				case langMacro:
-					if c&Macro != 0 {
-						// We deviate here from CLDR. The mapping "nb" -> "no"
-						// qualifies as a typical Macro language mapping.  However,
-						// for legacy reasons, CLDR maps "no", the macro language
-						// code for Norwegian, to the dominant variant "nb". This
-						// change is currently under consideration for CLDR as well.
-						// See http://unicode.org/cldr/trac/ticket/2698 and also
-						// http://unicode.org/cldr/trac/ticket/1790 for some of the
-						// practical implications. TODO: this check could be removed
-						// if CLDR adopts this change.
-						if c&CLDR == 0 || t.lang != _nb {
-							changed = true
-							t.lang = l
-						}
-					}
-				case langDeprecated:
-					if c&DeprecatedBase != 0 {
-						if t.lang == _mo && t.region == 0 {
-							t.region = _MD
-						}
-						t.lang = l
-						changed = true
-						// Other canonicalization types may still apply.
-						continue
-					}
-				}
-			} else if c&Legacy != 0 && t.lang == _no && c&CLDR != 0 {
-				t.lang = _nb
-				changed = true
-			}
-			break
-		}
-	}
-	if c&DeprecatedScript != 0 {
-		if t.script == _Qaai {
-			changed = true
-			t.script = _Zinh
-		}
-	}
-	if c&DeprecatedRegion != 0 {
-		if r := normRegion(t.region); r != 0 {
-			changed = true
-			t.region = r
-		}
-	}
-	return t, changed
-}
-
-// Canonicalize returns the canonicalized equivalent of the tag.
-func (c CanonType) Canonicalize(t Tag) (Tag, error) {
-	t, changed := t.canonicalize(c)
-	if changed {
-		t.remakeString()
-	}
-	return t, nil
-}
-
-// Confidence indicates the level of certainty for a given return value.
-// For example, Serbian may be written in Cyrillic or Latin script.
-// The confidence level indicates whether a value was explicitly specified,
-// whether it is typically the only possible value, or whether there is
-// an ambiguity.
-type Confidence int
-
-const (
-	No    Confidence = iota // full confidence that there was no match
-	Low                     // most likely value picked out of a set of alternatives
-	High                    // value is generally assumed to be the correct match
-	Exact                   // exact match or explicitly specified value
-)
-
-var confName = []string{"No", "Low", "High", "Exact"}
-
-func (c Confidence) String() string {
-	return confName[c]
-}
-
-// remakeString is used to update t.str in case lang, script or region changed.
-// It is assumed that pExt and pVariant still point to the start of the
-// respective parts.
-func (t *Tag) remakeString() {
-	if t.str == "" {
-		return
-	}
-	extra := t.str[t.pVariant:]
-	if t.pVariant > 0 {
-		extra = extra[1:]
-	}
-	if t.equalTags(und) && strings.HasPrefix(extra, "x-") {
-		t.str = extra
-		t.pVariant = 0
-		t.pExt = 0
-		return
-	}
-	var buf [max99thPercentileSize]byte // avoid extra memory allocation in most cases.
-	b := buf[:t.genCoreBytes(buf[:])]
-	if extra != "" {
-		diff := len(b) - int(t.pVariant)
-		b = append(b, '-')
-		b = append(b, extra...)
-		t.pVariant = uint8(int(t.pVariant) + diff)
-		t.pExt = uint16(int(t.pExt) + diff)
-	} else {
-		t.pVariant = uint8(len(b))
-		t.pExt = uint16(len(b))
-	}
-	t.str = string(b)
-}
-
-// genCoreBytes writes a string for the base languages, script and region tags
-// to the given buffer and returns the number of bytes written. It will never
-// write more than maxCoreSize bytes.
-func (t *Tag) genCoreBytes(buf []byte) int {
-	n := t.lang.stringToBuf(buf[:])
-	if t.script != 0 {
-		n += copy(buf[n:], "-")
-		n += copy(buf[n:], t.script.String())
-	}
-	if t.region != 0 {
-		n += copy(buf[n:], "-")
-		n += copy(buf[n:], t.region.String())
-	}
-	return n
-}
-
-// String returns the canonical string representation of the language tag.
-func (t Tag) String() string {
-	if t.str != "" {
-		return t.str
-	}
-	if t.script == 0 && t.region == 0 {
-		return t.lang.String()
-	}
-	buf := [maxCoreSize]byte{}
-	return string(buf[:t.genCoreBytes(buf[:])])
-}
-
-// MarshalText implements encoding.TextMarshaler.
-func (t Tag) MarshalText() (text []byte, err error) {
-	if t.str != "" {
-		text = append(text, t.str...)
-	} else if t.script == 0 && t.region == 0 {
-		text = append(text, t.lang.String()...)
-	} else {
-		buf := [maxCoreSize]byte{}
-		text = buf[:t.genCoreBytes(buf[:])]
-	}
-	return text, nil
-}
-
-// UnmarshalText implements encoding.TextUnmarshaler.
-func (t *Tag) UnmarshalText(text []byte) error {
-	tag, err := Raw.Parse(string(text))
-	*t = tag
-	return err
-}
-
-// Base returns the base language of the language tag. If the base language is
-// unspecified, an attempt will be made to infer it from the context.
-// It uses a variant of CLDR's Add Likely Subtags algorithm. This is subject to change.
-func (t Tag) Base() (Base, Confidence) {
-	if t.lang != 0 {
-		return Base{t.lang}, Exact
-	}
-	c := High
-	if t.script == 0 && !(Region{t.region}).IsCountry() {
-		c = Low
-	}
-	if tag, err := addTags(t); err == nil && tag.lang != 0 {
-		return Base{tag.lang}, c
-	}
-	return Base{0}, No
-}
-
-// Script infers the script for the language tag. If it was not explicitly given, it will infer
-// a most likely candidate.
-// If more than one script is commonly used for a language, the most likely one
-// is returned with a low confidence indication. For example, it returns (Cyrl, Low)
-// for Serbian.
-// If a script cannot be inferred (Zzzz, No) is returned. We do not use Zyyy (undetermined)
-// as one would suspect from the IANA registry for BCP 47. In a Unicode context Zyyy marks
-// common characters (like 1, 2, 3, '.', etc.) and is therefore more like multiple scripts.
-// See http://www.unicode.org/reports/tr24/#Values for more details. Zzzz is also used for
-// unknown value in CLDR.  (Zzzz, Exact) is returned if Zzzz was explicitly specified.
-// Note that an inferred script is never guaranteed to be the correct one. Latin is
-// almost exclusively used for Afrikaans, but Arabic has been used for some texts
-// in the past.  Also, the script that is commonly used may change over time.
-// It uses a variant of CLDR's Add Likely Subtags algorithm. This is subject to change.
-func (t Tag) Script() (Script, Confidence) {
-	if t.script != 0 {
-		return Script{t.script}, Exact
-	}
-	sc, c := scriptID(_Zzzz), No
-	if t.lang < langNoIndexOffset {
-		if scr := scriptID(suppressScript[t.lang]); scr != 0 {
-			// Note: it is not always the case that a language with a suppress
-			// script value is only written in one script (e.g. kk, ms, pa).
-			if t.region == 0 {
-				return Script{scriptID(scr)}, High
-			}
-			sc, c = scr, High
-		}
-	}
-	if tag, err := addTags(t); err == nil {
-		if tag.script != sc {
-			sc, c = tag.script, Low
-		}
-	} else {
-		t, _ = (Deprecated | Macro).Canonicalize(t)
-		if tag, err := addTags(t); err == nil && tag.script != sc {
-			sc, c = tag.script, Low
-		}
-	}
-	return Script{sc}, c
-}
-
-// Region returns the region for the language tag. If it was not explicitly given, it will
-// infer a most likely candidate from the context.
-// It uses a variant of CLDR's Add Likely Subtags algorithm. This is subject to change.
-func (t Tag) Region() (Region, Confidence) {
-	if t.region != 0 {
-		return Region{t.region}, Exact
-	}
-	if t, err := addTags(t); err == nil {
-		return Region{t.region}, Low // TODO: differentiate between high and low.
-	}
-	t, _ = (Deprecated | Macro).Canonicalize(t)
-	if tag, err := addTags(t); err == nil {
-		return Region{tag.region}, Low
-	}
-	return Region{_ZZ}, No // TODO: return world instead of undetermined?
-}
-
-// Variant returns the variants specified explicitly for this language tag.
-// or nil if no variant was specified.
-func (t Tag) Variants() []Variant {
-	v := []Variant{}
-	if int(t.pVariant) < int(t.pExt) {
-		for x, str := "", t.str[t.pVariant:t.pExt]; str != ""; {
-			x, str = nextToken(str)
-			v = append(v, Variant{x})
-		}
-	}
-	return v
-}
-
-// Parent returns the CLDR parent of t. In CLDR, missing fields in data for a
-// specific language are substituted with fields from the parent language.
-// The parent for a language may change for newer versions of CLDR.
-func (t Tag) Parent() Tag {
-	if t.str != "" {
-		// Strip the variants and extensions.
-		t, _ = Raw.Compose(t.Raw())
-		if t.region == 0 && t.script != 0 && t.lang != 0 {
-			base, _ := addTags(Tag{lang: t.lang})
-			if base.script == t.script {
-				return Tag{lang: t.lang}
-			}
-		}
-		return t
-	}
-	if t.lang != 0 {
-		if t.region != 0 {
-			maxScript := t.script
-			if maxScript == 0 {
-				max, _ := addTags(t)
-				maxScript = max.script
-			}
-
-			for i := range parents {
-				if langID(parents[i].lang) == t.lang && scriptID(parents[i].maxScript) == maxScript {
-					for _, r := range parents[i].fromRegion {
-						if regionID(r) == t.region {
-							return Tag{
-								lang:   t.lang,
-								script: scriptID(parents[i].script),
-								region: regionID(parents[i].toRegion),
-							}
-						}
-					}
-				}
-			}
-
-			// Strip the script if it is the default one.
-			base, _ := addTags(Tag{lang: t.lang})
-			if base.script != maxScript {
-				return Tag{lang: t.lang, script: maxScript}
-			}
-			return Tag{lang: t.lang}
-		} else if t.script != 0 {
-			// The parent for an base-script pair with a non-default script is
-			// "und" instead of the base language.
-			base, _ := addTags(Tag{lang: t.lang})
-			if base.script != t.script {
-				return und
-			}
-			return Tag{lang: t.lang}
-		}
-	}
-	return und
-}
-
-// returns token t and the rest of the string.
-func nextToken(s string) (t, tail string) {
-	p := strings.Index(s[1:], "-")
-	if p == -1 {
-		return s[1:], ""
-	}
-	p++
-	return s[1:p], s[p:]
-}
-
-// Extension is a single BCP 47 extension.
-type Extension struct {
-	s string
-}
-
-// String returns the string representation of the extension, including the
-// type tag.
-func (e Extension) String() string {
-	return e.s
-}
-
-// ParseExtension parses s as an extension and returns it on success.
-func ParseExtension(s string) (e Extension, err error) {
-	scan := makeScannerString(s)
-	var end int
-	if n := len(scan.token); n != 1 {
-		return Extension{}, errSyntax
-	}
-	scan.toLower(0, len(scan.b))
-	end = parseExtension(&scan)
-	if end != len(s) {
-		return Extension{}, errSyntax
-	}
-	return Extension{string(scan.b)}, nil
-}
-
-// Type returns the one-byte extension type of e. It returns 0 for the zero
-// exception.
-func (e Extension) Type() byte {
-	if e.s == "" {
-		return 0
-	}
-	return e.s[0]
-}
-
-// Tokens returns the list of tokens of e.
-func (e Extension) Tokens() []string {
-	return strings.Split(e.s, "-")
-}
-
-// Extension returns the extension of type x for tag t. It will return
-// false for ok if t does not have the requested extension. The returned
-// extension will be invalid in this case.
-func (t Tag) Extension(x byte) (ext Extension, ok bool) {
-	for i := int(t.pExt); i < len(t.str)-1; {
-		var ext string
-		i, ext = getExtension(t.str, i)
-		if ext[0] == x {
-			return Extension{ext}, true
-		}
-	}
-	return Extension{}, false
-}
-
-// Extensions returns all extensions of t.
-func (t Tag) Extensions() []Extension {
-	e := []Extension{}
-	for i := int(t.pExt); i < len(t.str)-1; {
-		var ext string
-		i, ext = getExtension(t.str, i)
-		e = append(e, Extension{ext})
-	}
-	return e
-}
-
-// TypeForKey returns the type associated with the given key, where key and type
-// are of the allowed values defined for the Unicode locale extension ('u') in
-// http://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
-// TypeForKey will traverse the inheritance chain to get the correct value.
-func (t Tag) TypeForKey(key string) string {
-	if start, end, _ := t.findTypeForKey(key); end != start {
-		return t.str[start:end]
-	}
-	return ""
-}
-
-var (
-	errPrivateUse       = errors.New("cannot set a key on a private use tag")
-	errInvalidArguments = errors.New("invalid key or type")
-)
-
-// SetTypeForKey returns a new Tag with the key set to type, where key and type
-// are of the allowed values defined for the Unicode locale extension ('u') in
-// http://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
-// An empty value removes an existing pair with the same key.
-func (t Tag) SetTypeForKey(key, value string) (Tag, error) {
-	if t.private() {
-		return t, errPrivateUse
-	}
-	if len(key) != 2 {
-		return t, errInvalidArguments
-	}
-
-	// Remove the setting if value is "".
-	if value == "" {
-		start, end, _ := t.findTypeForKey(key)
-		if start != end {
-			// Remove key tag and leading '-'.
-			start -= 4
-
-			// Remove a possible empty extension.
-			if (end == len(t.str) || t.str[end+2] == '-') && t.str[start-2] == '-' {
-				start -= 2
-			}
-			if start == int(t.pVariant) && end == len(t.str) {
-				t.str = ""
-				t.pVariant, t.pExt = 0, 0
-			} else {
-				t.str = fmt.Sprintf("%s%s", t.str[:start], t.str[end:])
-			}
-		}
-		return t, nil
-	}
-
-	if len(value) < 3 || len(value) > 8 {
-		return t, errInvalidArguments
-	}
-
-	var (
-		buf    [maxCoreSize + maxSimpleUExtensionSize]byte
-		uStart int // start of the -u extension.
-	)
-
-	// Generate the tag string if needed.
-	if t.str == "" {
-		uStart = t.genCoreBytes(buf[:])
-		buf[uStart] = '-'
-		uStart++
-	}
-
-	// Create new key-type pair and parse it to verify.
-	b := buf[uStart:]
-	copy(b, "u-")
-	copy(b[2:], key)
-	b[4] = '-'
-	b = b[:5+copy(b[5:], value)]
-	scan := makeScanner(b)
-	if parseExtensions(&scan); scan.err != nil {
-		return t, scan.err
-	}
-
-	// Assemble the replacement string.
-	if t.str == "" {
-		t.pVariant, t.pExt = byte(uStart-1), uint16(uStart-1)
-		t.str = string(buf[:uStart+len(b)])
-	} else {
-		s := t.str
-		start, end, hasExt := t.findTypeForKey(key)
-		if start == end {
-			if hasExt {
-				b = b[2:]
-			}
-			t.str = fmt.Sprintf("%s-%s%s", s[:start], b, s[end:])
-		} else {
-			t.str = fmt.Sprintf("%s%s%s", s[:start], value, s[end:])
-		}
-	}
-	return t, nil
-}
-
-// findKeyAndType returns the start and end position for the type corresponding
-// to key or the point at which to insert the key-value pair if the type
-// wasn't found. The hasExt return value reports whether an -u extension was present.
-// Note: the extensions are typically very small and are likely to contain
-// only one key-type pair.
-func (t Tag) findTypeForKey(key string) (start, end int, hasExt bool) {
-	p := int(t.pExt)
-	if len(key) != 2 || p == len(t.str) || p == 0 {
-		return p, p, false
-	}
-	s := t.str
-
-	// Find the correct extension.
-	for p++; s[p] != 'u'; p++ {
-		if s[p] > 'u' {
-			p--
-			return p, p, false
-		}
-		if p = nextExtension(s, p); p == len(s) {
-			return len(s), len(s), false
-		}
-	}
-	// Proceed to the hyphen following the extension name.
-	p++
-
-	// curKey is the key currently being processed.
-	curKey := ""
-
-	// Iterate over keys until we get the end of a section.
-	for {
-		// p points to the hyphen preceding the current token.
-		if p3 := p + 3; s[p3] == '-' {
-			// Found a key.
-			// Check whether we just processed the key that was requested.
-			if curKey == key {
-				return start, p, true
-			}
-			// Set to the next key and continue scanning type tokens.
-			curKey = s[p+1 : p3]
-			if curKey > key {
-				return p, p, true
-			}
-			// Start of the type token sequence.
-			start = p + 4
-			// A type is at least 3 characters long.
-			p += 7 // 4 + 3
-		} else {
-			// Attribute or type, which is at least 3 characters long.
-			p += 4
-		}
-		// p points past the third character of a type or attribute.
-		max := p + 5 // maximum length of token plus hyphen.
-		if len(s) < max {
-			max = len(s)
-		}
-		for ; p < max && s[p] != '-'; p++ {
-		}
-		// Bail if we have exhausted all tokens or if the next token starts
-		// a new extension.
-		if p == len(s) || s[p+2] == '-' {
-			if curKey == key {
-				return start, p, true
-			}
-			return p, p, true
-		}
-	}
-}
-
-// CompactIndex returns an index, where 0 <= index < NumCompactTags, for tags
-// for which data exists in the text repository. The index will change over time
-// and should not be stored in persistent storage. Extensions, except for the
-// 'va' type of the 'u' extension, are ignored. It will return 0, false if no
-// compact tag exists, where 0 is the index for the root language (Und).
-func CompactIndex(t Tag) (index int, ok bool) {
-	// TODO: perhaps give more frequent tags a lower index.
-	// TODO: we could make the indexes stable. This will excluded some
-	//       possibilities for optimization, so don't do this quite yet.
-	b, s, r := t.Raw()
-	if len(t.str) > 0 {
-		if strings.HasPrefix(t.str, "x-") {
-			// We have no entries for user-defined tags.
-			return 0, false
-		}
-		if uint16(t.pVariant) != t.pExt {
-			// There are no tags with variants and an u-va type.
-			if t.TypeForKey("va") != "" {
-				return 0, false
-			}
-			t, _ = Raw.Compose(b, s, r, t.Variants())
-		} else if _, ok := t.Extension('u'); ok {
-			// Strip all but the 'va' entry.
-			variant := t.TypeForKey("va")
-			t, _ = Raw.Compose(b, s, r)
-			t, _ = t.SetTypeForKey("va", variant)
-		}
-		if len(t.str) > 0 {
-			// We have some variants.
-			for i, s := range specialTags {
-				if s == t {
-					return i + 1, true
-				}
-			}
-			return 0, false
-		}
-	}
-	// No variants specified: just compare core components.
-	// The key has the form lllssrrr, where l, s, and r are nibbles for
-	// respectively the langID, scriptID, and regionID.
-	key := uint32(b.langID) << (8 + 12)
-	key |= uint32(s.scriptID) << 12
-	key |= uint32(r.regionID)
-	x, ok := coreTags[key]
-	return int(x), ok
-}
-
-// Base is an ISO 639 language code, used for encoding the base language
-// of a language tag.
-type Base struct {
-	langID
-}
-
-// ParseBase parses a 2- or 3-letter ISO 639 code.
-// It returns a ValueError if s is a well-formed but unknown language identifier
-// or another error if another error occurred.
-func ParseBase(s string) (Base, error) {
-	if n := len(s); n < 2 || 3 < n {
-		return Base{}, errSyntax
-	}
-	var buf [3]byte
-	l, err := getLangID(buf[:copy(buf[:], s)])
-	return Base{l}, err
-}
-
-// Script is a 4-letter ISO 15924 code for representing scripts.
-// It is idiomatically represented in title case.
-type Script struct {
-	scriptID
-}
-
-// ParseScript parses a 4-letter ISO 15924 code.
-// It returns a ValueError if s is a well-formed but unknown script identifier
-// or another error if another error occurred.
-func ParseScript(s string) (Script, error) {
-	if len(s) != 4 {
-		return Script{}, errSyntax
-	}
-	var buf [4]byte
-	sc, err := getScriptID(script, buf[:copy(buf[:], s)])
-	return Script{sc}, err
-}
-
-// Region is an ISO 3166-1 or UN M.49 code for representing countries and regions.
-type Region struct {
-	regionID
-}
-
-// EncodeM49 returns the Region for the given UN M.49 code.
-// It returns an error if r is not a valid code.
-func EncodeM49(r int) (Region, error) {
-	rid, err := getRegionM49(r)
-	return Region{rid}, err
-}
-
-// ParseRegion parses a 2- or 3-letter ISO 3166-1 or a UN M.49 code.
-// It returns a ValueError if s is a well-formed but unknown region identifier
-// or another error if another error occurred.
-func ParseRegion(s string) (Region, error) {
-	if n := len(s); n < 2 || 3 < n {
-		return Region{}, errSyntax
-	}
-	var buf [3]byte
-	r, err := getRegionID(buf[:copy(buf[:], s)])
-	return Region{r}, err
-}
-
-// IsCountry returns whether this region is a country or autonomous area. This
-// includes non-standard definitions from CLDR.
-func (r Region) IsCountry() bool {
-	if r.regionID == 0 || r.IsGroup() || r.IsPrivateUse() && r.regionID != _XK {
-		return false
-	}
-	return true
-}
-
-// IsGroup returns whether this region defines a collection of regions. This
-// includes non-standard definitions from CLDR.
-func (r Region) IsGroup() bool {
-	if r.regionID == 0 {
-		return false
-	}
-	return int(regionInclusion[r.regionID]) < len(regionContainment)
-}
-
-// Contains returns whether Region c is contained by Region r. It returns true
-// if c == r.
-func (r Region) Contains(c Region) bool {
-	return r.regionID.contains(c.regionID)
-}
-
-func (r regionID) contains(c regionID) bool {
-	if r == c {
-		return true
-	}
-	g := regionInclusion[r]
-	if g >= nRegionGroups {
-		return false
-	}
-	m := regionContainment[g]
-
-	d := regionInclusion[c]
-	b := regionInclusionBits[d]
-
-	// A contained country may belong to multiple disjoint groups. Matching any
-	// of these indicates containment. If the contained region is a group, it
-	// must strictly be a subset.
-	if d >= nRegionGroups {
-		return b&m != 0
-	}
-	return b&^m == 0
-}
-
-var errNoTLD = errors.New("language: region is not a valid ccTLD")
-
-// TLD returns the country code top-level domain (ccTLD). UK is returned for GB.
-// In all other cases it returns either the region itself or an error.
-//
-// This method may return an error for a region for which there exists a
-// canonical form with a ccTLD. To get that ccTLD canonicalize r first. The
-// region will already be canonicalized it was obtained from a Tag that was
-// obtained using any of the default methods.
-func (r Region) TLD() (Region, error) {
-	// See http://en.wikipedia.org/wiki/Country_code_top-level_domain for the
-	// difference between ISO 3166-1 and IANA ccTLD.
-	if r.regionID == _GB {
-		r = Region{_UK}
-	}
-	if (r.typ() & ccTLD) == 0 {
-		return Region{}, errNoTLD
-	}
-	return r, nil
-}
-
-// Canonicalize returns the region or a possible replacement if the region is
-// deprecated. It will not return a replacement for deprecated regions that
-// are split into multiple regions.
-func (r Region) Canonicalize() Region {
-	if cr := normRegion(r.regionID); cr != 0 {
-		return Region{cr}
-	}
-	return r
-}
-
-// Variant represents a registered variant of a language as defined by BCP 47.
-type Variant struct {
-	variant string
-}
-
-// ParseVariant parses and returns a Variant. An error is returned if s is not
-// a valid variant.
-func ParseVariant(s string) (Variant, error) {
-	s = strings.ToLower(s)
-	if _, ok := variantIndex[s]; ok {
-		return Variant{s}, nil
-	}
-	return Variant{}, mkErrInvalid([]byte(s))
-}
-
-// String returns the string representation of the variant.
-func (v Variant) String() string {
-	return v.variant
-}
diff --git a/vendor/golang.org/x/text/language/lookup.go b/vendor/golang.org/x/text/language/lookup.go
deleted file mode 100644
index 1d80ac3..0000000
--- a/vendor/golang.org/x/text/language/lookup.go
+++ /dev/null
@@ -1,396 +0,0 @@
-// Copyright 2013 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-package language
-
-import (
-	"bytes"
-	"fmt"
-	"sort"
-	"strconv"
-
-	"golang.org/x/text/internal/tag"
-)
-
-// findIndex tries to find the given tag in idx and returns a standardized error
-// if it could not be found.
-func findIndex(idx tag.Index, key []byte, form string) (index int, err error) {
-	if !tag.FixCase(form, key) {
-		return 0, errSyntax
-	}
-	i := idx.Index(key)
-	if i == -1 {
-		return 0, mkErrInvalid(key)
-	}
-	return i, nil
-}
-
-func searchUint(imap []uint16, key uint16) int {
-	return sort.Search(len(imap), func(i int) bool {
-		return imap[i] >= key
-	})
-}
-
-type langID uint16
-
-// getLangID returns the langID of s if s is a canonical subtag
-// or langUnknown if s is not a canonical subtag.
-func getLangID(s []byte) (langID, error) {
-	if len(s) == 2 {
-		return getLangISO2(s)
-	}
-	return getLangISO3(s)
-}
-
-// mapLang returns the mapped langID of id according to mapping m.
-func normLang(id langID) (langID, langAliasType) {
-	k := sort.Search(len(langAliasMap), func(i int) bool {
-		return langAliasMap[i].from >= uint16(id)
-	})
-	if k < len(langAliasMap) && langAliasMap[k].from == uint16(id) {
-		return langID(langAliasMap[k].to), langAliasTypes[k]
-	}
-	return id, langAliasTypeUnknown
-}
-
-// getLangISO2 returns the langID for the given 2-letter ISO language code
-// or unknownLang if this does not exist.
-func getLangISO2(s []byte) (langID, error) {
-	if !tag.FixCase("zz", s) {
-		return 0, errSyntax
-	}
-	if i := lang.Index(s); i != -1 && lang.Elem(i)[3] != 0 {
-		return langID(i), nil
-	}
-	return 0, mkErrInvalid(s)
-}
-
-const base = 'z' - 'a' + 1
-
-func strToInt(s []byte) uint {
-	v := uint(0)
-	for i := 0; i < len(s); i++ {
-		v *= base
-		v += uint(s[i] - 'a')
-	}
-	return v
-}
-
-// converts the given integer to the original ASCII string passed to strToInt.
-// len(s) must match the number of characters obtained.
-func intToStr(v uint, s []byte) {
-	for i := len(s) - 1; i >= 0; i-- {
-		s[i] = byte(v%base) + 'a'
-		v /= base
-	}
-}
-
-// getLangISO3 returns the langID for the given 3-letter ISO language code
-// or unknownLang if this does not exist.
-func getLangISO3(s []byte) (langID, error) {
-	if tag.FixCase("und", s) {
-		// first try to match canonical 3-letter entries
-		for i := lang.Index(s[:2]); i != -1; i = lang.Next(s[:2], i) {
-			if e := lang.Elem(i); e[3] == 0 && e[2] == s[2] {
-				// We treat "und" as special and always translate it to "unspecified".
-				// Note that ZZ and Zzzz are private use and are not treated as
-				// unspecified by default.
-				id := langID(i)
-				if id == nonCanonicalUnd {
-					return 0, nil
-				}
-				return id, nil
-			}
-		}
-		if i := altLangISO3.Index(s); i != -1 {
-			return langID(altLangIndex[altLangISO3.Elem(i)[3]]), nil
-		}
-		n := strToInt(s)
-		if langNoIndex[n/8]&(1<<(n%8)) != 0 {
-			return langID(n) + langNoIndexOffset, nil
-		}
-		// Check for non-canonical uses of ISO3.
-		for i := lang.Index(s[:1]); i != -1; i = lang.Next(s[:1], i) {
-			if e := lang.Elem(i); e[2] == s[1] && e[3] == s[2] {
-				return langID(i), nil
-			}
-		}
-		return 0, mkErrInvalid(s)
-	}
-	return 0, errSyntax
-}
-
-// stringToBuf writes the string to b and returns the number of bytes
-// written.  cap(b) must be >= 3.
-func (id langID) stringToBuf(b []byte) int {
-	if id >= langNoIndexOffset {
-		intToStr(uint(id)-langNoIndexOffset, b[:3])
-		return 3
-	} else if id == 0 {
-		return copy(b, "und")
-	}
-	l := lang[id<<2:]
-	if l[3] == 0 {
-		return copy(b, l[:3])
-	}
-	return copy(b, l[:2])
-}
-
-// String returns the BCP 47 representation of the langID.
-// Use b as variable name, instead of id, to ensure the variable
-// used is consistent with that of Base in which this type is embedded.
-func (b langID) String() string {
-	if b == 0 {
-		return "und"
-	} else if b >= langNoIndexOffset {
-		b -= langNoIndexOffset
-		buf := [3]byte{}
-		intToStr(uint(b), buf[:])
-		return string(buf[:])
-	}
-	l := lang.Elem(int(b))
-	if l[3] == 0 {
-		return l[:3]
-	}
-	return l[:2]
-}
-
-// ISO3 returns the ISO 639-3 language code.
-func (b langID) ISO3() string {
-	if b == 0 || b >= langNoIndexOffset {
-		return b.String()
-	}
-	l := lang.Elem(int(b))
-	if l[3] == 0 {
-		return l[:3]
-	} else if l[2] == 0 {
-		return altLangISO3.Elem(int(l[3]))[:3]
-	}
-	// This allocation will only happen for 3-letter ISO codes
-	// that are non-canonical BCP 47 language identifiers.
-	return l[0:1] + l[2:4]
-}
-
-// IsPrivateUse reports whether this language code is reserved for private use.
-func (b langID) IsPrivateUse() bool {
-	return langPrivateStart <= b && b <= langPrivateEnd
-}
-
-type regionID uint16
-
-// getRegionID returns the region id for s if s is a valid 2-letter region code
-// or unknownRegion.
-func getRegionID(s []byte) (regionID, error) {
-	if len(s) == 3 {
-		if isAlpha(s[0]) {
-			return getRegionISO3(s)
-		}
-		if i, err := strconv.ParseUint(string(s), 10, 10); err == nil {
-			return getRegionM49(int(i))
-		}
-	}
-	return getRegionISO2(s)
-}
-
-// getRegionISO2 returns the regionID for the given 2-letter ISO country code
-// or unknownRegion if this does not exist.
-func getRegionISO2(s []byte) (regionID, error) {
-	i, err := findIndex(regionISO, s, "ZZ")
-	if err != nil {
-		return 0, err
-	}
-	return regionID(i) + isoRegionOffset, nil
-}
-
-// getRegionISO3 returns the regionID for the given 3-letter ISO country code
-// or unknownRegion if this does not exist.
-func getRegionISO3(s []byte) (regionID, error) {
-	if tag.FixCase("ZZZ", s) {
-		for i := regionISO.Index(s[:1]); i != -1; i = regionISO.Next(s[:1], i) {
-			if e := regionISO.Elem(i); e[2] == s[1] && e[3] == s[2] {
-				return regionID(i) + isoRegionOffset, nil
-			}
-		}
-		for i := 0; i < len(altRegionISO3); i += 3 {
-			if tag.Compare(altRegionISO3[i:i+3], s) == 0 {
-				return regionID(altRegionIDs[i/3]), nil
-			}
-		}
-		return 0, mkErrInvalid(s)
-	}
-	return 0, errSyntax
-}
-
-func getRegionM49(n int) (regionID, error) {
-	if 0 < n && n <= 999 {
-		const (
-			searchBits = 7
-			regionBits = 9
-			regionMask = 1<<regionBits - 1
-		)
-		idx := n >> searchBits
-		buf := fromM49[m49Index[idx]:m49Index[idx+1]]
-		val := uint16(n) << regionBits // we rely on bits shifting out
-		i := sort.Search(len(buf), func(i int) bool {
-			return buf[i] >= val
-		})
-		if r := fromM49[int(m49Index[idx])+i]; r&^regionMask == val {
-			return regionID(r & regionMask), nil
-		}
-	}
-	var e ValueError
-	fmt.Fprint(bytes.NewBuffer([]byte(e.v[:])), n)
-	return 0, e
-}
-
-// normRegion returns a region if r is deprecated or 0 otherwise.
-// TODO: consider supporting BYS (-> BLR), CSK (-> 200 or CZ), PHI (-> PHL) and AFI (-> DJ).
-// TODO: consider mapping split up regions to new most populous one (like CLDR).
-func normRegion(r regionID) regionID {
-	m := regionOldMap
-	k := sort.Search(len(m), func(i int) bool {
-		return m[i].from >= uint16(r)
-	})
-	if k < len(m) && m[k].from == uint16(r) {
-		return regionID(m[k].to)
-	}
-	return 0
-}
-
-const (
-	iso3166UserAssigned = 1 << iota
-	ccTLD
-	bcp47Region
-)
-
-func (r regionID) typ() byte {
-	return regionTypes[r]
-}
-
-// String returns the BCP 47 representation for the region.
-// It returns "ZZ" for an unspecified region.
-func (r regionID) String() string {
-	if r < isoRegionOffset {
-		if r == 0 {
-			return "ZZ"
-		}
-		return fmt.Sprintf("%03d", r.M49())
-	}
-	r -= isoRegionOffset
-	return regionISO.Elem(int(r))[:2]
-}
-
-// ISO3 returns the 3-letter ISO code of r.
-// Note that not all regions have a 3-letter ISO code.
-// In such cases this method returns "ZZZ".
-func (r regionID) ISO3() string {
-	if r < isoRegionOffset {
-		return "ZZZ"
-	}
-	r -= isoRegionOffset
-	reg := regionISO.Elem(int(r))
-	switch reg[2] {
-	case 0:
-		return altRegionISO3[reg[3]:][:3]
-	case ' ':
-		return "ZZZ"
-	}
-	return reg[0:1] + reg[2:4]
-}
-
-// M49 returns the UN M.49 encoding of r, or 0 if this encoding
-// is not defined for r.
-func (r regionID) M49() int {
-	return int(m49[r])
-}
-
-// IsPrivateUse reports whether r has the ISO 3166 User-assigned status. This
-// may include private-use tags that are assigned by CLDR and used in this
-// implementation. So IsPrivateUse and IsCountry can be simultaneously true.
-func (r regionID) IsPrivateUse() bool {
-	return r.typ()&iso3166UserAssigned != 0
-}
-
-type scriptID uint8
-
-// getScriptID returns the script id for string s. It assumes that s
-// is of the format [A-Z][a-z]{3}.
-func getScriptID(idx tag.Index, s []byte) (scriptID, error) {
-	i, err := findIndex(idx, s, "Zzzz")
-	return scriptID(i), err
-}
-
-// String returns the script code in title case.
-// It returns "Zzzz" for an unspecified script.
-func (s scriptID) String() string {
-	if s == 0 {
-		return "Zzzz"
-	}
-	return script.Elem(int(s))
-}
-
-// IsPrivateUse reports whether this script code is reserved for private use.
-func (s scriptID) IsPrivateUse() bool {
-	return _Qaaa <= s && s <= _Qabx
-}
-
-const (
-	maxAltTaglen = len("en-US-POSIX")
-	maxLen       = maxAltTaglen
-)
-
-var (
-	// grandfatheredMap holds a mapping from legacy and grandfathered tags to
-	// their base language or index to more elaborate tag.
-	grandfatheredMap = map[[maxLen]byte]int16{
-		[maxLen]byte{'a', 'r', 't', '-', 'l', 'o', 'j', 'b', 'a', 'n'}: _jbo, // art-lojban
-		[maxLen]byte{'i', '-', 'a', 'm', 'i'}:                          _ami, // i-ami
-		[maxLen]byte{'i', '-', 'b', 'n', 'n'}:                          _bnn, // i-bnn
-		[maxLen]byte{'i', '-', 'h', 'a', 'k'}:                          _hak, // i-hak
-		[maxLen]byte{'i', '-', 'k', 'l', 'i', 'n', 'g', 'o', 'n'}:      _tlh, // i-klingon
-		[maxLen]byte{'i', '-', 'l', 'u', 'x'}:                          _lb,  // i-lux
-		[maxLen]byte{'i', '-', 'n', 'a', 'v', 'a', 'j', 'o'}:           _nv,  // i-navajo
-		[maxLen]byte{'i', '-', 'p', 'w', 'n'}:                          _pwn, // i-pwn
-		[maxLen]byte{'i', '-', 't', 'a', 'o'}:                          _tao, // i-tao
-		[maxLen]byte{'i', '-', 't', 'a', 'y'}:                          _tay, // i-tay
-		[maxLen]byte{'i', '-', 't', 's', 'u'}:                          _tsu, // i-tsu
-		[maxLen]byte{'n', 'o', '-', 'b', 'o', 'k'}:                     _nb,  // no-bok
-		[maxLen]byte{'n', 'o', '-', 'n', 'y', 'n'}:                     _nn,  // no-nyn
-		[maxLen]byte{'s', 'g', 'n', '-', 'b', 'e', '-', 'f', 'r'}:      _sfb, // sgn-BE-FR
-		[maxLen]byte{'s', 'g', 'n', '-', 'b', 'e', '-', 'n', 'l'}:      _vgt, // sgn-BE-NL
-		[maxLen]byte{'s', 'g', 'n', '-', 'c', 'h', '-', 'd', 'e'}:      _sgg, // sgn-CH-DE
-		[maxLen]byte{'z', 'h', '-', 'g', 'u', 'o', 'y', 'u'}:           _cmn, // zh-guoyu
-		[maxLen]byte{'z', 'h', '-', 'h', 'a', 'k', 'k', 'a'}:           _hak, // zh-hakka
-		[maxLen]byte{'z', 'h', '-', 'm', 'i', 'n', '-', 'n', 'a', 'n'}: _nan, // zh-min-nan
-		[maxLen]byte{'z', 'h', '-', 'x', 'i', 'a', 'n', 'g'}:           _hsn, // zh-xiang
-
-		// Grandfathered tags with no modern replacement will be converted as
-		// follows:
-		[maxLen]byte{'c', 'e', 'l', '-', 'g', 'a', 'u', 'l', 'i', 's', 'h'}: -1, // cel-gaulish
-		[maxLen]byte{'e', 'n', '-', 'g', 'b', '-', 'o', 'e', 'd'}:           -2, // en-GB-oed
-		[maxLen]byte{'i', '-', 'd', 'e', 'f', 'a', 'u', 'l', 't'}:           -3, // i-default
-		[maxLen]byte{'i', '-', 'e', 'n', 'o', 'c', 'h', 'i', 'a', 'n'}:      -4, // i-enochian
-		[maxLen]byte{'i', '-', 'm', 'i', 'n', 'g', 'o'}:                     -5, // i-mingo
-		[maxLen]byte{'z', 'h', '-', 'm', 'i', 'n'}:                          -6, // zh-min
-
-		// CLDR-specific tag.
-		[maxLen]byte{'r', 'o', 'o', 't'}:                                    0,  // root
-		[maxLen]byte{'e', 'n', '-', 'u', 's', '-', 'p', 'o', 's', 'i', 'x'}: -7, // en_US_POSIX"
-	}
-
-	altTagIndex = [...]uint8{0, 17, 31, 45, 61, 74, 86, 102}
-
-	altTags = "xtg-x-cel-gaulishen-GB-oxendicten-x-i-defaultund-x-i-enochiansee-x-i-mingonan-x-zh-minen-US-u-va-posix"
-)
-
-func grandfathered(s [maxAltTaglen]byte) (t Tag, ok bool) {
-	if v, ok := grandfatheredMap[s]; ok {
-		if v < 0 {
-			return Make(altTags[altTagIndex[-v-1]:altTagIndex[-v]]), true
-		}
-		t.lang = langID(v)
-		return t, true
-	}
-	return t, false
-}
diff --git a/vendor/golang.org/x/text/language/match.go b/vendor/golang.org/x/text/language/match.go
deleted file mode 100644
index 15b74d1..0000000
--- a/vendor/golang.org/x/text/language/match.go
+++ /dev/null
@@ -1,933 +0,0 @@
-// Copyright 2013 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-package language
-
-import "errors"
-
-// A MatchOption configures a Matcher.
-type MatchOption func(*matcher)
-
-// PreferSameScript will, in the absence of a match, result in the first
-// preferred tag with the same script as a supported tag to match this supported
-// tag. The default is currently true, but this may change in the future.
-func PreferSameScript(preferSame bool) MatchOption {
-	return func(m *matcher) { m.preferSameScript = preferSame }
-}
-
-// TODO(v1.0.0): consider making Matcher a concrete type, instead of interface.
-// There doesn't seem to be too much need for multiple types.
-// Making it a concrete type allows MatchStrings to be a method, which will
-// improve its discoverability.
-
-// MatchStrings parses and matches the given strings until one of them matches
-// the language in the Matcher. A string may be an Accept-Language header as
-// handled by ParseAcceptLanguage. The default language is returned if no
-// other language matched.
-func MatchStrings(m Matcher, lang ...string) (tag Tag, index int) {
-	for _, accept := range lang {
-		desired, _, err := ParseAcceptLanguage(accept)
-		if err != nil {
-			continue
-		}
-		if tag, index, conf := m.Match(desired...); conf != No {
-			return tag, index
-		}
-	}
-	tag, index, _ = m.Match()
-	return
-}
-
-// Matcher is the interface that wraps the Match method.
-//
-// Match returns the best match for any of the given tags, along with
-// a unique index associated with the returned tag and a confidence
-// score.
-type Matcher interface {
-	Match(t ...Tag) (tag Tag, index int, c Confidence)
-}
-
-// Comprehends reports the confidence score for a speaker of a given language
-// to being able to comprehend the written form of an alternative language.
-func Comprehends(speaker, alternative Tag) Confidence {
-	_, _, c := NewMatcher([]Tag{alternative}).Match(speaker)
-	return c
-}
-
-// NewMatcher returns a Matcher that matches an ordered list of preferred tags
-// against a list of supported tags based on written intelligibility, closeness
-// of dialect, equivalence of subtags and various other rules. It is initialized
-// with the list of supported tags. The first element is used as the default
-// value in case no match is found.
-//
-// Its Match method matches the first of the given Tags to reach a certain
-// confidence threshold. The tags passed to Match should therefore be specified
-// in order of preference. Extensions are ignored for matching.
-//
-// The index returned by the Match method corresponds to the index of the
-// matched tag in t, but is augmented with the Unicode extension ('u')of the
-// corresponding preferred tag. This allows user locale options to be passed
-// transparently.
-func NewMatcher(t []Tag, options ...MatchOption) Matcher {
-	return newMatcher(t, options)
-}
-
-func (m *matcher) Match(want ...Tag) (t Tag, index int, c Confidence) {
-	match, w, c := m.getBest(want...)
-	if match != nil {
-		t, index = match.tag, match.index
-	} else {
-		// TODO: this should be an option
-		t = m.default_.tag
-		if m.preferSameScript {
-		outer:
-			for _, w := range want {
-				script, _ := w.Script()
-				if script.scriptID == 0 {
-					// Don't do anything if there is no script, such as with
-					// private subtags.
-					continue
-				}
-				for i, h := range m.supported {
-					if script.scriptID == h.maxScript {
-						t, index = h.tag, i
-						break outer
-					}
-				}
-			}
-		}
-		// TODO: select first language tag based on script.
-	}
-	if w.region != 0 && t.region != 0 && t.region.contains(w.region) {
-		t, _ = Raw.Compose(t, Region{w.region})
-	}
-	// Copy options from the user-provided tag into the result tag. This is hard
-	// to do after the fact, so we do it here.
-	// TODO: add in alternative variants to -u-va-.
-	// TODO: add preferred region to -u-rg-.
-	if e := w.Extensions(); len(e) > 0 {
-		t, _ = Raw.Compose(t, e)
-	}
-	return t, index, c
-}
-
-type scriptRegionFlags uint8
-
-const (
-	isList = 1 << iota
-	scriptInFrom
-	regionInFrom
-)
-
-func (t *Tag) setUndefinedLang(id langID) {
-	if t.lang == 0 {
-		t.lang = id
-	}
-}
-
-func (t *Tag) setUndefinedScript(id scriptID) {
-	if t.script == 0 {
-		t.script = id
-	}
-}
-
-func (t *Tag) setUndefinedRegion(id regionID) {
-	if t.region == 0 || t.region.contains(id) {
-		t.region = id
-	}
-}
-
-// ErrMissingLikelyTagsData indicates no information was available
-// to compute likely values of missing tags.
-var ErrMissingLikelyTagsData = errors.New("missing likely tags data")
-
-// addLikelySubtags sets subtags to their most likely value, given the locale.
-// In most cases this means setting fields for unknown values, but in some
-// cases it may alter a value.  It returns an ErrMissingLikelyTagsData error
-// if the given locale cannot be expanded.
-func (t Tag) addLikelySubtags() (Tag, error) {
-	id, err := addTags(t)
-	if err != nil {
-		return t, err
-	} else if id.equalTags(t) {
-		return t, nil
-	}
-	id.remakeString()
-	return id, nil
-}
-
-// specializeRegion attempts to specialize a group region.
-func specializeRegion(t *Tag) bool {
-	if i := regionInclusion[t.region]; i < nRegionGroups {
-		x := likelyRegionGroup[i]
-		if langID(x.lang) == t.lang && scriptID(x.script) == t.script {
-			t.region = regionID(x.region)
-		}
-		return true
-	}
-	return false
-}
-
-func addTags(t Tag) (Tag, error) {
-	// We leave private use identifiers alone.
-	if t.private() {
-		return t, nil
-	}
-	if t.script != 0 && t.region != 0 {
-		if t.lang != 0 {
-			// already fully specified
-			specializeRegion(&t)
-			return t, nil
-		}
-		// Search matches for und-script-region. Note that for these cases
-		// region will never be a group so there is no need to check for this.
-		list := likelyRegion[t.region : t.region+1]
-		if x := list[0]; x.flags&isList != 0 {
-			list = likelyRegionList[x.lang : x.lang+uint16(x.script)]
-		}
-		for _, x := range list {
-			// Deviating from the spec. See match_test.go for details.
-			if scriptID(x.script) == t.script {
-				t.setUndefinedLang(langID(x.lang))
-				return t, nil
-			}
-		}
-	}
-	if t.lang != 0 {
-		// Search matches for lang-script and lang-region, where lang != und.
-		if t.lang < langNoIndexOffset {
-			x := likelyLang[t.lang]
-			if x.flags&isList != 0 {
-				list := likelyLangList[x.region : x.region+uint16(x.script)]
-				if t.script != 0 {
-					for _, x := range list {
-						if scriptID(x.script) == t.script && x.flags&scriptInFrom != 0 {
-							t.setUndefinedRegion(regionID(x.region))
-							return t, nil
-						}
-					}
-				} else if t.region != 0 {
-					count := 0
-					goodScript := true
-					tt := t
-					for _, x := range list {
-						// We visit all entries for which the script was not
-						// defined, including the ones where the region was not
-						// defined. This allows for proper disambiguation within
-						// regions.
-						if x.flags&scriptInFrom == 0 && t.region.contains(regionID(x.region)) {
-							tt.region = regionID(x.region)
-							tt.setUndefinedScript(scriptID(x.script))
-							goodScript = goodScript && tt.script == scriptID(x.script)
-							count++
-						}
-					}
-					if count == 1 {
-						return tt, nil
-					}
-					// Even if we fail to find a unique Region, we might have
-					// an unambiguous script.
-					if goodScript {
-						t.script = tt.script
-					}
-				}
-			}
-		}
-	} else {
-		// Search matches for und-script.
-		if t.script != 0 {
-			x := likelyScript[t.script]
-			if x.region != 0 {
-				t.setUndefinedRegion(regionID(x.region))
-				t.setUndefinedLang(langID(x.lang))
-				return t, nil
-			}
-		}
-		// Search matches for und-region. If und-script-region exists, it would
-		// have been found earlier.
-		if t.region != 0 {
-			if i := regionInclusion[t.region]; i < nRegionGroups {
-				x := likelyRegionGroup[i]
-				if x.region != 0 {
-					t.setUndefinedLang(langID(x.lang))
-					t.setUndefinedScript(scriptID(x.script))
-					t.region = regionID(x.region)
-				}
-			} else {
-				x := likelyRegion[t.region]
-				if x.flags&isList != 0 {
-					x = likelyRegionList[x.lang]
-				}
-				if x.script != 0 && x.flags != scriptInFrom {
-					t.setUndefinedLang(langID(x.lang))
-					t.setUndefinedScript(scriptID(x.script))
-					return t, nil
-				}
-			}
-		}
-	}
-
-	// Search matches for lang.
-	if t.lang < langNoIndexOffset {
-		x := likelyLang[t.lang]
-		if x.flags&isList != 0 {
-			x = likelyLangList[x.region]
-		}
-		if x.region != 0 {
-			t.setUndefinedScript(scriptID(x.script))
-			t.setUndefinedRegion(regionID(x.region))
-		}
-		specializeRegion(&t)
-		if t.lang == 0 {
-			t.lang = _en // default language
-		}
-		return t, nil
-	}
-	return t, ErrMissingLikelyTagsData
-}
-
-func (t *Tag) setTagsFrom(id Tag) {
-	t.lang = id.lang
-	t.script = id.script
-	t.region = id.region
-}
-
-// minimize removes the region or script subtags from t such that
-// t.addLikelySubtags() == t.minimize().addLikelySubtags().
-func (t Tag) minimize() (Tag, error) {
-	t, err := minimizeTags(t)
-	if err != nil {
-		return t, err
-	}
-	t.remakeString()
-	return t, nil
-}
-
-// minimizeTags mimics the behavior of the ICU 51 C implementation.
-func minimizeTags(t Tag) (Tag, error) {
-	if t.equalTags(und) {
-		return t, nil
-	}
-	max, err := addTags(t)
-	if err != nil {
-		return t, err
-	}
-	for _, id := range [...]Tag{
-		{lang: t.lang},
-		{lang: t.lang, region: t.region},
-		{lang: t.lang, script: t.script},
-	} {
-		if x, err := addTags(id); err == nil && max.equalTags(x) {
-			t.setTagsFrom(id)
-			break
-		}
-	}
-	return t, nil
-}
-
-// Tag Matching
-// CLDR defines an algorithm for finding the best match between two sets of language
-// tags. The basic algorithm defines how to score a possible match and then find
-// the match with the best score
-// (see http://www.unicode.org/reports/tr35/#LanguageMatching).
-// Using scoring has several disadvantages. The scoring obfuscates the importance of
-// the various factors considered, making the algorithm harder to understand. Using
-// scoring also requires the full score to be computed for each pair of tags.
-//
-// We will use a different algorithm which aims to have the following properties:
-// - clarity on the precedence of the various selection factors, and
-// - improved performance by allowing early termination of a comparison.
-//
-// Matching algorithm (overview)
-// Input:
-//   - supported: a set of supported tags
-//   - default:   the default tag to return in case there is no match
-//   - desired:   list of desired tags, ordered by preference, starting with
-//                the most-preferred.
-//
-// Algorithm:
-//   1) Set the best match to the lowest confidence level
-//   2) For each tag in "desired":
-//     a) For each tag in "supported":
-//        1) compute the match between the two tags.
-//        2) if the match is better than the previous best match, replace it
-//           with the new match. (see next section)
-//     b) if the current best match is Exact and pin is true the result will be
-//        frozen to the language found thusfar, although better matches may
-//        still be found for the same language.
-//   3) If the best match so far is below a certain threshold, return "default".
-//
-// Ranking:
-// We use two phases to determine whether one pair of tags are a better match
-// than another pair of tags. First, we determine a rough confidence level. If the
-// levels are different, the one with the highest confidence wins.
-// Second, if the rough confidence levels are identical, we use a set of tie-breaker
-// rules.
-//
-// The confidence level of matching a pair of tags is determined by finding the
-// lowest confidence level of any matches of the corresponding subtags (the
-// result is deemed as good as its weakest link).
-// We define the following levels:
-//   Exact    - An exact match of a subtag, before adding likely subtags.
-//   MaxExact - An exact match of a subtag, after adding likely subtags.
-//              [See Note 2].
-//   High     - High level of mutual intelligibility between different subtag
-//              variants.
-//   Low      - Low level of mutual intelligibility between different subtag
-//              variants.
-//   No       - No mutual intelligibility.
-//
-// The following levels can occur for each type of subtag:
-//   Base:    Exact, MaxExact, High, Low, No
-//   Script:  Exact, MaxExact [see Note 3], Low, No
-//   Region:  Exact, MaxExact, High
-//   Variant: Exact, High
-//   Private: Exact, No
-//
-// Any result with a confidence level of Low or higher is deemed a possible match.
-// Once a desired tag matches any of the supported tags with a level of MaxExact
-// or higher, the next desired tag is not considered (see Step 2.b).
-// Note that CLDR provides languageMatching data that defines close equivalence
-// classes for base languages, scripts and regions.
-//
-// Tie-breaking
-// If we get the same confidence level for two matches, we apply a sequence of
-// tie-breaking rules. The first that succeeds defines the result. The rules are
-// applied in the following order.
-//   1) Original language was defined and was identical.
-//   2) Original region was defined and was identical.
-//   3) Distance between two maximized regions was the smallest.
-//   4) Original script was defined and was identical.
-//   5) Distance from want tag to have tag using the parent relation [see Note 5.]
-// If there is still no winner after these rules are applied, the first match
-// found wins.
-//
-// Notes:
-// [2] In practice, as matching of Exact is done in a separate phase from
-//     matching the other levels, we reuse the Exact level to mean MaxExact in
-//     the second phase. As a consequence, we only need the levels defined by
-//     the Confidence type. The MaxExact confidence level is mapped to High in
-//     the public API.
-// [3] We do not differentiate between maximized script values that were derived
-//     from suppressScript versus most likely tag data. We determined that in
-//     ranking the two, one ranks just after the other. Moreover, the two cannot
-//     occur concurrently. As a consequence, they are identical for practical
-//     purposes.
-// [4] In case of deprecated, macro-equivalents and legacy mappings, we assign
-//     the MaxExact level to allow iw vs he to still be a closer match than
-//     en-AU vs en-US, for example.
-// [5] In CLDR a locale inherits fields that are unspecified for this locale
-//     from its parent. Therefore, if a locale is a parent of another locale,
-//     it is a strong measure for closeness, especially when no other tie
-//     breaker rule applies. One could also argue it is inconsistent, for
-//     example, when pt-AO matches pt (which CLDR equates with pt-BR), even
-//     though its parent is pt-PT according to the inheritance rules.
-//
-// Implementation Details:
-// There are several performance considerations worth pointing out. Most notably,
-// we preprocess as much as possible (within reason) at the time of creation of a
-// matcher. This includes:
-//   - creating a per-language map, which includes data for the raw base language
-//     and its canonicalized variant (if applicable),
-//   - expanding entries for the equivalence classes defined in CLDR's
-//     languageMatch data.
-// The per-language map ensures that typically only a very small number of tags
-// need to be considered. The pre-expansion of canonicalized subtags and
-// equivalence classes reduces the amount of map lookups that need to be done at
-// runtime.
-
-// matcher keeps a set of supported language tags, indexed by language.
-type matcher struct {
-	default_         *haveTag
-	supported        []*haveTag
-	index            map[langID]*matchHeader
-	passSettings     bool
-	preferSameScript bool
-}
-
-// matchHeader has the lists of tags for exact matches and matches based on
-// maximized and canonicalized tags for a given language.
-type matchHeader struct {
-	haveTags []*haveTag
-	original bool
-}
-
-// haveTag holds a supported Tag and its maximized script and region. The maximized
-// or canonicalized language is not stored as it is not needed during matching.
-type haveTag struct {
-	tag Tag
-
-	// index of this tag in the original list of supported tags.
-	index int
-
-	// conf is the maximum confidence that can result from matching this haveTag.
-	// When conf < Exact this means it was inserted after applying a CLDR equivalence rule.
-	conf Confidence
-
-	// Maximized region and script.
-	maxRegion regionID
-	maxScript scriptID
-
-	// altScript may be checked as an alternative match to maxScript. If altScript
-	// matches, the confidence level for this match is Low. Theoretically there
-	// could be multiple alternative scripts. This does not occur in practice.
-	altScript scriptID
-
-	// nextMax is the index of the next haveTag with the same maximized tags.
-	nextMax uint16
-}
-
-func makeHaveTag(tag Tag, index int) (haveTag, langID) {
-	max := tag
-	if tag.lang != 0 || tag.region != 0 || tag.script != 0 {
-		max, _ = max.canonicalize(All)
-		max, _ = addTags(max)
-		max.remakeString()
-	}
-	return haveTag{tag, index, Exact, max.region, max.script, altScript(max.lang, max.script), 0}, max.lang
-}
-
-// altScript returns an alternative script that may match the given script with
-// a low confidence.  At the moment, the langMatch data allows for at most one
-// script to map to another and we rely on this to keep the code simple.
-func altScript(l langID, s scriptID) scriptID {
-	for _, alt := range matchScript {
-		// TODO: also match cases where language is not the same.
-		if (langID(alt.wantLang) == l || langID(alt.haveLang) == l) &&
-			scriptID(alt.haveScript) == s {
-			return scriptID(alt.wantScript)
-		}
-	}
-	return 0
-}
-
-// addIfNew adds a haveTag to the list of tags only if it is a unique tag.
-// Tags that have the same maximized values are linked by index.
-func (h *matchHeader) addIfNew(n haveTag, exact bool) {
-	h.original = h.original || exact
-	// Don't add new exact matches.
-	for _, v := range h.haveTags {
-		if v.tag.equalsRest(n.tag) {
-			return
-		}
-	}
-	// Allow duplicate maximized tags, but create a linked list to allow quickly
-	// comparing the equivalents and bail out.
-	for i, v := range h.haveTags {
-		if v.maxScript == n.maxScript &&
-			v.maxRegion == n.maxRegion &&
-			v.tag.variantOrPrivateTagStr() == n.tag.variantOrPrivateTagStr() {
-			for h.haveTags[i].nextMax != 0 {
-				i = int(h.haveTags[i].nextMax)
-			}
-			h.haveTags[i].nextMax = uint16(len(h.haveTags))
-			break
-		}
-	}
-	h.haveTags = append(h.haveTags, &n)
-}
-
-// header returns the matchHeader for the given language. It creates one if
-// it doesn't already exist.
-func (m *matcher) header(l langID) *matchHeader {
-	if h := m.index[l]; h != nil {
-		return h
-	}
-	h := &matchHeader{}
-	m.index[l] = h
-	return h
-}
-
-func toConf(d uint8) Confidence {
-	if d <= 10 {
-		return High
-	}
-	if d < 30 {
-		return Low
-	}
-	return No
-}
-
-// newMatcher builds an index for the given supported tags and returns it as
-// a matcher. It also expands the index by considering various equivalence classes
-// for a given tag.
-func newMatcher(supported []Tag, options []MatchOption) *matcher {
-	m := &matcher{
-		index:            make(map[langID]*matchHeader),
-		preferSameScript: true,
-	}
-	for _, o := range options {
-		o(m)
-	}
-	if len(supported) == 0 {
-		m.default_ = &haveTag{}
-		return m
-	}
-	// Add supported languages to the index. Add exact matches first to give
-	// them precedence.
-	for i, tag := range supported {
-		pair, _ := makeHaveTag(tag, i)
-		m.header(tag.lang).addIfNew(pair, true)
-		m.supported = append(m.supported, &pair)
-	}
-	m.default_ = m.header(supported[0].lang).haveTags[0]
-	// Keep these in two different loops to support the case that two equivalent
-	// languages are distinguished, such as iw and he.
-	for i, tag := range supported {
-		pair, max := makeHaveTag(tag, i)
-		if max != tag.lang {
-			m.header(max).addIfNew(pair, true)
-		}
-	}
-
-	// update is used to add indexes in the map for equivalent languages.
-	// update will only add entries to original indexes, thus not computing any
-	// transitive relations.
-	update := func(want, have uint16, conf Confidence) {
-		if hh := m.index[langID(have)]; hh != nil {
-			if !hh.original {
-				return
-			}
-			hw := m.header(langID(want))
-			for _, ht := range hh.haveTags {
-				v := *ht
-				if conf < v.conf {
-					v.conf = conf
-				}
-				v.nextMax = 0 // this value needs to be recomputed
-				if v.altScript != 0 {
-					v.altScript = altScript(langID(want), v.maxScript)
-				}
-				hw.addIfNew(v, conf == Exact && hh.original)
-			}
-		}
-	}
-
-	// Add entries for languages with mutual intelligibility as defined by CLDR's
-	// languageMatch data.
-	for _, ml := range matchLang {
-		update(ml.want, ml.have, toConf(ml.distance))
-		if !ml.oneway {
-			update(ml.have, ml.want, toConf(ml.distance))
-		}
-	}
-
-	// Add entries for possible canonicalizations. This is an optimization to
-	// ensure that only one map lookup needs to be done at runtime per desired tag.
-	// First we match deprecated equivalents. If they are perfect equivalents
-	// (their canonicalization simply substitutes a different language code, but
-	// nothing else), the match confidence is Exact, otherwise it is High.
-	for i, lm := range langAliasMap {
-		// If deprecated codes match and there is no fiddling with the script or
-		// or region, we consider it an exact match.
-		conf := Exact
-		if langAliasTypes[i] != langMacro {
-			if !isExactEquivalent(langID(lm.from)) {
-				conf = High
-			}
-			update(lm.to, lm.from, conf)
-		}
-		update(lm.from, lm.to, conf)
-	}
-	return m
-}
-
-// getBest gets the best matching tag in m for any of the given tags, taking into
-// account the order of preference of the given tags.
-func (m *matcher) getBest(want ...Tag) (got *haveTag, orig Tag, c Confidence) {
-	best := bestMatch{}
-	for i, w := range want {
-		var max Tag
-		// Check for exact match first.
-		h := m.index[w.lang]
-		if w.lang != 0 {
-			if h == nil {
-				continue
-			}
-			// Base language is defined.
-			max, _ = w.canonicalize(Legacy | Deprecated | Macro)
-			// A region that is added through canonicalization is stronger than
-			// a maximized region: set it in the original (e.g. mo -> ro-MD).
-			if w.region != max.region {
-				w.region = max.region
-			}
-			// TODO: should we do the same for scripts?
-			// See test case: en, sr, nl ; sh ; sr
-			max, _ = addTags(max)
-		} else {
-			// Base language is not defined.
-			if h != nil {
-				for i := range h.haveTags {
-					have := h.haveTags[i]
-					if have.tag.equalsRest(w) {
-						return have, w, Exact
-					}
-				}
-			}
-			if w.script == 0 && w.region == 0 {
-				// We skip all tags matching und for approximate matching, including
-				// private tags.
-				continue
-			}
-			max, _ = addTags(w)
-			if h = m.index[max.lang]; h == nil {
-				continue
-			}
-		}
-		pin := true
-		for _, t := range want[i+1:] {
-			if w.lang == t.lang {
-				pin = false
-				break
-			}
-		}
-		// Check for match based on maximized tag.
-		for i := range h.haveTags {
-			have := h.haveTags[i]
-			best.update(have, w, max.script, max.region, pin)
-			if best.conf == Exact {
-				for have.nextMax != 0 {
-					have = h.haveTags[have.nextMax]
-					best.update(have, w, max.script, max.region, pin)
-				}
-				return best.have, best.want, best.conf
-			}
-		}
-	}
-	if best.conf <= No {
-		if len(want) != 0 {
-			return nil, want[0], No
-		}
-		return nil, Tag{}, No
-	}
-	return best.have, best.want, best.conf
-}
-
-// bestMatch accumulates the best match so far.
-type bestMatch struct {
-	have            *haveTag
-	want            Tag
-	conf            Confidence
-	pinnedRegion    regionID
-	pinLanguage     bool
-	sameRegionGroup bool
-	// Cached results from applying tie-breaking rules.
-	origLang     bool
-	origReg      bool
-	paradigmReg  bool
-	regGroupDist uint8
-	origScript   bool
-}
-
-// update updates the existing best match if the new pair is considered to be a
-// better match. To determine if the given pair is a better match, it first
-// computes the rough confidence level. If this surpasses the current match, it
-// will replace it and update the tie-breaker rule cache. If there is a tie, it
-// proceeds with applying a series of tie-breaker rules. If there is no
-// conclusive winner after applying the tie-breaker rules, it leaves the current
-// match as the preferred match.
-//
-// If pin is true and have and tag are a strong match, it will henceforth only
-// consider matches for this language. This corresponds to the nothing that most
-// users have a strong preference for the first defined language. A user can
-// still prefer a second language over a dialect of the preferred language by
-// explicitly specifying dialects, e.g. "en, nl, en-GB". In this case pin should
-// be false.
-func (m *bestMatch) update(have *haveTag, tag Tag, maxScript scriptID, maxRegion regionID, pin bool) {
-	// Bail if the maximum attainable confidence is below that of the current best match.
-	c := have.conf
-	if c < m.conf {
-		return
-	}
-	// Don't change the language once we already have found an exact match.
-	if m.pinLanguage && tag.lang != m.want.lang {
-		return
-	}
-	// Pin the region group if we are comparing tags for the same language.
-	if tag.lang == m.want.lang && m.sameRegionGroup {
-		_, sameGroup := regionGroupDist(m.pinnedRegion, have.maxRegion, have.maxScript, m.want.lang)
-		if !sameGroup {
-			return
-		}
-	}
-	if c == Exact && have.maxScript == maxScript {
-		// If there is another language and then another entry of this language,
-		// don't pin anything, otherwise pin the language.
-		m.pinLanguage = pin
-	}
-	if have.tag.equalsRest(tag) {
-	} else if have.maxScript != maxScript {
-		// There is usually very little comprehension between different scripts.
-		// In a few cases there may still be Low comprehension. This possibility
-		// is pre-computed and stored in have.altScript.
-		if Low < m.conf || have.altScript != maxScript {
-			return
-		}
-		c = Low
-	} else if have.maxRegion != maxRegion {
-		if High < c {
-			// There is usually a small difference between languages across regions.
-			c = High
-		}
-	}
-
-	// We store the results of the computations of the tie-breaker rules along
-	// with the best match. There is no need to do the checks once we determine
-	// we have a winner, but we do still need to do the tie-breaker computations.
-	// We use "beaten" to keep track if we still need to do the checks.
-	beaten := false // true if the new pair defeats the current one.
-	if c != m.conf {
-		if c < m.conf {
-			return
-		}
-		beaten = true
-	}
-
-	// Tie-breaker rules:
-	// We prefer if the pre-maximized language was specified and identical.
-	origLang := have.tag.lang == tag.lang && tag.lang != 0
-	if !beaten && m.origLang != origLang {
-		if m.origLang {
-			return
-		}
-		beaten = true
-	}
-
-	// We prefer if the pre-maximized region was specified and identical.
-	origReg := have.tag.region == tag.region && tag.region != 0
-	if !beaten && m.origReg != origReg {
-		if m.origReg {
-			return
-		}
-		beaten = true
-	}
-
-	regGroupDist, sameGroup := regionGroupDist(have.maxRegion, maxRegion, maxScript, tag.lang)
-	if !beaten && m.regGroupDist != regGroupDist {
-		if regGroupDist > m.regGroupDist {
-			return
-		}
-		beaten = true
-	}
-
-	paradigmReg := isParadigmLocale(tag.lang, have.maxRegion)
-	if !beaten && m.paradigmReg != paradigmReg {
-		if !paradigmReg {
-			return
-		}
-		beaten = true
-	}
-
-	// Next we prefer if the pre-maximized script was specified and identical.
-	origScript := have.tag.script == tag.script && tag.script != 0
-	if !beaten && m.origScript != origScript {
-		if m.origScript {
-			return
-		}
-		beaten = true
-	}
-
-	// Update m to the newly found best match.
-	if beaten {
-		m.have = have
-		m.want = tag
-		m.conf = c
-		m.pinnedRegion = maxRegion
-		m.sameRegionGroup = sameGroup
-		m.origLang = origLang
-		m.origReg = origReg
-		m.paradigmReg = paradigmReg
-		m.origScript = origScript
-		m.regGroupDist = regGroupDist
-	}
-}
-
-func isParadigmLocale(lang langID, r regionID) bool {
-	for _, e := range paradigmLocales {
-		if langID(e[0]) == lang && (r == regionID(e[1]) || r == regionID(e[2])) {
-			return true
-		}
-	}
-	return false
-}
-
-// regionGroupDist computes the distance between two regions based on their
-// CLDR grouping.
-func regionGroupDist(a, b regionID, script scriptID, lang langID) (dist uint8, same bool) {
-	const defaultDistance = 4
-
-	aGroup := uint(regionToGroups[a]) << 1
-	bGroup := uint(regionToGroups[b]) << 1
-	for _, ri := range matchRegion {
-		if langID(ri.lang) == lang && (ri.script == 0 || scriptID(ri.script) == script) {
-			group := uint(1 << (ri.group &^ 0x80))
-			if 0x80&ri.group == 0 {
-				if aGroup&bGroup&group != 0 { // Both regions are in the group.
-					return ri.distance, ri.distance == defaultDistance
-				}
-			} else {
-				if (aGroup|bGroup)&group == 0 { // Both regions are not in the group.
-					return ri.distance, ri.distance == defaultDistance
-				}
-			}
-		}
-	}
-	return defaultDistance, true
-}
-
-func (t Tag) variants() string {
-	if t.pVariant == 0 {
-		return ""
-	}
-	return t.str[t.pVariant:t.pExt]
-}
-
-// variantOrPrivateTagStr returns variants or private use tags.
-func (t Tag) variantOrPrivateTagStr() string {
-	if t.pExt > 0 {
-		return t.str[t.pVariant:t.pExt]
-	}
-	return t.str[t.pVariant:]
-}
-
-// equalsRest compares everything except the language.
-func (a Tag) equalsRest(b Tag) bool {
-	// TODO: don't include extensions in this comparison. To do this efficiently,
-	// though, we should handle private tags separately.
-	return a.script == b.script && a.region == b.region && a.variantOrPrivateTagStr() == b.variantOrPrivateTagStr()
-}
-
-// isExactEquivalent returns true if canonicalizing the language will not alter
-// the script or region of a tag.
-func isExactEquivalent(l langID) bool {
-	for _, o := range notEquivalent {
-		if o == l {
-			return false
-		}
-	}
-	return true
-}
-
-var notEquivalent []langID
-
-func init() {
-	// Create a list of all languages for which canonicalization may alter the
-	// script or region.
-	for _, lm := range langAliasMap {
-		tag := Tag{lang: langID(lm.from)}
-		if tag, _ = tag.canonicalize(All); tag.script != 0 || tag.region != 0 {
-			notEquivalent = append(notEquivalent, langID(lm.from))
-		}
-	}
-	// Maximize undefined regions of paradigm locales.
-	for i, v := range paradigmLocales {
-		max, _ := addTags(Tag{lang: langID(v[0])})
-		if v[1] == 0 {
-			paradigmLocales[i][1] = uint16(max.region)
-		}
-		if v[2] == 0 {
-			paradigmLocales[i][2] = uint16(max.region)
-		}
-	}
-}
diff --git a/vendor/golang.org/x/text/language/parse.go b/vendor/golang.org/x/text/language/parse.go
deleted file mode 100644
index fca2d30..0000000
--- a/vendor/golang.org/x/text/language/parse.go
+++ /dev/null
@@ -1,859 +0,0 @@
-// Copyright 2013 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-package language
-
-import (
-	"bytes"
-	"errors"
-	"fmt"
-	"sort"
-	"strconv"
-	"strings"
-
-	"golang.org/x/text/internal/tag"
-)
-
-// isAlpha returns true if the byte is not a digit.
-// b must be an ASCII letter or digit.
-func isAlpha(b byte) bool {
-	return b > '9'
-}
-
-// isAlphaNum returns true if the string contains only ASCII letters or digits.
-func isAlphaNum(s []byte) bool {
-	for _, c := range s {
-		if !('a' <= c && c <= 'z' || 'A' <= c && c <= 'Z' || '0' <= c && c <= '9') {
-			return false
-		}
-	}
-	return true
-}
-
-// errSyntax is returned by any of the parsing functions when the
-// input is not well-formed, according to BCP 47.
-// TODO: return the position at which the syntax error occurred?
-var errSyntax = errors.New("language: tag is not well-formed")
-
-// ValueError is returned by any of the parsing functions when the
-// input is well-formed but the respective subtag is not recognized
-// as a valid value.
-type ValueError struct {
-	v [8]byte
-}
-
-func mkErrInvalid(s []byte) error {
-	var e ValueError
-	copy(e.v[:], s)
-	return e
-}
-
-func (e ValueError) tag() []byte {
-	n := bytes.IndexByte(e.v[:], 0)
-	if n == -1 {
-		n = 8
-	}
-	return e.v[:n]
-}
-
-// Error implements the error interface.
-func (e ValueError) Error() string {
-	return fmt.Sprintf("language: subtag %q is well-formed but unknown", e.tag())
-}
-
-// Subtag returns the subtag for which the error occurred.
-func (e ValueError) Subtag() string {
-	return string(e.tag())
-}
-
-// scanner is used to scan BCP 47 tokens, which are separated by _ or -.
-type scanner struct {
-	b     []byte
-	bytes [max99thPercentileSize]byte
-	token []byte
-	start int // start position of the current token
-	end   int // end position of the current token
-	next  int // next point for scan
-	err   error
-	done  bool
-}
-
-func makeScannerString(s string) scanner {
-	scan := scanner{}
-	if len(s) <= len(scan.bytes) {
-		scan.b = scan.bytes[:copy(scan.bytes[:], s)]
-	} else {
-		scan.b = []byte(s)
-	}
-	scan.init()
-	return scan
-}
-
-// makeScanner returns a scanner using b as the input buffer.
-// b is not copied and may be modified by the scanner routines.
-func makeScanner(b []byte) scanner {
-	scan := scanner{b: b}
-	scan.init()
-	return scan
-}
-
-func (s *scanner) init() {
-	for i, c := range s.b {
-		if c == '_' {
-			s.b[i] = '-'
-		}
-	}
-	s.scan()
-}
-
-// restToLower converts the string between start and end to lower case.
-func (s *scanner) toLower(start, end int) {
-	for i := start; i < end; i++ {
-		c := s.b[i]
-		if 'A' <= c && c <= 'Z' {
-			s.b[i] += 'a' - 'A'
-		}
-	}
-}
-
-func (s *scanner) setError(e error) {
-	if s.err == nil || (e == errSyntax && s.err != errSyntax) {
-		s.err = e
-	}
-}
-
-// resizeRange shrinks or grows the array at position oldStart such that
-// a new string of size newSize can fit between oldStart and oldEnd.
-// Sets the scan point to after the resized range.
-func (s *scanner) resizeRange(oldStart, oldEnd, newSize int) {
-	s.start = oldStart
-	if end := oldStart + newSize; end != oldEnd {
-		diff := end - oldEnd
-		if end < cap(s.b) {
-			b := make([]byte, len(s.b)+diff)
-			copy(b, s.b[:oldStart])
-			copy(b[end:], s.b[oldEnd:])
-			s.b = b
-		} else {
-			s.b = append(s.b[end:], s.b[oldEnd:]...)
-		}
-		s.next = end + (s.next - s.end)
-		s.end = end
-	}
-}
-
-// replace replaces the current token with repl.
-func (s *scanner) replace(repl string) {
-	s.resizeRange(s.start, s.end, len(repl))
-	copy(s.b[s.start:], repl)
-}
-
-// gobble removes the current token from the input.
-// Caller must call scan after calling gobble.
-func (s *scanner) gobble(e error) {
-	s.setError(e)
-	if s.start == 0 {
-		s.b = s.b[:+copy(s.b, s.b[s.next:])]
-		s.end = 0
-	} else {
-		s.b = s.b[:s.start-1+copy(s.b[s.start-1:], s.b[s.end:])]
-		s.end = s.start - 1
-	}
-	s.next = s.start
-}
-
-// deleteRange removes the given range from s.b before the current token.
-func (s *scanner) deleteRange(start, end int) {
-	s.setError(errSyntax)
-	s.b = s.b[:start+copy(s.b[start:], s.b[end:])]
-	diff := end - start
-	s.next -= diff
-	s.start -= diff
-	s.end -= diff
-}
-
-// scan parses the next token of a BCP 47 string.  Tokens that are larger
-// than 8 characters or include non-alphanumeric characters result in an error
-// and are gobbled and removed from the output.
-// It returns the end position of the last token consumed.
-func (s *scanner) scan() (end int) {
-	end = s.end
-	s.token = nil
-	for s.start = s.next; s.next < len(s.b); {
-		i := bytes.IndexByte(s.b[s.next:], '-')
-		if i == -1 {
-			s.end = len(s.b)
-			s.next = len(s.b)
-			i = s.end - s.start
-		} else {
-			s.end = s.next + i
-			s.next = s.end + 1
-		}
-		token := s.b[s.start:s.end]
-		if i < 1 || i > 8 || !isAlphaNum(token) {
-			s.gobble(errSyntax)
-			continue
-		}
-		s.token = token
-		return end
-	}
-	if n := len(s.b); n > 0 && s.b[n-1] == '-' {
-		s.setError(errSyntax)
-		s.b = s.b[:len(s.b)-1]
-	}
-	s.done = true
-	return end
-}
-
-// acceptMinSize parses multiple tokens of the given size or greater.
-// It returns the end position of the last token consumed.
-func (s *scanner) acceptMinSize(min int) (end int) {
-	end = s.end
-	s.scan()
-	for ; len(s.token) >= min; s.scan() {
-		end = s.end
-	}
-	return end
-}
-
-// Parse parses the given BCP 47 string and returns a valid Tag. If parsing
-// failed it returns an error and any part of the tag that could be parsed.
-// If parsing succeeded but an unknown value was found, it returns
-// ValueError. The Tag returned in this case is just stripped of the unknown
-// value. All other values are preserved. It accepts tags in the BCP 47 format
-// and extensions to this standard defined in
-// http://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
-// The resulting tag is canonicalized using the default canonicalization type.
-func Parse(s string) (t Tag, err error) {
-	return Default.Parse(s)
-}
-
-// Parse parses the given BCP 47 string and returns a valid Tag. If parsing
-// failed it returns an error and any part of the tag that could be parsed.
-// If parsing succeeded but an unknown value was found, it returns
-// ValueError. The Tag returned in this case is just stripped of the unknown
-// value. All other values are preserved. It accepts tags in the BCP 47 format
-// and extensions to this standard defined in
-// http://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers.
-// The resulting tag is canonicalized using the the canonicalization type c.
-func (c CanonType) Parse(s string) (t Tag, err error) {
-	// TODO: consider supporting old-style locale key-value pairs.
-	if s == "" {
-		return und, errSyntax
-	}
-	if len(s) <= maxAltTaglen {
-		b := [maxAltTaglen]byte{}
-		for i, c := range s {
-			// Generating invalid UTF-8 is okay as it won't match.
-			if 'A' <= c && c <= 'Z' {
-				c += 'a' - 'A'
-			} else if c == '_' {
-				c = '-'
-			}
-			b[i] = byte(c)
-		}
-		if t, ok := grandfathered(b); ok {
-			return t, nil
-		}
-	}
-	scan := makeScannerString(s)
-	t, err = parse(&scan, s)
-	t, changed := t.canonicalize(c)
-	if changed {
-		t.remakeString()
-	}
-	return t, err
-}
-
-func parse(scan *scanner, s string) (t Tag, err error) {
-	t = und
-	var end int
-	if n := len(scan.token); n <= 1 {
-		scan.toLower(0, len(scan.b))
-		if n == 0 || scan.token[0] != 'x' {
-			return t, errSyntax
-		}
-		end = parseExtensions(scan)
-	} else if n >= 4 {
-		return und, errSyntax
-	} else { // the usual case
-		t, end = parseTag(scan)
-		if n := len(scan.token); n == 1 {
-			t.pExt = uint16(end)
-			end = parseExtensions(scan)
-		} else if end < len(scan.b) {
-			scan.setError(errSyntax)
-			scan.b = scan.b[:end]
-		}
-	}
-	if int(t.pVariant) < len(scan.b) {
-		if end < len(s) {
-			s = s[:end]
-		}
-		if len(s) > 0 && tag.Compare(s, scan.b) == 0 {
-			t.str = s
-		} else {
-			t.str = string(scan.b)
-		}
-	} else {
-		t.pVariant, t.pExt = 0, 0
-	}
-	return t, scan.err
-}
-
-// parseTag parses language, script, region and variants.
-// It returns a Tag and the end position in the input that was parsed.
-func parseTag(scan *scanner) (t Tag, end int) {
-	var e error
-	// TODO: set an error if an unknown lang, script or region is encountered.
-	t.lang, e = getLangID(scan.token)
-	scan.setError(e)
-	scan.replace(t.lang.String())
-	langStart := scan.start
-	end = scan.scan()
-	for len(scan.token) == 3 && isAlpha(scan.token[0]) {
-		// From http://tools.ietf.org/html/bcp47, <lang>-<extlang> tags are equivalent
-		// to a tag of the form <extlang>.
-		lang, e := getLangID(scan.token)
-		if lang != 0 {
-			t.lang = lang
-			copy(scan.b[langStart:], lang.String())
-			scan.b[langStart+3] = '-'
-			scan.start = langStart + 4
-		}
-		scan.gobble(e)
-		end = scan.scan()
-	}
-	if len(scan.token) == 4 && isAlpha(scan.token[0]) {
-		t.script, e = getScriptID(script, scan.token)
-		if t.script == 0 {
-			scan.gobble(e)
-		}
-		end = scan.scan()
-	}
-	if n := len(scan.token); n >= 2 && n <= 3 {
-		t.region, e = getRegionID(scan.token)
-		if t.region == 0 {
-			scan.gobble(e)
-		} else {
-			scan.replace(t.region.String())
-		}
-		end = scan.scan()
-	}
-	scan.toLower(scan.start, len(scan.b))
-	t.pVariant = byte(end)
-	end = parseVariants(scan, end, t)
-	t.pExt = uint16(end)
-	return t, end
-}
-
-var separator = []byte{'-'}
-
-// parseVariants scans tokens as long as each token is a valid variant string.
-// Duplicate variants are removed.
-func parseVariants(scan *scanner, end int, t Tag) int {
-	start := scan.start
-	varIDBuf := [4]uint8{}
-	variantBuf := [4][]byte{}
-	varID := varIDBuf[:0]
-	variant := variantBuf[:0]
-	last := -1
-	needSort := false
-	for ; len(scan.token) >= 4; scan.scan() {
-		// TODO: measure the impact of needing this conversion and redesign
-		// the data structure if there is an issue.
-		v, ok := variantIndex[string(scan.token)]
-		if !ok {
-			// unknown variant
-			// TODO: allow user-defined variants?
-			scan.gobble(mkErrInvalid(scan.token))
-			continue
-		}
-		varID = append(varID, v)
-		variant = append(variant, scan.token)
-		if !needSort {
-			if last < int(v) {
-				last = int(v)
-			} else {
-				needSort = true
-				// There is no legal combinations of more than 7 variants
-				// (and this is by no means a useful sequence).
-				const maxVariants = 8
-				if len(varID) > maxVariants {
-					break
-				}
-			}
-		}
-		end = scan.end
-	}
-	if needSort {
-		sort.Sort(variantsSort{varID, variant})
-		k, l := 0, -1
-		for i, v := range varID {
-			w := int(v)
-			if l == w {
-				// Remove duplicates.
-				continue
-			}
-			varID[k] = varID[i]
-			variant[k] = variant[i]
-			k++
-			l = w
-		}
-		if str := bytes.Join(variant[:k], separator); len(str) == 0 {
-			end = start - 1
-		} else {
-			scan.resizeRange(start, end, len(str))
-			copy(scan.b[scan.start:], str)
-			end = scan.end
-		}
-	}
-	return end
-}
-
-type variantsSort struct {
-	i []uint8
-	v [][]byte
-}
-
-func (s variantsSort) Len() int {
-	return len(s.i)
-}
-
-func (s variantsSort) Swap(i, j int) {
-	s.i[i], s.i[j] = s.i[j], s.i[i]
-	s.v[i], s.v[j] = s.v[j], s.v[i]
-}
-
-func (s variantsSort) Less(i, j int) bool {
-	return s.i[i] < s.i[j]
-}
-
-type bytesSort [][]byte
-
-func (b bytesSort) Len() int {
-	return len(b)
-}
-
-func (b bytesSort) Swap(i, j int) {
-	b[i], b[j] = b[j], b[i]
-}
-
-func (b bytesSort) Less(i, j int) bool {
-	return bytes.Compare(b[i], b[j]) == -1
-}
-
-// parseExtensions parses and normalizes the extensions in the buffer.
-// It returns the last position of scan.b that is part of any extension.
-// It also trims scan.b to remove excess parts accordingly.
-func parseExtensions(scan *scanner) int {
-	start := scan.start
-	exts := [][]byte{}
-	private := []byte{}
-	end := scan.end
-	for len(scan.token) == 1 {
-		extStart := scan.start
-		ext := scan.token[0]
-		end = parseExtension(scan)
-		extension := scan.b[extStart:end]
-		if len(extension) < 3 || (ext != 'x' && len(extension) < 4) {
-			scan.setError(errSyntax)
-			end = extStart
-			continue
-		} else if start == extStart && (ext == 'x' || scan.start == len(scan.b)) {
-			scan.b = scan.b[:end]
-			return end
-		} else if ext == 'x' {
-			private = extension
-			break
-		}
-		exts = append(exts, extension)
-	}
-	sort.Sort(bytesSort(exts))
-	if len(private) > 0 {
-		exts = append(exts, private)
-	}
-	scan.b = scan.b[:start]
-	if len(exts) > 0 {
-		scan.b = append(scan.b, bytes.Join(exts, separator)...)
-	} else if start > 0 {
-		// Strip trailing '-'.
-		scan.b = scan.b[:start-1]
-	}
-	return end
-}
-
-// parseExtension parses a single extension and returns the position of
-// the extension end.
-func parseExtension(scan *scanner) int {
-	start, end := scan.start, scan.end
-	switch scan.token[0] {
-	case 'u':
-		attrStart := end
-		scan.scan()
-		for last := []byte{}; len(scan.token) > 2; scan.scan() {
-			if bytes.Compare(scan.token, last) != -1 {
-				// Attributes are unsorted. Start over from scratch.
-				p := attrStart + 1
-				scan.next = p
-				attrs := [][]byte{}
-				for scan.scan(); len(scan.token) > 2; scan.scan() {
-					attrs = append(attrs, scan.token)
-					end = scan.end
-				}
-				sort.Sort(bytesSort(attrs))
-				copy(scan.b[p:], bytes.Join(attrs, separator))
-				break
-			}
-			last = scan.token
-			end = scan.end
-		}
-		var last, key []byte
-		for attrEnd := end; len(scan.token) == 2; last = key {
-			key = scan.token
-			keyEnd := scan.end
-			end = scan.acceptMinSize(3)
-			// TODO: check key value validity
-			if keyEnd == end || bytes.Compare(key, last) != 1 {
-				// We have an invalid key or the keys are not sorted.
-				// Start scanning keys from scratch and reorder.
-				p := attrEnd + 1
-				scan.next = p
-				keys := [][]byte{}
-				for scan.scan(); len(scan.token) == 2; {
-					keyStart, keyEnd := scan.start, scan.end
-					end = scan.acceptMinSize(3)
-					if keyEnd != end {
-						keys = append(keys, scan.b[keyStart:end])
-					} else {
-						scan.setError(errSyntax)
-						end = keyStart
-					}
-				}
-				sort.Sort(bytesSort(keys))
-				reordered := bytes.Join(keys, separator)
-				if e := p + len(reordered); e < end {
-					scan.deleteRange(e, end)
-					end = e
-				}
-				copy(scan.b[p:], bytes.Join(keys, separator))
-				break
-			}
-		}
-	case 't':
-		scan.scan()
-		if n := len(scan.token); n >= 2 && n <= 3 && isAlpha(scan.token[1]) {
-			_, end = parseTag(scan)
-			scan.toLower(start, end)
-		}
-		for len(scan.token) == 2 && !isAlpha(scan.token[1]) {
-			end = scan.acceptMinSize(3)
-		}
-	case 'x':
-		end = scan.acceptMinSize(1)
-	default:
-		end = scan.acceptMinSize(2)
-	}
-	return end
-}
-
-// Compose creates a Tag from individual parts, which may be of type Tag, Base,
-// Script, Region, Variant, []Variant, Extension, []Extension or error. If a
-// Base, Script or Region or slice of type Variant or Extension is passed more
-// than once, the latter will overwrite the former. Variants and Extensions are
-// accumulated, but if two extensions of the same type are passed, the latter
-// will replace the former. A Tag overwrites all former values and typically
-// only makes sense as the first argument. The resulting tag is returned after
-// canonicalizing using the Default CanonType. If one or more errors are
-// encountered, one of the errors is returned.
-func Compose(part ...interface{}) (t Tag, err error) {
-	return Default.Compose(part...)
-}
-
-// Compose creates a Tag from individual parts, which may be of type Tag, Base,
-// Script, Region, Variant, []Variant, Extension, []Extension or error. If a
-// Base, Script or Region or slice of type Variant or Extension is passed more
-// than once, the latter will overwrite the former. Variants and Extensions are
-// accumulated, but if two extensions of the same type are passed, the latter
-// will replace the former. A Tag overwrites all former values and typically
-// only makes sense as the first argument. The resulting tag is returned after
-// canonicalizing using CanonType c. If one or more errors are encountered,
-// one of the errors is returned.
-func (c CanonType) Compose(part ...interface{}) (t Tag, err error) {
-	var b builder
-	if err = b.update(part...); err != nil {
-		return und, err
-	}
-	t, _ = b.tag.canonicalize(c)
-
-	if len(b.ext) > 0 || len(b.variant) > 0 {
-		sort.Sort(sortVariant(b.variant))
-		sort.Strings(b.ext)
-		if b.private != "" {
-			b.ext = append(b.ext, b.private)
-		}
-		n := maxCoreSize + tokenLen(b.variant...) + tokenLen(b.ext...)
-		buf := make([]byte, n)
-		p := t.genCoreBytes(buf)
-		t.pVariant = byte(p)
-		p += appendTokens(buf[p:], b.variant...)
-		t.pExt = uint16(p)
-		p += appendTokens(buf[p:], b.ext...)
-		t.str = string(buf[:p])
-	} else if b.private != "" {
-		t.str = b.private
-		t.remakeString()
-	}
-	return
-}
-
-type builder struct {
-	tag Tag
-
-	private string // the x extension
-	ext     []string
-	variant []string
-
-	err error
-}
-
-func (b *builder) addExt(e string) {
-	if e == "" {
-	} else if e[0] == 'x' {
-		b.private = e
-	} else {
-		b.ext = append(b.ext, e)
-	}
-}
-
-var errInvalidArgument = errors.New("invalid Extension or Variant")
-
-func (b *builder) update(part ...interface{}) (err error) {
-	replace := func(l *[]string, s string, eq func(a, b string) bool) bool {
-		if s == "" {
-			b.err = errInvalidArgument
-			return true
-		}
-		for i, v := range *l {
-			if eq(v, s) {
-				(*l)[i] = s
-				return true
-			}
-		}
-		return false
-	}
-	for _, x := range part {
-		switch v := x.(type) {
-		case Tag:
-			b.tag.lang = v.lang
-			b.tag.region = v.region
-			b.tag.script = v.script
-			if v.str != "" {
-				b.variant = nil
-				for x, s := "", v.str[v.pVariant:v.pExt]; s != ""; {
-					x, s = nextToken(s)
-					b.variant = append(b.variant, x)
-				}
-				b.ext, b.private = nil, ""
-				for i, e := int(v.pExt), ""; i < len(v.str); {
-					i, e = getExtension(v.str, i)
-					b.addExt(e)
-				}
-			}
-		case Base:
-			b.tag.lang = v.langID
-		case Script:
-			b.tag.script = v.scriptID
-		case Region:
-			b.tag.region = v.regionID
-		case Variant:
-			if !replace(&b.variant, v.variant, func(a, b string) bool { return a == b }) {
-				b.variant = append(b.variant, v.variant)
-			}
-		case Extension:
-			if !replace(&b.ext, v.s, func(a, b string) bool { return a[0] == b[0] }) {
-				b.addExt(v.s)
-			}
-		case []Variant:
-			b.variant = nil
-			for _, x := range v {
-				b.update(x)
-			}
-		case []Extension:
-			b.ext, b.private = nil, ""
-			for _, e := range v {
-				b.update(e)
-			}
-		// TODO: support parsing of raw strings based on morphology or just extensions?
-		case error:
-			err = v
-		}
-	}
-	return
-}
-
-func tokenLen(token ...string) (n int) {
-	for _, t := range token {
-		n += len(t) + 1
-	}
-	return
-}
-
-func appendTokens(b []byte, token ...string) int {
-	p := 0
-	for _, t := range token {
-		b[p] = '-'
-		copy(b[p+1:], t)
-		p += 1 + len(t)
-	}
-	return p
-}
-
-type sortVariant []string
-
-func (s sortVariant) Len() int {
-	return len(s)
-}
-
-func (s sortVariant) Swap(i, j int) {
-	s[j], s[i] = s[i], s[j]
-}
-
-func (s sortVariant) Less(i, j int) bool {
-	return variantIndex[s[i]] < variantIndex[s[j]]
-}
-
-func findExt(list []string, x byte) int {
-	for i, e := range list {
-		if e[0] == x {
-			return i
-		}
-	}
-	return -1
-}
-
-// getExtension returns the name, body and end position of the extension.
-func getExtension(s string, p int) (end int, ext string) {
-	if s[p] == '-' {
-		p++
-	}
-	if s[p] == 'x' {
-		return len(s), s[p:]
-	}
-	end = nextExtension(s, p)
-	return end, s[p:end]
-}
-
-// nextExtension finds the next extension within the string, searching
-// for the -<char>- pattern from position p.
-// In the fast majority of cases, language tags will have at most
-// one extension and extensions tend to be small.
-func nextExtension(s string, p int) int {
-	for n := len(s) - 3; p < n; {
-		if s[p] == '-' {
-			if s[p+2] == '-' {
-				return p
-			}
-			p += 3
-		} else {
-			p++
-		}
-	}
-	return len(s)
-}
-
-var errInvalidWeight = errors.New("ParseAcceptLanguage: invalid weight")
-
-// ParseAcceptLanguage parses the contents of an Accept-Language header as
-// defined in http://www.ietf.org/rfc/rfc2616.txt and returns a list of Tags and
-// a list of corresponding quality weights. It is more permissive than RFC 2616
-// and may return non-nil slices even if the input is not valid.
-// The Tags will be sorted by highest weight first and then by first occurrence.
-// Tags with a weight of zero will be dropped. An error will be returned if the
-// input could not be parsed.
-func ParseAcceptLanguage(s string) (tag []Tag, q []float32, err error) {
-	var entry string
-	for s != "" {
-		if entry, s = split(s, ','); entry == "" {
-			continue
-		}
-
-		entry, weight := split(entry, ';')
-
-		// Scan the language.
-		t, err := Parse(entry)
-		if err != nil {
-			id, ok := acceptFallback[entry]
-			if !ok {
-				return nil, nil, err
-			}
-			t = Tag{lang: id}
-		}
-
-		// Scan the optional weight.
-		w := 1.0
-		if weight != "" {
-			weight = consume(weight, 'q')
-			weight = consume(weight, '=')
-			// consume returns the empty string when a token could not be
-			// consumed, resulting in an error for ParseFloat.
-			if w, err = strconv.ParseFloat(weight, 32); err != nil {
-				return nil, nil, errInvalidWeight
-			}
-			// Drop tags with a quality weight of 0.
-			if w <= 0 {
-				continue
-			}
-		}
-
-		tag = append(tag, t)
-		q = append(q, float32(w))
-	}
-	sortStable(&tagSort{tag, q})
-	return tag, q, nil
-}
-
-// consume removes a leading token c from s and returns the result or the empty
-// string if there is no such token.
-func consume(s string, c byte) string {
-	if s == "" || s[0] != c {
-		return ""
-	}
-	return strings.TrimSpace(s[1:])
-}
-
-func split(s string, c byte) (head, tail string) {
-	if i := strings.IndexByte(s, c); i >= 0 {
-		return strings.TrimSpace(s[:i]), strings.TrimSpace(s[i+1:])
-	}
-	return strings.TrimSpace(s), ""
-}
-
-// Add hack mapping to deal with a small number of cases that that occur
-// in Accept-Language (with reasonable frequency).
-var acceptFallback = map[string]langID{
-	"english": _en,
-	"deutsch": _de,
-	"italian": _it,
-	"french":  _fr,
-	"*":       _mul, // defined in the spec to match all languages.
-}
-
-type tagSort struct {
-	tag []Tag
-	q   []float32
-}
-
-func (s *tagSort) Len() int {
-	return len(s.q)
-}
-
-func (s *tagSort) Less(i, j int) bool {
-	return s.q[i] > s.q[j]
-}
-
-func (s *tagSort) Swap(i, j int) {
-	s.tag[i], s.tag[j] = s.tag[j], s.tag[i]
-	s.q[i], s.q[j] = s.q[j], s.q[i]
-}
diff --git a/vendor/golang.org/x/text/language/tables.go b/vendor/golang.org/x/text/language/tables.go
deleted file mode 100644
index b738d45..0000000
--- a/vendor/golang.org/x/text/language/tables.go
+++ /dev/null
@@ -1,3686 +0,0 @@
-// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT.
-
-package language
-
-import "golang.org/x/text/internal/tag"
-
-// CLDRVersion is the CLDR version from which the tables in this package are derived.
-const CLDRVersion = "32"
-
-const numLanguages = 8665
-
-const numScripts = 242
-
-const numRegions = 357
-
-type fromTo struct {
-	from uint16
-	to   uint16
-}
-
-const nonCanonicalUnd = 1201
-const (
-	_af  = 22
-	_am  = 39
-	_ar  = 58
-	_az  = 88
-	_bg  = 126
-	_bn  = 165
-	_ca  = 215
-	_cs  = 250
-	_da  = 257
-	_de  = 269
-	_el  = 310
-	_en  = 313
-	_es  = 318
-	_et  = 320
-	_fa  = 328
-	_fi  = 337
-	_fil = 339
-	_fr  = 350
-	_gu  = 420
-	_he  = 444
-	_hi  = 446
-	_hr  = 465
-	_hu  = 469
-	_hy  = 471
-	_id  = 481
-	_is  = 504
-	_it  = 505
-	_ja  = 512
-	_ka  = 528
-	_kk  = 578
-	_km  = 586
-	_kn  = 593
-	_ko  = 596
-	_ky  = 650
-	_lo  = 696
-	_lt  = 704
-	_lv  = 711
-	_mk  = 767
-	_ml  = 772
-	_mn  = 779
-	_mo  = 784
-	_mr  = 795
-	_ms  = 799
-	_mul = 806
-	_my  = 817
-	_nb  = 839
-	_ne  = 849
-	_nl  = 871
-	_no  = 879
-	_pa  = 925
-	_pl  = 947
-	_pt  = 960
-	_ro  = 988
-	_ru  = 994
-	_sh  = 1031
-	_si  = 1036
-	_sk  = 1042
-	_sl  = 1046
-	_sq  = 1073
-	_sr  = 1074
-	_sv  = 1092
-	_sw  = 1093
-	_ta  = 1104
-	_te  = 1121
-	_th  = 1131
-	_tl  = 1146
-	_tn  = 1152
-	_tr  = 1162
-	_uk  = 1198
-	_ur  = 1204
-	_uz  = 1212
-	_vi  = 1219
-	_zh  = 1321
-	_zu  = 1327
-	_jbo = 515
-	_ami = 1650
-	_bnn = 2357
-	_hak = 438
-	_tlh = 14467
-	_lb  = 661
-	_nv  = 899
-	_pwn = 12055
-	_tao = 14188
-	_tay = 14198
-	_tsu = 14662
-	_nn  = 874
-	_sfb = 13629
-	_vgt = 15701
-	_sgg = 13660
-	_cmn = 3007
-	_nan = 835
-	_hsn = 467
-)
-
-const langPrivateStart = 0x2f72
-
-const langPrivateEnd = 0x3179
-
-// lang holds an alphabetically sorted list of ISO-639 language identifiers.
-// All entries are 4 bytes. The index of the identifier (divided by 4) is the language tag.
-// For 2-byte language identifiers, the two successive bytes have the following meaning:
-//     - if the first letter of the 2- and 3-letter ISO codes are the same:
-//       the second and third letter of the 3-letter ISO code.
-//     - otherwise: a 0 and a by 2 bits right-shifted index into altLangISO3.
-// For 3-byte language identifiers the 4th byte is 0.
-const lang tag.Index = "" + // Size: 5324 bytes
-	"---\x00aaaraai\x00aak\x00aau\x00abbkabi\x00abq\x00abr\x00abt\x00aby\x00a" +
-	"cd\x00ace\x00ach\x00ada\x00ade\x00adj\x00ady\x00adz\x00aeveaeb\x00aey" +
-	"\x00affragc\x00agd\x00agg\x00agm\x00ago\x00agq\x00aha\x00ahl\x00aho\x00a" +
-	"jg\x00akkaakk\x00ala\x00ali\x00aln\x00alt\x00ammhamm\x00amn\x00amo\x00am" +
-	"p\x00anrganc\x00ank\x00ann\x00any\x00aoj\x00aom\x00aoz\x00apc\x00apd\x00" +
-	"ape\x00apr\x00aps\x00apz\x00arraarc\x00arh\x00arn\x00aro\x00arq\x00ars" +
-	"\x00ary\x00arz\x00assmasa\x00ase\x00asg\x00aso\x00ast\x00ata\x00atg\x00a" +
-	"tj\x00auy\x00avvaavl\x00avn\x00avt\x00avu\x00awa\x00awb\x00awo\x00awx" +
-	"\x00ayymayb\x00azzebaakbal\x00ban\x00bap\x00bar\x00bas\x00bav\x00bax\x00" +
-	"bba\x00bbb\x00bbc\x00bbd\x00bbj\x00bbp\x00bbr\x00bcf\x00bch\x00bci\x00bc" +
-	"m\x00bcn\x00bco\x00bcq\x00bcu\x00bdd\x00beelbef\x00beh\x00bej\x00bem\x00" +
-	"bet\x00bew\x00bex\x00bez\x00bfd\x00bfq\x00bft\x00bfy\x00bgulbgc\x00bgn" +
-	"\x00bgx\x00bhihbhb\x00bhg\x00bhi\x00bhk\x00bhl\x00bho\x00bhy\x00biisbib" +
-	"\x00big\x00bik\x00bim\x00bin\x00bio\x00biq\x00bjh\x00bji\x00bjj\x00bjn" +
-	"\x00bjo\x00bjr\x00bjt\x00bjz\x00bkc\x00bkm\x00bkq\x00bku\x00bkv\x00blt" +
-	"\x00bmambmh\x00bmk\x00bmq\x00bmu\x00bnenbng\x00bnm\x00bnp\x00boodboj\x00" +
-	"bom\x00bon\x00bpy\x00bqc\x00bqi\x00bqp\x00bqv\x00brrebra\x00brh\x00brx" +
-	"\x00brz\x00bsosbsj\x00bsq\x00bss\x00bst\x00bto\x00btt\x00btv\x00bua\x00b" +
-	"uc\x00bud\x00bug\x00buk\x00bum\x00buo\x00bus\x00buu\x00bvb\x00bwd\x00bwr" +
-	"\x00bxh\x00bye\x00byn\x00byr\x00bys\x00byv\x00byx\x00bza\x00bze\x00bzf" +
-	"\x00bzh\x00bzw\x00caatcan\x00cbj\x00cch\x00ccp\x00ceheceb\x00cfa\x00cgg" +
-	"\x00chhachk\x00chm\x00cho\x00chp\x00chr\x00cja\x00cjm\x00cjv\x00ckb\x00c" +
-	"kl\x00cko\x00cky\x00cla\x00cme\x00cmg\x00cooscop\x00cps\x00crrecrh\x00cr" +
-	"j\x00crk\x00crl\x00crm\x00crs\x00csescsb\x00csw\x00ctd\x00cuhucvhvcyymda" +
-	"andad\x00daf\x00dag\x00dah\x00dak\x00dar\x00dav\x00dbd\x00dbq\x00dcc\x00" +
-	"ddn\x00deeuded\x00den\x00dga\x00dgh\x00dgi\x00dgl\x00dgr\x00dgz\x00dia" +
-	"\x00dje\x00dnj\x00dob\x00doi\x00dop\x00dow\x00dri\x00drs\x00dsb\x00dtm" +
-	"\x00dtp\x00dts\x00dty\x00dua\x00duc\x00dud\x00dug\x00dvivdva\x00dww\x00d" +
-	"yo\x00dyu\x00dzzodzg\x00ebu\x00eeweefi\x00egl\x00egy\x00eka\x00eky\x00el" +
-	"llema\x00emi\x00enngenn\x00enq\x00eopoeri\x00es\x00\x05esu\x00etstetr" +
-	"\x00ett\x00etu\x00etx\x00euusewo\x00ext\x00faasfaa\x00fab\x00fag\x00fai" +
-	"\x00fan\x00ffulffi\x00ffm\x00fiinfia\x00fil\x00fit\x00fjijflr\x00fmp\x00" +
-	"foaofod\x00fon\x00for\x00fpe\x00fqs\x00frrafrc\x00frp\x00frr\x00frs\x00f" +
-	"ub\x00fud\x00fue\x00fuf\x00fuh\x00fuq\x00fur\x00fuv\x00fuy\x00fvr\x00fyr" +
-	"ygalegaa\x00gaf\x00gag\x00gah\x00gaj\x00gam\x00gan\x00gaw\x00gay\x00gba" +
-	"\x00gbf\x00gbm\x00gby\x00gbz\x00gcr\x00gdlagde\x00gdn\x00gdr\x00geb\x00g" +
-	"ej\x00gel\x00gez\x00gfk\x00ggn\x00ghs\x00gil\x00gim\x00gjk\x00gjn\x00gju" +
-	"\x00gkn\x00gkp\x00gllgglk\x00gmm\x00gmv\x00gnrngnd\x00gng\x00god\x00gof" +
-	"\x00goi\x00gom\x00gon\x00gor\x00gos\x00got\x00grb\x00grc\x00grt\x00grw" +
-	"\x00gsw\x00guujgub\x00guc\x00gud\x00gur\x00guw\x00gux\x00guz\x00gvlvgvf" +
-	"\x00gvr\x00gvs\x00gwc\x00gwi\x00gwt\x00gyi\x00haauhag\x00hak\x00ham\x00h" +
-	"aw\x00haz\x00hbb\x00hdy\x00heebhhy\x00hiinhia\x00hif\x00hig\x00hih\x00hi" +
-	"l\x00hla\x00hlu\x00hmd\x00hmt\x00hnd\x00hne\x00hnj\x00hnn\x00hno\x00homo" +
-	"hoc\x00hoj\x00hot\x00hrrvhsb\x00hsn\x00htathuunhui\x00hyyehzerianaian" +
-	"\x00iar\x00iba\x00ibb\x00iby\x00ica\x00ich\x00idndidd\x00idi\x00idu\x00i" +
-	"eleife\x00igboigb\x00ige\x00iiiiijj\x00ikpkikk\x00ikt\x00ikw\x00ikx\x00i" +
-	"lo\x00imo\x00inndinh\x00iodoiou\x00iri\x00isslittaiukuiw\x00\x03iwm\x00i" +
-	"ws\x00izh\x00izi\x00japnjab\x00jam\x00jbo\x00jbu\x00jen\x00jgk\x00jgo" +
-	"\x00ji\x00\x06jib\x00jmc\x00jml\x00jra\x00jut\x00jvavjwavkaatkaa\x00kab" +
-	"\x00kac\x00kad\x00kai\x00kaj\x00kam\x00kao\x00kbd\x00kbm\x00kbp\x00kbq" +
-	"\x00kbx\x00kby\x00kcg\x00kck\x00kcl\x00kct\x00kde\x00kdh\x00kdl\x00kdt" +
-	"\x00kea\x00ken\x00kez\x00kfo\x00kfr\x00kfy\x00kgonkge\x00kgf\x00kgp\x00k" +
-	"ha\x00khb\x00khn\x00khq\x00khs\x00kht\x00khw\x00khz\x00kiikkij\x00kiu" +
-	"\x00kiw\x00kjuakjd\x00kjg\x00kjs\x00kjy\x00kkazkkc\x00kkj\x00klalkln\x00" +
-	"klq\x00klt\x00klx\x00kmhmkmb\x00kmh\x00kmo\x00kms\x00kmu\x00kmw\x00knank" +
-	"nf\x00knp\x00koorkoi\x00kok\x00kol\x00kos\x00koz\x00kpe\x00kpf\x00kpo" +
-	"\x00kpr\x00kpx\x00kqb\x00kqf\x00kqs\x00kqy\x00kraukrc\x00kri\x00krj\x00k" +
-	"rl\x00krs\x00kru\x00ksasksb\x00ksd\x00ksf\x00ksh\x00ksj\x00ksr\x00ktb" +
-	"\x00ktm\x00kto\x00kuurkub\x00kud\x00kue\x00kuj\x00kum\x00kun\x00kup\x00k" +
-	"us\x00kvomkvg\x00kvr\x00kvx\x00kw\x00\x01kwj\x00kwo\x00kxa\x00kxc\x00kxm" +
-	"\x00kxp\x00kxw\x00kxz\x00kyirkye\x00kyx\x00kzr\x00laatlab\x00lad\x00lag" +
-	"\x00lah\x00laj\x00las\x00lbtzlbe\x00lbu\x00lbw\x00lcm\x00lcp\x00ldb\x00l" +
-	"ed\x00lee\x00lem\x00lep\x00leq\x00leu\x00lez\x00lguglgg\x00liimlia\x00li" +
-	"d\x00lif\x00lig\x00lih\x00lij\x00lis\x00ljp\x00lki\x00lkt\x00lle\x00lln" +
-	"\x00lmn\x00lmo\x00lmp\x00lninlns\x00lnu\x00loaoloj\x00lok\x00lol\x00lor" +
-	"\x00los\x00loz\x00lrc\x00ltitltg\x00luublua\x00luo\x00luy\x00luz\x00lvav" +
-	"lwl\x00lzh\x00lzz\x00mad\x00maf\x00mag\x00mai\x00mak\x00man\x00mas\x00ma" +
-	"w\x00maz\x00mbh\x00mbo\x00mbq\x00mbu\x00mbw\x00mci\x00mcp\x00mcq\x00mcr" +
-	"\x00mcu\x00mda\x00mde\x00mdf\x00mdh\x00mdj\x00mdr\x00mdx\x00med\x00mee" +
-	"\x00mek\x00men\x00mer\x00met\x00meu\x00mfa\x00mfe\x00mfn\x00mfo\x00mfq" +
-	"\x00mglgmgh\x00mgl\x00mgo\x00mgp\x00mgy\x00mhahmhi\x00mhl\x00mirimif\x00" +
-	"min\x00mis\x00miw\x00mkkdmki\x00mkl\x00mkp\x00mkw\x00mlalmle\x00mlp\x00m" +
-	"ls\x00mmo\x00mmu\x00mmx\x00mnonmna\x00mnf\x00mni\x00mnw\x00moolmoa\x00mo" +
-	"e\x00moh\x00mos\x00mox\x00mpp\x00mps\x00mpt\x00mpx\x00mql\x00mrarmrd\x00" +
-	"mrj\x00mro\x00mssamtltmtc\x00mtf\x00mti\x00mtr\x00mua\x00mul\x00mur\x00m" +
-	"us\x00mva\x00mvn\x00mvy\x00mwk\x00mwr\x00mwv\x00mxc\x00mxm\x00myyamyk" +
-	"\x00mym\x00myv\x00myw\x00myx\x00myz\x00mzk\x00mzm\x00mzn\x00mzp\x00mzw" +
-	"\x00mzz\x00naaunac\x00naf\x00nah\x00nak\x00nan\x00nap\x00naq\x00nas\x00n" +
-	"bobnca\x00nce\x00ncf\x00nch\x00nco\x00ncu\x00nddendc\x00nds\x00neepneb" +
-	"\x00new\x00nex\x00nfr\x00ngdonga\x00ngb\x00ngl\x00nhb\x00nhe\x00nhw\x00n" +
-	"if\x00nii\x00nij\x00nin\x00niu\x00niy\x00niz\x00njo\x00nkg\x00nko\x00nll" +
-	"dnmg\x00nmz\x00nnnonnf\x00nnh\x00nnk\x00nnm\x00noornod\x00noe\x00non\x00" +
-	"nop\x00nou\x00nqo\x00nrblnrb\x00nsk\x00nsn\x00nso\x00nss\x00ntm\x00ntr" +
-	"\x00nui\x00nup\x00nus\x00nuv\x00nux\x00nvavnwb\x00nxq\x00nxr\x00nyyanym" +
-	"\x00nyn\x00nzi\x00occiogc\x00ojjiokr\x00okv\x00omrmong\x00onn\x00ons\x00" +
-	"opm\x00orrioro\x00oru\x00osssosa\x00ota\x00otk\x00ozm\x00paanpag\x00pal" +
-	"\x00pam\x00pap\x00pau\x00pbi\x00pcd\x00pcm\x00pdc\x00pdt\x00ped\x00peo" +
-	"\x00pex\x00pfl\x00phl\x00phn\x00pilipil\x00pip\x00pka\x00pko\x00plolpla" +
-	"\x00pms\x00png\x00pnn\x00pnt\x00pon\x00ppo\x00pra\x00prd\x00prg\x00psusp" +
-	"ss\x00ptorptp\x00puu\x00pwa\x00quuequc\x00qug\x00rai\x00raj\x00rao\x00rc" +
-	"f\x00rej\x00rel\x00res\x00rgn\x00rhg\x00ria\x00rif\x00rjs\x00rkt\x00rmoh" +
-	"rmf\x00rmo\x00rmt\x00rmu\x00rnunrna\x00rng\x00roonrob\x00rof\x00roo\x00r" +
-	"ro\x00rtm\x00ruusrue\x00rug\x00rw\x00\x04rwk\x00rwo\x00ryu\x00saansaf" +
-	"\x00sah\x00saq\x00sas\x00sat\x00sav\x00saz\x00sba\x00sbe\x00sbp\x00scrds" +
-	"ck\x00scl\x00scn\x00sco\x00scs\x00sdndsdc\x00sdh\x00semesef\x00seh\x00se" +
-	"i\x00ses\x00sgagsga\x00sgs\x00sgw\x00sgz\x00sh\x00\x02shi\x00shk\x00shn" +
-	"\x00shu\x00siinsid\x00sig\x00sil\x00sim\x00sjr\x00sklkskc\x00skr\x00sks" +
-	"\x00sllvsld\x00sli\x00sll\x00sly\x00smmosma\x00smi\x00smj\x00smn\x00smp" +
-	"\x00smq\x00sms\x00snnasnc\x00snk\x00snp\x00snx\x00sny\x00soomsok\x00soq" +
-	"\x00sou\x00soy\x00spd\x00spl\x00sps\x00sqqisrrpsrb\x00srn\x00srr\x00srx" +
-	"\x00ssswssd\x00ssg\x00ssy\x00stotstk\x00stq\x00suunsua\x00sue\x00suk\x00" +
-	"sur\x00sus\x00svweswwaswb\x00swc\x00swg\x00swp\x00swv\x00sxn\x00sxw\x00s" +
-	"yl\x00syr\x00szl\x00taamtaj\x00tal\x00tan\x00taq\x00tbc\x00tbd\x00tbf" +
-	"\x00tbg\x00tbo\x00tbw\x00tbz\x00tci\x00tcy\x00tdd\x00tdg\x00tdh\x00teelt" +
-	"ed\x00tem\x00teo\x00tet\x00tfi\x00tggktgc\x00tgo\x00tgu\x00thhathl\x00th" +
-	"q\x00thr\x00tiirtif\x00tig\x00tik\x00tim\x00tio\x00tiv\x00tkuktkl\x00tkr" +
-	"\x00tkt\x00tlgltlf\x00tlx\x00tly\x00tmh\x00tmy\x00tnsntnh\x00toontof\x00" +
-	"tog\x00toq\x00tpi\x00tpm\x00tpz\x00tqo\x00trurtru\x00trv\x00trw\x00tssot" +
-	"sd\x00tsf\x00tsg\x00tsj\x00tsw\x00ttatttd\x00tte\x00ttj\x00ttr\x00tts" +
-	"\x00ttt\x00tuh\x00tul\x00tum\x00tuq\x00tvd\x00tvl\x00tvu\x00twwitwh\x00t" +
-	"wq\x00txg\x00tyahtya\x00tyv\x00tzm\x00ubu\x00udm\x00ugiguga\x00ukkruli" +
-	"\x00umb\x00und\x00unr\x00unx\x00urrduri\x00urt\x00urw\x00usa\x00utr\x00u" +
-	"vh\x00uvl\x00uzzbvag\x00vai\x00van\x00veenvec\x00vep\x00viievic\x00viv" +
-	"\x00vls\x00vmf\x00vmw\x00voolvot\x00vro\x00vun\x00vut\x00walnwae\x00waj" +
-	"\x00wal\x00wan\x00war\x00wbp\x00wbq\x00wbr\x00wci\x00wer\x00wgi\x00whg" +
-	"\x00wib\x00wiu\x00wiv\x00wja\x00wji\x00wls\x00wmo\x00wnc\x00wni\x00wnu" +
-	"\x00woolwob\x00wos\x00wrs\x00wsk\x00wtm\x00wuu\x00wuv\x00wwa\x00xav\x00x" +
-	"bi\x00xcr\x00xes\x00xhhoxla\x00xlc\x00xld\x00xmf\x00xmn\x00xmr\x00xna" +
-	"\x00xnr\x00xog\x00xon\x00xpr\x00xrb\x00xsa\x00xsi\x00xsm\x00xsr\x00xwe" +
-	"\x00yam\x00yao\x00yap\x00yas\x00yat\x00yav\x00yay\x00yaz\x00yba\x00ybb" +
-	"\x00yby\x00yer\x00ygr\x00ygw\x00yiidyko\x00yle\x00ylg\x00yll\x00yml\x00y" +
-	"ooryon\x00yrb\x00yre\x00yrl\x00yss\x00yua\x00yue\x00yuj\x00yut\x00yuw" +
-	"\x00zahazag\x00zbl\x00zdj\x00zea\x00zgh\x00zhhozhx\x00zia\x00zlm\x00zmi" +
-	"\x00zne\x00zuulzxx\x00zza\x00\xff\xff\xff\xff"
-
-const langNoIndexOffset = 1330
-
-// langNoIndex is a bit vector of all 3-letter language codes that are not used as an index
-// in lookup tables. The language ids for these language codes are derived directly
-// from the letters and are not consecutive.
-// Size: 2197 bytes, 2197 elements
-var langNoIndex = [2197]uint8{
-	// Entry 0 - 3F
-	0xff, 0xf8, 0xed, 0xfe, 0xeb, 0xd3, 0x3b, 0xd2,
-	0xfb, 0xbf, 0x7a, 0xfa, 0x37, 0x1d, 0x3c, 0x57,
-	0x6e, 0x97, 0x73, 0x38, 0xfb, 0xea, 0xbf, 0x70,
-	0xad, 0x03, 0xff, 0xff, 0xcf, 0x05, 0x84, 0x62,
-	0xe9, 0xbf, 0xfd, 0xbf, 0xbf, 0xf7, 0xfd, 0x77,
-	0x0f, 0xff, 0xef, 0x6f, 0xff, 0xfb, 0xdf, 0xe2,
-	0xc9, 0xf8, 0x7f, 0x7e, 0x4d, 0xb8, 0x0a, 0x6a,
-	0x7c, 0xea, 0xe3, 0xfa, 0x7a, 0xbf, 0x67, 0xff,
-	// Entry 40 - 7F
-	0xff, 0xff, 0xff, 0xdf, 0x2a, 0x54, 0x91, 0xc0,
-	0x5d, 0xe3, 0x97, 0x14, 0x07, 0x20, 0xdd, 0xed,
-	0x9f, 0x3f, 0xc9, 0x21, 0xf8, 0x3f, 0x94, 0x35,
-	0x7c, 0x5f, 0xff, 0x5f, 0x8e, 0x6e, 0xdf, 0xff,
-	0xff, 0xff, 0x55, 0x7c, 0xd3, 0xfd, 0xbf, 0xb5,
-	0x7b, 0xdf, 0x7f, 0xf7, 0xca, 0xfe, 0xdb, 0xa3,
-	0xa8, 0xff, 0x1f, 0x67, 0x7d, 0xeb, 0xef, 0xce,
-	0xff, 0xff, 0x9f, 0xff, 0xb7, 0xef, 0xfe, 0xcf,
-	// Entry 80 - BF
-	0xdb, 0xff, 0xf3, 0xcd, 0xfb, 0x2f, 0xff, 0xff,
-	0xbb, 0xee, 0xf7, 0xbd, 0xdb, 0xff, 0x5f, 0xf7,
-	0xfd, 0xf2, 0xfd, 0xff, 0x5e, 0x2f, 0x3b, 0xba,
-	0x7e, 0xff, 0xff, 0xfe, 0xf7, 0xff, 0xdd, 0xff,
-	0xfd, 0xdf, 0xfb, 0xfe, 0x9d, 0xb4, 0xd3, 0xff,
-	0xef, 0xff, 0xdf, 0xf7, 0x7f, 0xb7, 0xfd, 0xd5,
-	0xa5, 0x77, 0x40, 0xff, 0x9c, 0xc1, 0x41, 0x2c,
-	0x08, 0x20, 0x41, 0x00, 0x50, 0x40, 0x00, 0x80,
-	// Entry C0 - FF
-	0xfb, 0x4a, 0xf2, 0x9f, 0xb4, 0x42, 0x41, 0x96,
-	0x1b, 0x14, 0x08, 0xf2, 0x2b, 0xe7, 0x17, 0x56,
-	0x05, 0x7d, 0x0e, 0x1c, 0x37, 0x71, 0xf3, 0xef,
-	0x97, 0xff, 0x5d, 0x38, 0x64, 0x08, 0x00, 0x10,
-	0xbc, 0x85, 0xaf, 0xdf, 0xff, 0xf7, 0x73, 0x35,
-	0x3e, 0x87, 0xc7, 0xdf, 0xff, 0x00, 0x81, 0x00,
-	0xb0, 0x05, 0x80, 0x00, 0x00, 0x00, 0x00, 0x03,
-	0x40, 0x00, 0x40, 0x92, 0x21, 0x50, 0xb1, 0x5d,
-	// Entry 100 - 13F
-	0xfd, 0xdc, 0xbe, 0x5e, 0x00, 0x00, 0x02, 0x64,
-	0x0d, 0x19, 0x41, 0xdf, 0x79, 0x22, 0x00, 0x00,
-	0x00, 0x5e, 0x64, 0xdc, 0x24, 0xe5, 0xd9, 0xe3,
-	0xfe, 0xff, 0xfd, 0xcb, 0x9f, 0x14, 0x01, 0x0c,
-	0x86, 0x00, 0xd1, 0x00, 0xf0, 0xc5, 0x67, 0x5f,
-	0x56, 0x89, 0x5e, 0xb5, 0x6c, 0xaf, 0x03, 0x00,
-	0x02, 0x00, 0x00, 0x00, 0xc0, 0x37, 0xda, 0x56,
-	0x90, 0x69, 0x01, 0x2c, 0x96, 0x69, 0x20, 0xfb,
-	// Entry 140 - 17F
-	0xff, 0x3f, 0x00, 0x00, 0x00, 0x01, 0x08, 0x16,
-	0x01, 0x00, 0x00, 0xb0, 0x14, 0x03, 0x50, 0x06,
-	0x0a, 0x00, 0x01, 0x00, 0x00, 0x00, 0x11, 0x09,
-	0x00, 0x00, 0x60, 0x10, 0x00, 0x00, 0x00, 0x10,
-	0x00, 0x00, 0x44, 0x00, 0x00, 0x10, 0x00, 0x04,
-	0x08, 0x00, 0x00, 0x04, 0x00, 0x80, 0x28, 0x04,
-	0x00, 0x00, 0x40, 0xd5, 0x2d, 0x00, 0x64, 0x35,
-	0x24, 0x52, 0xf4, 0xd4, 0xbd, 0x62, 0xc9, 0x03,
-	// Entry 180 - 1BF
-	0x00, 0x80, 0x00, 0x40, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x04, 0x13, 0x39, 0x01, 0xdd, 0x57, 0x98,
-	0x21, 0x18, 0x81, 0x00, 0x00, 0x01, 0x40, 0x82,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x01, 0x40, 0x00, 0x44, 0x00, 0x00, 0x80, 0xea,
-	0xa9, 0x39, 0x00, 0x02, 0x00, 0x00, 0x00, 0x04,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x02, 0x00, 0x00, 0x00,
-	// Entry 1C0 - 1FF
-	0x00, 0x01, 0x28, 0x05, 0x00, 0x00, 0x00, 0x00,
-	0x04, 0x20, 0x04, 0xa6, 0x00, 0x04, 0x00, 0x00,
-	0x81, 0x50, 0x00, 0x00, 0x00, 0x11, 0x84, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x55,
-	0x02, 0x10, 0x08, 0x04, 0x00, 0x00, 0x00, 0x40,
-	0x30, 0x83, 0x01, 0x00, 0x00, 0x00, 0x11, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x1e, 0xcd, 0xbf, 0x7a, 0xbf,
-	// Entry 200 - 23F
-	0xdf, 0xc3, 0x83, 0x82, 0xc0, 0xfb, 0x57, 0x27,
-	0xcd, 0x55, 0xe7, 0x01, 0x00, 0x20, 0xb2, 0xc5,
-	0xa4, 0x45, 0x25, 0x9b, 0x02, 0xdf, 0xe0, 0xdf,
-	0x03, 0x44, 0x08, 0x10, 0x01, 0x04, 0x01, 0xe3,
-	0x92, 0x54, 0xdb, 0x28, 0xd1, 0x5f, 0xf6, 0x6d,
-	0x79, 0xed, 0x1c, 0x7d, 0x04, 0x08, 0x00, 0x01,
-	0x21, 0x12, 0x64, 0x5f, 0xdd, 0x0e, 0x85, 0x4f,
-	0x40, 0x40, 0x00, 0x04, 0xf1, 0xfd, 0x3d, 0x54,
-	// Entry 240 - 27F
-	0xe8, 0x03, 0xb4, 0x27, 0x23, 0x0d, 0x00, 0x00,
-	0x20, 0x7b, 0x38, 0x02, 0x05, 0x84, 0x00, 0xf0,
-	0xbb, 0x7e, 0x5a, 0x00, 0x18, 0x04, 0x81, 0x00,
-	0x00, 0x00, 0x80, 0x10, 0x90, 0x1c, 0x01, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x10, 0x40, 0x00, 0x04,
-	0x08, 0xa0, 0x70, 0xa5, 0x0c, 0x40, 0x00, 0x00,
-	0x11, 0x04, 0x04, 0x68, 0x00, 0x20, 0x70, 0xff,
-	0x7b, 0x7f, 0x60, 0x00, 0x05, 0x9b, 0xdd, 0x66,
-	// Entry 280 - 2BF
-	0x03, 0x00, 0x11, 0x00, 0x00, 0x00, 0x40, 0x05,
-	0xb5, 0xb6, 0x80, 0x08, 0x04, 0x00, 0x04, 0x51,
-	0xe2, 0xef, 0xfd, 0x3f, 0x05, 0x09, 0x08, 0x05,
-	0x40, 0x00, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00,
-	0x08, 0x00, 0x00, 0x00, 0x00, 0x81, 0x00, 0x60,
-	0xe7, 0x48, 0x00, 0x81, 0x20, 0xc0, 0x05, 0x80,
-	0x03, 0x00, 0x00, 0x00, 0x8c, 0x50, 0x40, 0x04,
-	0x84, 0x47, 0x84, 0x40, 0x20, 0x10, 0x00, 0x20,
-	// Entry 2C0 - 2FF
-	0x02, 0x50, 0x80, 0x11, 0x00, 0x91, 0x6c, 0xe2,
-	0x50, 0x27, 0x1d, 0x11, 0x29, 0x06, 0x59, 0xe9,
-	0x33, 0x08, 0x00, 0x20, 0x04, 0x40, 0x10, 0x00,
-	0x00, 0x00, 0x50, 0x44, 0x92, 0x49, 0xd6, 0x5d,
-	0xa7, 0x81, 0x47, 0x97, 0xfb, 0x00, 0x10, 0x00,
-	0x08, 0x00, 0x80, 0x00, 0x40, 0x04, 0x00, 0x01,
-	0x02, 0x00, 0x01, 0x40, 0x80, 0x00, 0x00, 0x08,
-	0xd8, 0xeb, 0xf6, 0x39, 0xc4, 0x89, 0x12, 0x00,
-	// Entry 300 - 33F
-	0x00, 0x0c, 0x04, 0x01, 0x20, 0x20, 0xdd, 0xa0,
-	0x01, 0x00, 0x00, 0x00, 0x12, 0x00, 0x00, 0x00,
-	0x04, 0x10, 0xd0, 0x9d, 0x95, 0x13, 0x04, 0x80,
-	0x00, 0x01, 0xd0, 0x12, 0x40, 0x00, 0x10, 0xb0,
-	0x10, 0x62, 0x4c, 0xd2, 0x02, 0x01, 0x4a, 0x00,
-	0x46, 0x04, 0x00, 0x08, 0x02, 0x00, 0x20, 0x80,
-	0x00, 0x80, 0x06, 0x00, 0x08, 0x00, 0x00, 0x00,
-	0x00, 0xf0, 0xd8, 0x6f, 0x15, 0x02, 0x08, 0x00,
-	// Entry 340 - 37F
-	0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x10, 0x01,
-	0x00, 0x10, 0x00, 0x00, 0x00, 0xf0, 0x84, 0xe3,
-	0xdd, 0xbf, 0xf9, 0xf9, 0x3b, 0x7f, 0x7f, 0xdb,
-	0xfd, 0xfc, 0xfe, 0xdf, 0xff, 0xfd, 0xff, 0xf6,
-	0xfb, 0xfc, 0xf7, 0x1f, 0xff, 0xb3, 0x6c, 0xff,
-	0xd9, 0xad, 0xdf, 0xfe, 0xef, 0xba, 0xdf, 0xff,
-	0xff, 0xff, 0xb7, 0xdd, 0x7d, 0xbf, 0xab, 0x7f,
-	0xfd, 0xfd, 0xdf, 0x2f, 0x9c, 0xdf, 0xf3, 0x6f,
-	// Entry 380 - 3BF
-	0xdf, 0xdd, 0xff, 0xfb, 0xee, 0xd2, 0xab, 0x5f,
-	0xd5, 0xdf, 0x7f, 0xff, 0xeb, 0xff, 0xe4, 0x4d,
-	0xf9, 0xff, 0xfe, 0xf7, 0xfd, 0xdf, 0xfb, 0xbf,
-	0xee, 0xdb, 0x6f, 0xef, 0xff, 0x7f, 0xff, 0xff,
-	0xf7, 0x5f, 0xd3, 0x3b, 0xfd, 0xd9, 0xdf, 0xeb,
-	0xbc, 0x08, 0x05, 0x24, 0xff, 0x07, 0x70, 0xfe,
-	0xe6, 0x5e, 0x00, 0x08, 0x00, 0x83, 0x3d, 0x1b,
-	0x06, 0xe6, 0x72, 0x60, 0xd1, 0x3c, 0x7f, 0x44,
-	// Entry 3C0 - 3FF
-	0x02, 0x30, 0x9f, 0x7a, 0x16, 0xbd, 0x7f, 0x57,
-	0xf2, 0xff, 0x31, 0xff, 0xf2, 0x1e, 0x90, 0xf7,
-	0xf1, 0xf9, 0x45, 0x80, 0x01, 0x02, 0x00, 0x00,
-	0x40, 0x54, 0x9f, 0x8a, 0xd9, 0xd9, 0x0e, 0x11,
-	0x86, 0x51, 0xc0, 0xf3, 0xfb, 0x47, 0x00, 0x01,
-	0x05, 0xd1, 0x50, 0x58, 0x00, 0x00, 0x00, 0x10,
-	0x04, 0x02, 0x00, 0x00, 0x0a, 0x00, 0x17, 0xd2,
-	0xb9, 0xfd, 0xfc, 0xba, 0xfe, 0xef, 0xc7, 0xbe,
-	// Entry 400 - 43F
-	0x53, 0x6f, 0xdf, 0xe7, 0xdb, 0x65, 0xbb, 0x7f,
-	0xfa, 0xff, 0x77, 0xf3, 0xef, 0xbf, 0xfd, 0xf7,
-	0xdf, 0xdf, 0x9b, 0x7f, 0xff, 0xff, 0x7f, 0x6f,
-	0xf7, 0xfb, 0xeb, 0xdf, 0xbc, 0xff, 0xbf, 0x6b,
-	0x7b, 0xfb, 0xff, 0xce, 0x76, 0xbd, 0xf7, 0xf7,
-	0xdf, 0xdc, 0xf7, 0xf7, 0xff, 0xdf, 0xf3, 0xfe,
-	0xef, 0xff, 0xff, 0xff, 0xb6, 0x7f, 0x7f, 0xde,
-	0xf7, 0xb9, 0xeb, 0x77, 0xff, 0xfb, 0xbf, 0xdf,
-	// Entry 440 - 47F
-	0xfd, 0xfe, 0xfb, 0xff, 0xfe, 0xeb, 0x1f, 0x7d,
-	0x2f, 0xfd, 0xb6, 0xb5, 0xa5, 0xfc, 0xff, 0xfd,
-	0x7f, 0x4e, 0xbf, 0x8f, 0xae, 0xff, 0xee, 0xdf,
-	0x7f, 0xf7, 0x73, 0x02, 0x02, 0x04, 0xfc, 0xf7,
-	0xff, 0xb7, 0xd7, 0xef, 0xfe, 0xcd, 0xf5, 0xce,
-	0xe2, 0x8e, 0xe7, 0xbf, 0xb7, 0xff, 0x56, 0xbd,
-	0xcd, 0xff, 0xfb, 0xff, 0xdf, 0xd7, 0xea, 0xff,
-	0xe5, 0x5f, 0x6d, 0x0f, 0xa7, 0x51, 0x06, 0xc4,
-	// Entry 480 - 4BF
-	0x13, 0x50, 0x5d, 0xaf, 0xa6, 0xfd, 0x99, 0xfb,
-	0x63, 0x1d, 0x53, 0xff, 0xef, 0xb7, 0x35, 0x20,
-	0x14, 0x00, 0x55, 0x51, 0x82, 0x65, 0xf5, 0x41,
-	0xe2, 0xff, 0xfc, 0xdf, 0x00, 0x05, 0xc5, 0x05,
-	0x00, 0x22, 0x00, 0x74, 0x69, 0x10, 0x08, 0x04,
-	0x41, 0x00, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x51, 0x20, 0x05, 0x04, 0x01, 0x00, 0x00,
-	0x06, 0x01, 0x20, 0x00, 0x18, 0x01, 0x92, 0xb1,
-	// Entry 4C0 - 4FF
-	0xfd, 0x47, 0x49, 0x06, 0x95, 0x06, 0x57, 0xed,
-	0xfb, 0x4c, 0x1c, 0x6b, 0x83, 0x04, 0x62, 0x40,
-	0x00, 0x11, 0x42, 0x00, 0x00, 0x00, 0x54, 0x83,
-	0xb8, 0x4f, 0x10, 0x8c, 0x89, 0x46, 0xde, 0xf7,
-	0x13, 0x31, 0x00, 0x20, 0x00, 0x00, 0x00, 0x90,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x0a, 0x10, 0x00,
-	0x01, 0x00, 0x00, 0xf0, 0x5b, 0xf4, 0xbe, 0x3d,
-	0xba, 0xcf, 0xf7, 0xaf, 0x42, 0x04, 0x84, 0x41,
-	// Entry 500 - 53F
-	0x30, 0xff, 0x79, 0x72, 0x04, 0x00, 0x00, 0x49,
-	0x2d, 0x14, 0x27, 0x57, 0xed, 0xf1, 0x3f, 0xe7,
-	0x3f, 0x00, 0x00, 0x02, 0xc6, 0xa0, 0x1e, 0xf8,
-	0xbb, 0xff, 0xfd, 0xfb, 0xb7, 0xfd, 0xe5, 0xf7,
-	0xfd, 0xfc, 0xd5, 0xed, 0x47, 0xf4, 0x7e, 0x10,
-	0x01, 0x01, 0x84, 0x6d, 0xff, 0xf7, 0xdd, 0xf9,
-	0x5b, 0x05, 0x86, 0xed, 0xf5, 0x77, 0xbd, 0x3c,
-	0x00, 0x00, 0x00, 0x42, 0x71, 0x42, 0x00, 0x40,
-	// Entry 540 - 57F
-	0x00, 0x00, 0x01, 0x43, 0x19, 0x00, 0x08, 0x00,
-	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
-	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
-	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
-	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
-	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
-	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
-	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
-	// Entry 580 - 5BF
-	0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff,
-	0xff, 0xab, 0xbd, 0xe7, 0x57, 0xee, 0x13, 0x5d,
-	0x09, 0xc1, 0x40, 0x21, 0xfa, 0x17, 0x01, 0x80,
-	0x00, 0x00, 0x00, 0x00, 0xf0, 0xce, 0xfb, 0xbf,
-	0x00, 0x23, 0x00, 0x00, 0x00, 0x00, 0x08, 0x00,
-	0x00, 0x30, 0x15, 0xa3, 0x10, 0x00, 0x00, 0x00,
-	0x11, 0x04, 0x16, 0x00, 0x00, 0x02, 0x00, 0x81,
-	0xa3, 0x01, 0x50, 0x00, 0x00, 0x83, 0x11, 0x40,
-	// Entry 5C0 - 5FF
-	0x00, 0x00, 0x00, 0xf0, 0xdd, 0x7b, 0x3e, 0x02,
-	0xaa, 0x10, 0x5d, 0x98, 0x52, 0x00, 0x80, 0x20,
-	0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x02, 0x02,
-	0x19, 0x00, 0x10, 0x02, 0x10, 0x61, 0x5a, 0x9d,
-	0x31, 0x00, 0x00, 0x00, 0x01, 0x10, 0x02, 0x20,
-	0x00, 0x00, 0x01, 0x00, 0x42, 0x00, 0x20, 0x00,
-	0x00, 0x1f, 0xdf, 0xd2, 0xb9, 0xff, 0xfd, 0x3f,
-	0x1f, 0x98, 0xcf, 0x9c, 0xbf, 0xaf, 0x5f, 0xfe,
-	// Entry 600 - 63F
-	0x7b, 0x4b, 0x40, 0x10, 0xe1, 0xfd, 0xaf, 0xd9,
-	0xb7, 0xf6, 0xfb, 0xb3, 0xc7, 0xff, 0x6f, 0xf1,
-	0x73, 0xb1, 0x7f, 0x9f, 0x7f, 0xbd, 0xfc, 0xb7,
-	0xee, 0x1c, 0xfa, 0xcb, 0xef, 0xdd, 0xf9, 0xbd,
-	0x6e, 0xae, 0x55, 0xfd, 0x6e, 0x81, 0x76, 0x1f,
-	0xd4, 0x77, 0xf5, 0x7d, 0xfb, 0xff, 0xeb, 0xfe,
-	0xbe, 0x5f, 0x46, 0x1b, 0xe9, 0x5f, 0x50, 0x18,
-	0x02, 0xfa, 0xf7, 0x9d, 0x15, 0x97, 0x05, 0x0f,
-	// Entry 640 - 67F
-	0x75, 0xc4, 0x7d, 0x81, 0x92, 0xf1, 0x57, 0x6c,
-	0xff, 0xe4, 0xef, 0x6f, 0xff, 0xfc, 0xdd, 0xde,
-	0xfc, 0xfd, 0x76, 0x5f, 0x7a, 0x1f, 0x00, 0x98,
-	0x02, 0xfb, 0xa3, 0xef, 0xf3, 0xd6, 0xf2, 0xff,
-	0xb9, 0xda, 0x7d, 0x50, 0x1e, 0x15, 0x7b, 0xb4,
-	0xf5, 0x3e, 0xff, 0xff, 0xf1, 0xf7, 0xff, 0xe7,
-	0x5f, 0xff, 0xff, 0x9e, 0xdb, 0xf6, 0xd7, 0xb9,
-	0xef, 0x27, 0x80, 0xbb, 0xc5, 0xff, 0xff, 0xe3,
-	// Entry 680 - 6BF
-	0x97, 0x9d, 0xbf, 0x9f, 0xf7, 0xc7, 0xfd, 0x37,
-	0xce, 0x7f, 0x04, 0x1d, 0x53, 0x7f, 0xf8, 0xda,
-	0x5d, 0xce, 0x7d, 0x06, 0xb9, 0xea, 0x69, 0xa0,
-	0x1a, 0x20, 0x00, 0x30, 0x02, 0x04, 0x24, 0x08,
-	0x04, 0x00, 0x00, 0x40, 0xd4, 0x02, 0x04, 0x00,
-	0x00, 0x04, 0x00, 0x04, 0x00, 0x20, 0x01, 0x06,
-	0x50, 0x00, 0x08, 0x00, 0x00, 0x00, 0x24, 0x00,
-	0x04, 0x00, 0x10, 0xcc, 0x58, 0xd5, 0x0d, 0x0f,
-	// Entry 6C0 - 6FF
-	0x14, 0x4d, 0xf1, 0x16, 0x44, 0xd1, 0x42, 0x08,
-	0x40, 0x00, 0x00, 0x40, 0x00, 0x08, 0x00, 0x00,
-	0x00, 0xdc, 0xfb, 0xcb, 0x0e, 0x58, 0x08, 0x41,
-	0x04, 0x20, 0x04, 0x00, 0x30, 0x12, 0x40, 0x00,
-	0x00, 0x10, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x01, 0x00, 0x00, 0x00, 0x80, 0x10, 0x10, 0xab,
-	0x6d, 0x93, 0x00, 0x01, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x80, 0x80, 0x25, 0x00, 0x00,
-	// Entry 700 - 73F
-	0x00, 0x00, 0x00, 0x00, 0x0a, 0x00, 0x00, 0x00,
-	0x80, 0x86, 0xc2, 0x00, 0x00, 0x00, 0x00, 0x01,
-	0xdf, 0x18, 0x00, 0x00, 0x02, 0xf0, 0xfd, 0x79,
-	0x3b, 0x00, 0x25, 0x00, 0x00, 0x00, 0x02, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x00,
-	0x03, 0x00, 0x09, 0x20, 0x00, 0x00, 0x01, 0x00,
-	0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x01, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	// Entry 740 - 77F
-	0x00, 0x00, 0x00, 0xef, 0xd5, 0xfd, 0xcf, 0x7e,
-	0xb0, 0x11, 0x00, 0x00, 0x00, 0x92, 0x01, 0x44,
-	0xcd, 0xf9, 0x5c, 0x00, 0x01, 0x00, 0x30, 0x04,
-	0x04, 0x55, 0x00, 0x01, 0x04, 0xf4, 0x3f, 0x4a,
-	0x01, 0x00, 0x00, 0xb0, 0x80, 0x00, 0x55, 0x55,
-	0x97, 0x7c, 0x9f, 0x31, 0xcc, 0x68, 0xd1, 0x03,
-	0xd5, 0x57, 0x27, 0x14, 0x01, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x2c, 0xf7, 0xcb, 0x1f, 0x14, 0x60,
-	// Entry 780 - 7BF
-	0x03, 0x68, 0x01, 0x10, 0x8b, 0x38, 0x8a, 0x01,
-	0x00, 0x00, 0x20, 0x00, 0x24, 0x44, 0x00, 0x00,
-	0x10, 0x03, 0x11, 0x02, 0x01, 0x00, 0x00, 0xf0,
-	0xf5, 0xff, 0xd5, 0x97, 0xbc, 0x70, 0xd6, 0x78,
-	0x78, 0x15, 0x50, 0x01, 0xa4, 0x84, 0xa9, 0x41,
-	0x00, 0x00, 0x00, 0x6b, 0x39, 0x52, 0x74, 0x00,
-	0xe8, 0x30, 0x90, 0x6a, 0x92, 0x00, 0x00, 0x02,
-	0xff, 0xef, 0xff, 0x4b, 0x85, 0x53, 0xf4, 0xed,
-	// Entry 7C0 - 7FF
-	0xdd, 0xbf, 0x72, 0x19, 0xc7, 0x0c, 0xd5, 0x42,
-	0x54, 0xdd, 0x77, 0x14, 0x00, 0x80, 0x40, 0x56,
-	0xcc, 0x16, 0x9e, 0xea, 0x35, 0x7d, 0xef, 0xff,
-	0xbd, 0xa4, 0xaf, 0x01, 0x44, 0x18, 0x01, 0x4d,
-	0x4e, 0x4a, 0x08, 0x50, 0x28, 0x30, 0xe0, 0x80,
-	0x10, 0x20, 0x24, 0x00, 0xff, 0x2f, 0xd3, 0x60,
-	0xfe, 0x01, 0x02, 0x88, 0x0a, 0x40, 0x16, 0x01,
-	0x01, 0x15, 0x2b, 0x3c, 0x01, 0x00, 0x00, 0x10,
-	// Entry 800 - 83F
-	0x90, 0x49, 0x41, 0x02, 0x02, 0x01, 0xe1, 0xbf,
-	0xbf, 0x03, 0x00, 0x00, 0x10, 0xd4, 0xa3, 0xd1,
-	0x40, 0x9c, 0x44, 0xdf, 0xf5, 0x8f, 0x66, 0xb3,
-	0x55, 0x20, 0xd4, 0xc1, 0xd8, 0x30, 0x3d, 0x80,
-	0x00, 0x00, 0x00, 0x04, 0xd4, 0x11, 0xc5, 0x84,
-	0x2e, 0x50, 0x00, 0x22, 0x50, 0x6e, 0xbd, 0x93,
-	0x07, 0x00, 0x20, 0x10, 0x84, 0xb2, 0x45, 0x10,
-	0x06, 0x44, 0x00, 0x00, 0x12, 0x02, 0x11, 0x00,
-	// Entry 840 - 87F
-	0xf0, 0xfb, 0xfd, 0x3f, 0x05, 0x00, 0x12, 0x81,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x02,
-	0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x02, 0x28,
-	0x84, 0x00, 0x21, 0xc0, 0x23, 0x24, 0x00, 0x00,
-	0x00, 0xcb, 0xe4, 0x3a, 0x42, 0x88, 0x14, 0xf1,
-	0xef, 0xff, 0x7f, 0x12, 0x01, 0x01, 0x84, 0x50,
-	0x07, 0xfc, 0xff, 0xff, 0x0f, 0x01, 0x00, 0x40,
-	0x10, 0x38, 0x01, 0x01, 0x1c, 0x12, 0x40, 0xe1,
-	// Entry 880 - 8BF
-	0x76, 0x16, 0x08, 0x03, 0x10, 0x00, 0x00, 0x00,
-	0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x24,
-	0x0a, 0x00, 0x80, 0x00, 0x00,
-}
-
-// altLangISO3 holds an alphabetically sorted list of 3-letter language code alternatives
-// to 2-letter language codes that cannot be derived using the method described above.
-// Each 3-letter code is followed by its 1-byte langID.
-const altLangISO3 tag.Index = "---\x00cor\x00hbs\x01heb\x02kin\x03spa\x04yid\x05\xff\xff\xff\xff"
-
-// altLangIndex is used to convert indexes in altLangISO3 to langIDs.
-// Size: 12 bytes, 6 elements
-var altLangIndex = [6]uint16{
-	0x0281, 0x0407, 0x01fb, 0x03e5, 0x013e, 0x0208,
-}
-
-// langAliasMap maps langIDs to their suggested replacements.
-// Size: 656 bytes, 164 elements
-var langAliasMap = [164]fromTo{
-	0:   {from: 0x82, to: 0x88},
-	1:   {from: 0x187, to: 0x1ae},
-	2:   {from: 0x1f3, to: 0x1e1},
-	3:   {from: 0x1fb, to: 0x1bc},
-	4:   {from: 0x208, to: 0x512},
-	5:   {from: 0x20f, to: 0x20e},
-	6:   {from: 0x310, to: 0x3dc},
-	7:   {from: 0x347, to: 0x36f},
-	8:   {from: 0x407, to: 0x432},
-	9:   {from: 0x47a, to: 0x153},
-	10:  {from: 0x490, to: 0x451},
-	11:  {from: 0x4a2, to: 0x21},
-	12:  {from: 0x53e, to: 0x544},
-	13:  {from: 0x58f, to: 0x12d},
-	14:  {from: 0x630, to: 0x1eb1},
-	15:  {from: 0x651, to: 0x431},
-	16:  {from: 0x662, to: 0x431},
-	17:  {from: 0x6ed, to: 0x3a},
-	18:  {from: 0x6f8, to: 0x1d7},
-	19:  {from: 0x73e, to: 0x21a1},
-	20:  {from: 0x7b3, to: 0x56},
-	21:  {from: 0x7b9, to: 0x299b},
-	22:  {from: 0x7c5, to: 0x58},
-	23:  {from: 0x7e6, to: 0x145},
-	24:  {from: 0x80c, to: 0x5a},
-	25:  {from: 0x815, to: 0x8d},
-	26:  {from: 0x87e, to: 0x810},
-	27:  {from: 0x8c3, to: 0xee3},
-	28:  {from: 0x9ef, to: 0x331},
-	29:  {from: 0xa36, to: 0x2c5},
-	30:  {from: 0xa3d, to: 0xbf},
-	31:  {from: 0xabe, to: 0x3322},
-	32:  {from: 0xb38, to: 0x529},
-	33:  {from: 0xb75, to: 0x265a},
-	34:  {from: 0xb7e, to: 0xbc3},
-	35:  {from: 0xb9b, to: 0x44e},
-	36:  {from: 0xbbc, to: 0x4229},
-	37:  {from: 0xbbf, to: 0x529},
-	38:  {from: 0xbfe, to: 0x2da7},
-	39:  {from: 0xc2e, to: 0x3181},
-	40:  {from: 0xcb9, to: 0xf3},
-	41:  {from: 0xd08, to: 0xfa},
-	42:  {from: 0xdc8, to: 0x11a},
-	43:  {from: 0xdd7, to: 0x32d},
-	44:  {from: 0xdf8, to: 0xdfb},
-	45:  {from: 0xdfe, to: 0x531},
-	46:  {from: 0xedf, to: 0x205a},
-	47:  {from: 0xeee, to: 0x2e9a},
-	48:  {from: 0xf39, to: 0x367},
-	49:  {from: 0x10d0, to: 0x140},
-	50:  {from: 0x1104, to: 0x2d0},
-	51:  {from: 0x11a0, to: 0x1ec},
-	52:  {from: 0x1279, to: 0x21},
-	53:  {from: 0x1424, to: 0x15e},
-	54:  {from: 0x1470, to: 0x14e},
-	55:  {from: 0x151f, to: 0xd9b},
-	56:  {from: 0x1523, to: 0x390},
-	57:  {from: 0x1532, to: 0x19f},
-	58:  {from: 0x1580, to: 0x210},
-	59:  {from: 0x1583, to: 0x10d},
-	60:  {from: 0x15a3, to: 0x3caf},
-	61:  {from: 0x166a, to: 0x19b},
-	62:  {from: 0x16c8, to: 0x136},
-	63:  {from: 0x1700, to: 0x29f8},
-	64:  {from: 0x1718, to: 0x194},
-	65:  {from: 0x1727, to: 0xf3f},
-	66:  {from: 0x177a, to: 0x178},
-	67:  {from: 0x1809, to: 0x17b6},
-	68:  {from: 0x1816, to: 0x18f3},
-	69:  {from: 0x188a, to: 0x436},
-	70:  {from: 0x1979, to: 0x1d01},
-	71:  {from: 0x1a74, to: 0x2bb0},
-	72:  {from: 0x1a8a, to: 0x1f8},
-	73:  {from: 0x1b5a, to: 0x1fa},
-	74:  {from: 0x1b86, to: 0x1515},
-	75:  {from: 0x1d64, to: 0x2c9b},
-	76:  {from: 0x2038, to: 0x37b1},
-	77:  {from: 0x203d, to: 0x20dd},
-	78:  {from: 0x205a, to: 0x30b},
-	79:  {from: 0x20e3, to: 0x274},
-	80:  {from: 0x20ee, to: 0x263},
-	81:  {from: 0x20f2, to: 0x22d},
-	82:  {from: 0x20f9, to: 0x256},
-	83:  {from: 0x210f, to: 0x21eb},
-	84:  {from: 0x2135, to: 0x27d},
-	85:  {from: 0x2160, to: 0x913},
-	86:  {from: 0x2199, to: 0x121},
-	87:  {from: 0x21ce, to: 0x1561},
-	88:  {from: 0x21e6, to: 0x504},
-	89:  {from: 0x21f4, to: 0x49f},
-	90:  {from: 0x222d, to: 0x121},
-	91:  {from: 0x2237, to: 0x121},
-	92:  {from: 0x2262, to: 0x92a},
-	93:  {from: 0x2316, to: 0x3226},
-	94:  {from: 0x2382, to: 0x3365},
-	95:  {from: 0x2472, to: 0x2c7},
-	96:  {from: 0x24e4, to: 0x2ff},
-	97:  {from: 0x24f0, to: 0x2fa},
-	98:  {from: 0x24fa, to: 0x31f},
-	99:  {from: 0x2550, to: 0xb5b},
-	100: {from: 0x25a9, to: 0xe2},
-	101: {from: 0x263e, to: 0x2d0},
-	102: {from: 0x26c9, to: 0x26b4},
-	103: {from: 0x26f9, to: 0x3c8},
-	104: {from: 0x2727, to: 0x3caf},
-	105: {from: 0x2765, to: 0x26b4},
-	106: {from: 0x2789, to: 0x4358},
-	107: {from: 0x28ef, to: 0x2837},
-	108: {from: 0x2914, to: 0x351},
-	109: {from: 0x2986, to: 0x2da7},
-	110: {from: 0x2b1a, to: 0x38d},
-	111: {from: 0x2bfc, to: 0x395},
-	112: {from: 0x2c3f, to: 0x3caf},
-	113: {from: 0x2cfc, to: 0x3be},
-	114: {from: 0x2d13, to: 0x597},
-	115: {from: 0x2d47, to: 0x148},
-	116: {from: 0x2d48, to: 0x148},
-	117: {from: 0x2dff, to: 0x2f1},
-	118: {from: 0x2e08, to: 0x19cc},
-	119: {from: 0x2e1a, to: 0x2d95},
-	120: {from: 0x2e21, to: 0x292},
-	121: {from: 0x2e54, to: 0x7d},
-	122: {from: 0x2e65, to: 0x2282},
-	123: {from: 0x2ea0, to: 0x2e9b},
-	124: {from: 0x2eef, to: 0x2ed7},
-	125: {from: 0x3193, to: 0x3c4},
-	126: {from: 0x3366, to: 0x338e},
-	127: {from: 0x342a, to: 0x3dc},
-	128: {from: 0x34ee, to: 0x18d0},
-	129: {from: 0x35c8, to: 0x2c9b},
-	130: {from: 0x35e6, to: 0x412},
-	131: {from: 0x3658, to: 0x246},
-	132: {from: 0x3676, to: 0x3f4},
-	133: {from: 0x36fd, to: 0x445},
-	134: {from: 0x37c0, to: 0x121},
-	135: {from: 0x3816, to: 0x38f2},
-	136: {from: 0x382b, to: 0x2c9b},
-	137: {from: 0x382f, to: 0xa9},
-	138: {from: 0x3832, to: 0x3228},
-	139: {from: 0x386c, to: 0x39a6},
-	140: {from: 0x3892, to: 0x3fc0},
-	141: {from: 0x38a5, to: 0x39d7},
-	142: {from: 0x38b4, to: 0x1fa4},
-	143: {from: 0x38b5, to: 0x2e9a},
-	144: {from: 0x395c, to: 0x47e},
-	145: {from: 0x3b4e, to: 0xd91},
-	146: {from: 0x3b78, to: 0x137},
-	147: {from: 0x3c99, to: 0x4bc},
-	148: {from: 0x3fbd, to: 0x100},
-	149: {from: 0x4208, to: 0xa91},
-	150: {from: 0x42be, to: 0x573},
-	151: {from: 0x42f9, to: 0x3f60},
-	152: {from: 0x4378, to: 0x25a},
-	153: {from: 0x43cb, to: 0x36cb},
-	154: {from: 0x43cd, to: 0x10f},
-	155: {from: 0x44af, to: 0x3322},
-	156: {from: 0x44e3, to: 0x512},
-	157: {from: 0x45ca, to: 0x2409},
-	158: {from: 0x45dd, to: 0x26dc},
-	159: {from: 0x4610, to: 0x48ae},
-	160: {from: 0x46ae, to: 0x46a0},
-	161: {from: 0x473e, to: 0x4745},
-	162: {from: 0x4916, to: 0x31f},
-	163: {from: 0x49a7, to: 0x523},
-}
-
-// Size: 164 bytes, 164 elements
-var langAliasTypes = [164]langAliasType{
-	// Entry 0 - 3F
-	1, 0, 0, 0, 0, 0, 0, 1, 2, 2, 0, 1, 0, 0, 1, 2,
-	1, 1, 2, 0, 1, 0, 1, 2, 1, 1, 0, 0, 2, 1, 1, 0,
-	2, 0, 0, 1, 0, 1, 0, 0, 1, 2, 1, 1, 1, 1, 0, 0,
-	2, 1, 1, 1, 1, 2, 1, 0, 1, 1, 2, 2, 0, 1, 2, 0,
-	// Entry 40 - 7F
-	1, 0, 1, 1, 1, 1, 0, 0, 2, 1, 0, 0, 0, 0, 1, 1,
-	1, 1, 1, 0, 1, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 1,
-	2, 2, 2, 0, 1, 1, 0, 1, 0, 0, 0, 0, 1, 0, 1, 1,
-	0, 1, 0, 2, 1, 1, 0, 0, 1, 0, 0, 0, 0, 1, 1, 2,
-	// Entry 80 - BF
-	0, 0, 2, 1, 1, 1, 0, 0, 0, 2, 0, 0, 0, 0, 0, 0,
-	1, 1, 0, 1, 2, 0, 0, 0, 1, 0, 1, 0, 1, 0, 0, 0,
-	0, 1, 1, 1,
-}
-
-const (
-	_Latn = 87
-	_Hani = 54
-	_Hans = 56
-	_Hant = 57
-	_Qaaa = 139
-	_Qaai = 147
-	_Qabx = 188
-	_Zinh = 236
-	_Zyyy = 241
-	_Zzzz = 242
-)
-
-// script is an alphabetically sorted list of ISO 15924 codes. The index
-// of the script in the string, divided by 4, is the internal scriptID.
-const script tag.Index = "" + // Size: 976 bytes
-	"----AdlmAfakAghbAhomArabAranArmiArmnAvstBaliBamuBassBatkBengBhksBlisBopo" +
-	"BrahBraiBugiBuhdCakmCansCariChamCherCirtCoptCpmnCprtCyrlCyrsDevaDogrDsrt" +
-	"DuplEgydEgyhEgypElbaEthiGeokGeorGlagGongGonmGothGranGrekGujrGuruHanbHang" +
-	"HaniHanoHansHantHatrHebrHiraHluwHmngHmnpHrktHungIndsItalJamoJavaJpanJurc" +
-	"KaliKanaKharKhmrKhojKitlKitsKndaKoreKpelKthiLanaLaooLatfLatgLatnLekeLepc" +
-	"LimbLinaLinbLisuLomaLyciLydiMahjMakaMandManiMarcMayaMedfMendMercMeroMlym" +
-	"ModiMongMoonMrooMteiMultMymrNarbNbatNewaNkdbNkgbNkooNshuOgamOlckOrkhOrya" +
-	"OsgeOsmaPalmPaucPermPhagPhliPhlpPhlvPhnxPiqdPlrdPrtiQaaaQaabQaacQaadQaae" +
-	"QaafQaagQaahQaaiQaajQaakQaalQaamQaanQaaoQaapQaaqQaarQaasQaatQaauQaavQaaw" +
-	"QaaxQaayQaazQabaQabbQabcQabdQabeQabfQabgQabhQabiQabjQabkQablQabmQabnQabo" +
-	"QabpQabqQabrQabsQabtQabuQabvQabwQabxRjngRoroRunrSamrSaraSarbSaurSgnwShaw" +
-	"ShrdShuiSiddSindSinhSoraSoyoSundSyloSyrcSyreSyrjSyrnTagbTakrTaleTaluTaml" +
-	"TangTavtTeluTengTfngTglgThaaThaiTibtTirhUgarVaiiVispWaraWchoWoleXpeoXsux" +
-	"YiiiZanbZinhZmthZsyeZsymZxxxZyyyZzzz\xff\xff\xff\xff"
-
-// suppressScript is an index from langID to the dominant script for that language,
-// if it exists.  If a script is given, it should be suppressed from the language tag.
-// Size: 1330 bytes, 1330 elements
-var suppressScript = [1330]uint8{
-	// Entry 0 - 3F
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x1f, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x29,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00, 0x00,
-	// Entry 40 - 7F
-	0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x1f, 0x00,
-	// Entry 80 - BF
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	// Entry C0 - FF
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00,
-	// Entry 100 - 13F
-	0x57, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0xde, 0x00, 0x00, 0x00, 0x00, 0xe0, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x31, 0x00,
-	0x00, 0x57, 0x00, 0x00, 0x57, 0x00, 0x57, 0x00,
-	// Entry 140 - 17F
-	0x57, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00,
-	0x05, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00,
-	0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00,
-	0x00, 0x57, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x57, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	// Entry 180 - 1BF
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x57, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x57, 0x32, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x3b, 0x00, 0x21, 0x00,
-	// Entry 1C0 - 1FF
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x57, 0x57, 0x00, 0x57, 0x57, 0x00, 0x08,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00,
-	0x57, 0x57, 0x00, 0x3b, 0x00, 0x00, 0x00, 0x00,
-	// Entry 200 - 23F
-	0x46, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x2b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	// Entry 240 - 27F
-	0x00, 0x00, 0x1f, 0x00, 0x00, 0x57, 0x00, 0x00,
-	0x00, 0x00, 0x4b, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x4f, 0x00, 0x00, 0x50, 0x00, 0x21, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	// Entry 280 - 2BF
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00,
-	0x54, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	// Entry 2C0 - 2FF
-	0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x21, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x1f,
-	// Entry 300 - 33F
-	0x00, 0x00, 0x00, 0x00, 0x6b, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x21, 0x00, 0x00, 0x00, 0x57,
-	0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x72, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00,
-	// Entry 340 - 37F
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00,
-	0x57, 0x21, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
-	0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x57,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x78, 0x57, 0x00,
-	0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00,
-	// Entry 380 - 3BF
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x57, 0x00, 0x00, 0x00, 0x00, 0x7d, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x33, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x05, 0x00,
-	// Entry 3C0 - 3FF
-	0x57, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00,
-	0x00, 0x57, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x1f, 0x00, 0x00, 0x57, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	// Entry 400 - 43F
-	0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0xca, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00,
-	0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
-	0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00,
-	// Entry 440 - 47F
-	0x00, 0x00, 0x00, 0x00, 0x57, 0x57, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0xd7, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0xda, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0xdf, 0x00, 0x00, 0x00, 0x29,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
-	0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00,
-	// Entry 480 - 4BF
-	0x57, 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00,
-	0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x1f, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x05, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	// Entry 4C0 - 4FF
-	0x57, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	// Entry 500 - 53F
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x3b, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57,
-	0x00, 0x00,
-}
-
-const (
-	_001 = 1
-	_419 = 31
-	_BR  = 65
-	_CA  = 73
-	_ES  = 110
-	_GB  = 123
-	_MD  = 188
-	_PT  = 238
-	_UK  = 306
-	_US  = 309
-	_ZZ  = 357
-	_XA  = 323
-	_XC  = 325
-	_XK  = 333
-)
-
-// isoRegionOffset needs to be added to the index of regionISO to obtain the regionID
-// for 2-letter ISO codes. (The first isoRegionOffset regionIDs are reserved for
-// the UN.M49 codes used for groups.)
-const isoRegionOffset = 32
-
-// regionTypes defines the status of a region for various standards.
-// Size: 358 bytes, 358 elements
-var regionTypes = [358]uint8{
-	// Entry 0 - 3F
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x05, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	// Entry 40 - 7F
-	0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x04,
-	0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04,
-	0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06,
-	0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00,
-	0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	// Entry 80 - BF
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x00, 0x04, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	// Entry C0 - FF
-	0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00,
-	0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x04, 0x06,
-	0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00,
-	0x06, 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05,
-	0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05,
-	// Entry 100 - 13F
-	0x05, 0x05, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x02, 0x06, 0x04, 0x06, 0x06, 0x06,
-	0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06,
-	// Entry 140 - 17F
-	0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, 0x05,
-	0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05,
-	0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05,
-	0x05, 0x05, 0x05, 0x05, 0x05, 0x04, 0x06, 0x06,
-	0x04, 0x06, 0x06, 0x04, 0x06, 0x05,
-}
-
-// regionISO holds a list of alphabetically sorted 2-letter ISO region codes.
-// Each 2-letter codes is followed by two bytes with the following meaning:
-//     - [A-Z}{2}: the first letter of the 2-letter code plus these two
-//                 letters form the 3-letter ISO code.
-//     - 0, n:     index into altRegionISO3.
-const regionISO tag.Index = "" + // Size: 1308 bytes
-	"AAAAACSCADNDAEREAFFGAGTGAIIAALLBAMRMANNTAOGOAQTAARRGASSMATUTAUUSAWBWAXLA" +
-	"AZZEBAIHBBRBBDGDBEELBFFABGGRBHHRBIDIBJENBLLMBMMUBNRNBOOLBQESBRRABSHSBTTN" +
-	"BUURBVVTBWWABYLRBZLZCAANCCCKCDODCFAFCGOGCHHECIIVCKOKCLHLCMMRCNHNCOOLCPPT" +
-	"CRRICS\x00\x00CTTECUUBCVPVCWUWCXXRCYYPCZZEDDDRDEEUDGGADJJIDKNKDMMADOOMDY" +
-	"HYDZZAEA  ECCUEESTEGGYEHSHERRIESSPETTHEU\x00\x03EZ  FIINFJJIFKLKFMSMFORO" +
-	"FQ\x00\x18FRRAFXXXGAABGBBRGDRDGEEOGFUFGGGYGHHAGIIBGLRLGMMBGNINGPLPGQNQGR" +
-	"RCGS\x00\x06GTTMGUUMGWNBGYUYHKKGHMMDHNNDHRRVHTTIHUUNHVVOIC  IDDNIERLILSR" +
-	"IMMNINNDIOOTIQRQIRRNISSLITTAJEEYJMAMJOORJPPNJTTNKEENKGGZKHHMKIIRKM\x00" +
-	"\x09KNNAKP\x00\x0cKRORKWWTKY\x00\x0fKZAZLAAOLBBNLCCALIIELKKALRBRLSSOLTTU" +
-	"LUUXLVVALYBYMAARMCCOMDDAMENEMFAFMGDGMHHLMIIDMKKDMLLIMMMRMNNGMOACMPNPMQTQ" +
-	"MRRTMSSRMTLTMUUSMVDVMWWIMXEXMYYSMZOZNAAMNCCLNEERNFFKNGGANHHBNIICNLLDNOOR" +
-	"NPPLNQ\x00\x1eNRRUNTTZNUIUNZZLOMMNPAANPCCIPEERPFYFPGNGPHHLPKAKPLOLPM\x00" +
-	"\x12PNCNPRRIPSSEPTRTPUUSPWLWPYRYPZCZQAATQMMMQNNNQOOOQPPPQQQQQRRRQSSSQTTT" +
-	"QU\x00\x03QVVVQWWWQXXXQYYYQZZZREEURHHOROOURS\x00\x15RUUSRWWASAAUSBLBSCYC" +
-	"SDDNSEWESGGPSHHNSIVNSJJMSKVKSLLESMMRSNENSOOMSRURSSSDSTTPSUUNSVLVSXXMSYYR" +
-	"SZWZTAAATCCATDCDTF\x00\x18TGGOTHHATJJKTKKLTLLSTMKMTNUNTOONTPMPTRURTTTOTV" +
-	"UVTWWNTZZAUAKRUGGAUK  UMMIUN  USSAUYRYUZZBVAATVCCTVDDRVEENVGGBVIIRVNNMVU" +
-	"UTWFLFWKAKWSSMXAAAXBBBXCCCXDDDXEEEXFFFXGGGXHHHXIIIXJJJXKKKXLLLXMMMXNNNXO" +
-	"OOXPPPXQQQXRRRXSSSXTTTXUUUXVVVXWWWXXXXXYYYXZZZYDMDYEEMYT\x00\x1bYUUGZAAF" +
-	"ZMMBZRARZWWEZZZZ\xff\xff\xff\xff"
-
-// altRegionISO3 holds a list of 3-letter region codes that cannot be
-// mapped to 2-letter codes using the default algorithm. This is a short list.
-const altRegionISO3 string = "SCGQUUSGSCOMPRKCYMSPMSRBATFMYTATN"
-
-// altRegionIDs holds a list of regionIDs the positions of which match those
-// of the 3-letter ISO codes in altRegionISO3.
-// Size: 22 bytes, 11 elements
-var altRegionIDs = [11]uint16{
-	0x0057, 0x0070, 0x0088, 0x00a8, 0x00aa, 0x00ad, 0x00ea, 0x0105,
-	0x0121, 0x015f, 0x00dc,
-}
-
-// Size: 80 bytes, 20 elements
-var regionOldMap = [20]fromTo{
-	0:  {from: 0x44, to: 0xc4},
-	1:  {from: 0x58, to: 0xa7},
-	2:  {from: 0x5f, to: 0x60},
-	3:  {from: 0x66, to: 0x3b},
-	4:  {from: 0x79, to: 0x78},
-	5:  {from: 0x93, to: 0x37},
-	6:  {from: 0xa3, to: 0x133},
-	7:  {from: 0xc1, to: 0x133},
-	8:  {from: 0xd7, to: 0x13f},
-	9:  {from: 0xdc, to: 0x2b},
-	10: {from: 0xef, to: 0x133},
-	11: {from: 0xf2, to: 0xe2},
-	12: {from: 0xfc, to: 0x70},
-	13: {from: 0x103, to: 0x164},
-	14: {from: 0x12a, to: 0x126},
-	15: {from: 0x132, to: 0x7b},
-	16: {from: 0x13a, to: 0x13e},
-	17: {from: 0x141, to: 0x133},
-	18: {from: 0x15d, to: 0x15e},
-	19: {from: 0x163, to: 0x4b},
-}
-
-// m49 maps regionIDs to UN.M49 codes. The first isoRegionOffset entries are
-// codes indicating collections of regions.
-// Size: 716 bytes, 358 elements
-var m49 = [358]int16{
-	// Entry 0 - 3F
-	0, 1, 2, 3, 5, 9, 11, 13,
-	14, 15, 17, 18, 19, 21, 29, 30,
-	34, 35, 39, 53, 54, 57, 61, 142,
-	143, 145, 150, 151, 154, 155, 202, 419,
-	958, 0, 20, 784, 4, 28, 660, 8,
-	51, 530, 24, 10, 32, 16, 40, 36,
-	533, 248, 31, 70, 52, 50, 56, 854,
-	100, 48, 108, 204, 652, 60, 96, 68,
-	// Entry 40 - 7F
-	535, 76, 44, 64, 104, 74, 72, 112,
-	84, 124, 166, 180, 140, 178, 756, 384,
-	184, 152, 120, 156, 170, 0, 188, 891,
-	296, 192, 132, 531, 162, 196, 203, 278,
-	276, 0, 262, 208, 212, 214, 204, 12,
-	0, 218, 233, 818, 732, 232, 724, 231,
-	967, 0, 246, 242, 238, 583, 234, 0,
-	250, 249, 266, 826, 308, 268, 254, 831,
-	// Entry 80 - BF
-	288, 292, 304, 270, 324, 312, 226, 300,
-	239, 320, 316, 624, 328, 344, 334, 340,
-	191, 332, 348, 854, 0, 360, 372, 376,
-	833, 356, 86, 368, 364, 352, 380, 832,
-	388, 400, 392, 581, 404, 417, 116, 296,
-	174, 659, 408, 410, 414, 136, 398, 418,
-	422, 662, 438, 144, 430, 426, 440, 442,
-	428, 434, 504, 492, 498, 499, 663, 450,
-	// Entry C0 - FF
-	584, 581, 807, 466, 104, 496, 446, 580,
-	474, 478, 500, 470, 480, 462, 454, 484,
-	458, 508, 516, 540, 562, 574, 566, 548,
-	558, 528, 578, 524, 10, 520, 536, 570,
-	554, 512, 591, 0, 604, 258, 598, 608,
-	586, 616, 666, 612, 630, 275, 620, 581,
-	585, 600, 591, 634, 959, 960, 961, 962,
-	963, 964, 965, 966, 967, 968, 969, 970,
-	// Entry 100 - 13F
-	971, 972, 638, 716, 642, 688, 643, 646,
-	682, 90, 690, 729, 752, 702, 654, 705,
-	744, 703, 694, 674, 686, 706, 740, 728,
-	678, 810, 222, 534, 760, 748, 0, 796,
-	148, 260, 768, 764, 762, 772, 626, 795,
-	788, 776, 626, 792, 780, 798, 158, 834,
-	804, 800, 826, 581, 0, 840, 858, 860,
-	336, 670, 704, 862, 92, 850, 704, 548,
-	// Entry 140 - 17F
-	876, 581, 882, 973, 974, 975, 976, 977,
-	978, 979, 980, 981, 982, 983, 984, 985,
-	986, 987, 988, 989, 990, 991, 992, 993,
-	994, 995, 996, 997, 998, 720, 887, 175,
-	891, 710, 894, 180, 716, 999,
-}
-
-// m49Index gives indexes into fromM49 based on the three most significant bits
-// of a 10-bit UN.M49 code. To search an UN.M49 code in fromM49, search in
-//    fromM49[m49Index[msb39(code)]:m49Index[msb3(code)+1]]
-// for an entry where the first 7 bits match the 7 lsb of the UN.M49 code.
-// The region code is stored in the 9 lsb of the indexed value.
-// Size: 18 bytes, 9 elements
-var m49Index = [9]int16{
-	0, 59, 108, 143, 181, 220, 259, 291,
-	333,
-}
-
-// fromM49 contains entries to map UN.M49 codes to regions. See m49Index for details.
-// Size: 666 bytes, 333 elements
-var fromM49 = [333]uint16{
-	// Entry 0 - 3F
-	0x0201, 0x0402, 0x0603, 0x0824, 0x0a04, 0x1027, 0x1205, 0x142b,
-	0x1606, 0x1867, 0x1a07, 0x1c08, 0x1e09, 0x202d, 0x220a, 0x240b,
-	0x260c, 0x2822, 0x2a0d, 0x302a, 0x3825, 0x3a0e, 0x3c0f, 0x3e32,
-	0x402c, 0x4410, 0x4611, 0x482f, 0x4e12, 0x502e, 0x5842, 0x6039,
-	0x6435, 0x6628, 0x6834, 0x6a13, 0x6c14, 0x7036, 0x7215, 0x783d,
-	0x7a16, 0x8043, 0x883f, 0x8c33, 0x9046, 0x9445, 0x9841, 0xa848,
-	0xac9a, 0xb509, 0xb93c, 0xc03e, 0xc838, 0xd0c4, 0xd83a, 0xe047,
-	0xe8a6, 0xf052, 0xf849, 0x085a, 0x10ad, 0x184c, 0x1c17, 0x1e18,
-	// Entry 40 - 7F
-	0x20b3, 0x2219, 0x2920, 0x2c1a, 0x2e1b, 0x3051, 0x341c, 0x361d,
-	0x3853, 0x3d2e, 0x445c, 0x4c4a, 0x5454, 0x5ca8, 0x5f5f, 0x644d,
-	0x684b, 0x7050, 0x7856, 0x7e90, 0x8059, 0x885d, 0x941e, 0x965e,
-	0x983b, 0xa063, 0xa864, 0xac65, 0xb469, 0xbd1a, 0xc486, 0xcc6f,
-	0xce6f, 0xd06d, 0xd26a, 0xd476, 0xdc74, 0xde88, 0xe473, 0xec72,
-	0xf031, 0xf279, 0xf478, 0xfc7e, 0x04e5, 0x0921, 0x0c62, 0x147a,
-	0x187d, 0x1c83, 0x26ed, 0x2860, 0x2c5f, 0x3060, 0x4080, 0x4881,
-	0x50a7, 0x5887, 0x6082, 0x687c, 0x7085, 0x788a, 0x8089, 0x8884,
-	// Entry 80 - BF
-	0x908c, 0x9891, 0x9c8e, 0xa138, 0xa88f, 0xb08d, 0xb892, 0xc09d,
-	0xc899, 0xd095, 0xd89c, 0xe09b, 0xe896, 0xf097, 0xf89e, 0x004f,
-	0x08a0, 0x10a2, 0x1cae, 0x20a1, 0x28a4, 0x30aa, 0x34ab, 0x3cac,
-	0x42a5, 0x44af, 0x461f, 0x4cb0, 0x54b5, 0x58b8, 0x5cb4, 0x64b9,
-	0x6cb2, 0x70b6, 0x74b7, 0x7cc6, 0x84bf, 0x8cce, 0x94d0, 0x9ccd,
-	0xa4c3, 0xaccb, 0xb4c8, 0xbcc9, 0xc0cc, 0xc8cf, 0xd8bb, 0xe0c5,
-	0xe4bc, 0xe6bd, 0xe8ca, 0xf0ba, 0xf8d1, 0x00e1, 0x08d2, 0x10dd,
-	0x18db, 0x20d9, 0x2429, 0x265b, 0x2a30, 0x2d1b, 0x2e40, 0x30de,
-	// Entry C0 - FF
-	0x38d3, 0x493f, 0x54e0, 0x5cd8, 0x64d4, 0x6cd6, 0x74df, 0x7cd5,
-	0x84da, 0x88c7, 0x8b33, 0x8e75, 0x90c0, 0x92f0, 0x94e8, 0x9ee2,
-	0xace6, 0xb0f1, 0xb8e4, 0xc0e7, 0xc8eb, 0xd0e9, 0xd8ee, 0xe08b,
-	0xe526, 0xecec, 0xf4f3, 0xfd02, 0x0504, 0x0706, 0x0d07, 0x183c,
-	0x1d0e, 0x26a9, 0x2826, 0x2cb1, 0x2ebe, 0x34ea, 0x3d39, 0x4513,
-	0x4d18, 0x5508, 0x5d14, 0x6105, 0x650a, 0x6d12, 0x7d0d, 0x7f11,
-	0x813e, 0x830f, 0x8515, 0x8d61, 0x9964, 0xa15d, 0xa86e, 0xb117,
-	0xb30b, 0xb86c, 0xc10b, 0xc916, 0xd110, 0xd91d, 0xe10c, 0xe84e,
-	// Entry 100 - 13F
-	0xf11c, 0xf524, 0xf923, 0x0122, 0x0925, 0x1129, 0x192c, 0x2023,
-	0x2928, 0x312b, 0x3727, 0x391f, 0x3d2d, 0x4131, 0x4930, 0x4ec2,
-	0x5519, 0x646b, 0x747b, 0x7e7f, 0x809f, 0x8298, 0x852f, 0x9135,
-	0xa53d, 0xac37, 0xb536, 0xb937, 0xbd3b, 0xd940, 0xe542, 0xed5e,
-	0xef5e, 0xf657, 0xfd62, 0x7c20, 0x7ef4, 0x80f5, 0x82f6, 0x84f7,
-	0x86f8, 0x88f9, 0x8afa, 0x8cfb, 0x8e70, 0x90fd, 0x92fe, 0x94ff,
-	0x9700, 0x9901, 0x9b43, 0x9d44, 0x9f45, 0xa146, 0xa347, 0xa548,
-	0xa749, 0xa94a, 0xab4b, 0xad4c, 0xaf4d, 0xb14e, 0xb34f, 0xb550,
-	// Entry 140 - 17F
-	0xb751, 0xb952, 0xbb53, 0xbd54, 0xbf55, 0xc156, 0xc357, 0xc558,
-	0xc759, 0xc95a, 0xcb5b, 0xcd5c, 0xcf65,
-}
-
-// Size: 1615 bytes
-var variantIndex = map[string]uint8{
-	"1606nict": 0x0,
-	"1694acad": 0x1,
-	"1901":     0x2,
-	"1959acad": 0x3,
-	"1994":     0x4d,
-	"1996":     0x4,
-	"abl1943":  0x5,
-	"akuapem":  0x6,
-	"alalc97":  0x4f,
-	"aluku":    0x7,
-	"ao1990":   0x8,
-	"arevela":  0x9,
-	"arevmda":  0xa,
-	"asante":   0xb,
-	"baku1926": 0xc,
-	"balanka":  0xd,
-	"barla":    0xe,
-	"basiceng": 0xf,
-	"bauddha":  0x10,
-	"biscayan": 0x11,
-	"biske":    0x48,
-	"bohoric":  0x12,
-	"boont":    0x13,
-	"colb1945": 0x14,
-	"cornu":    0x15,
-	"dajnko":   0x16,
-	"ekavsk":   0x17,
-	"emodeng":  0x18,
-	"fonipa":   0x50,
-	"fonnapa":  0x51,
-	"fonupa":   0x52,
-	"fonxsamp": 0x53,
-	"hepburn":  0x19,
-	"heploc":   0x4e,
-	"hognorsk": 0x1a,
-	"hsistemo": 0x1b,
-	"ijekavsk": 0x1c,
-	"itihasa":  0x1d,
-	"jauer":    0x1e,
-	"jyutping": 0x1f,
-	"kkcor":    0x20,
-	"kociewie": 0x21,
-	"kscor":    0x22,
-	"laukika":  0x23,
-	"lipaw":    0x49,
-	"luna1918": 0x24,
-	"metelko":  0x25,
-	"monoton":  0x26,
-	"ndyuka":   0x27,
-	"nedis":    0x28,
-	"newfound": 0x29,
-	"njiva":    0x4a,
-	"nulik":    0x2a,
-	"osojs":    0x4b,
-	"oxendict": 0x2b,
-	"pahawh2":  0x2c,
-	"pahawh3":  0x2d,
-	"pahawh4":  0x2e,
-	"pamaka":   0x2f,
-	"petr1708": 0x30,
-	"pinyin":   0x31,
-	"polyton":  0x32,
-	"puter":    0x33,
-	"rigik":    0x34,
-	"rozaj":    0x35,
-	"rumgr":    0x36,
-	"scotland": 0x37,
-	"scouse":   0x38,
-	"simple":   0x54,
-	"solba":    0x4c,
-	"sotav":    0x39,
-	"spanglis": 0x3a,
-	"surmiran": 0x3b,
-	"sursilv":  0x3c,
-	"sutsilv":  0x3d,
-	"tarask":   0x3e,
-	"uccor":    0x3f,
-	"ucrcor":   0x40,
-	"ulster":   0x41,
-	"unifon":   0x42,
-	"vaidika":  0x43,
-	"valencia": 0x44,
-	"vallader": 0x45,
-	"wadegile": 0x46,
-	"xsistemo": 0x47,
-}
-
-// variantNumSpecialized is the number of specialized variants in variants.
-const variantNumSpecialized = 79
-
-// nRegionGroups is the number of region groups.
-const nRegionGroups = 33
-
-type likelyLangRegion struct {
-	lang   uint16
-	region uint16
-}
-
-// likelyScript is a lookup table, indexed by scriptID, for the most likely
-// languages and regions given a script.
-// Size: 976 bytes, 244 elements
-var likelyScript = [244]likelyLangRegion{
-	1:   {lang: 0x14e, region: 0x84},
-	3:   {lang: 0x2a2, region: 0x106},
-	4:   {lang: 0x1f, region: 0x99},
-	5:   {lang: 0x3a, region: 0x6b},
-	7:   {lang: 0x3b, region: 0x9c},
-	8:   {lang: 0x1d7, region: 0x28},
-	9:   {lang: 0x13, region: 0x9c},
-	10:  {lang: 0x5b, region: 0x95},
-	11:  {lang: 0x60, region: 0x52},
-	12:  {lang: 0xb9, region: 0xb4},
-	13:  {lang: 0x63, region: 0x95},
-	14:  {lang: 0xa5, region: 0x35},
-	15:  {lang: 0x3e9, region: 0x99},
-	17:  {lang: 0x529, region: 0x12e},
-	18:  {lang: 0x3b1, region: 0x99},
-	19:  {lang: 0x15e, region: 0x78},
-	20:  {lang: 0xc2, region: 0x95},
-	21:  {lang: 0x9d, region: 0xe7},
-	22:  {lang: 0xdb, region: 0x35},
-	23:  {lang: 0xf3, region: 0x49},
-	24:  {lang: 0x4f0, region: 0x12b},
-	25:  {lang: 0xe7, region: 0x13e},
-	26:  {lang: 0xe5, region: 0x135},
-	28:  {lang: 0xf1, region: 0x6b},
-	30:  {lang: 0x1a0, region: 0x5d},
-	31:  {lang: 0x3e2, region: 0x106},
-	33:  {lang: 0x1be, region: 0x99},
-	36:  {lang: 0x15e, region: 0x78},
-	39:  {lang: 0x133, region: 0x6b},
-	40:  {lang: 0x431, region: 0x27},
-	41:  {lang: 0x27, region: 0x6f},
-	43:  {lang: 0x210, region: 0x7d},
-	44:  {lang: 0xfe, region: 0x38},
-	46:  {lang: 0x19b, region: 0x99},
-	47:  {lang: 0x19e, region: 0x130},
-	48:  {lang: 0x3e9, region: 0x99},
-	49:  {lang: 0x136, region: 0x87},
-	50:  {lang: 0x1a4, region: 0x99},
-	51:  {lang: 0x39d, region: 0x99},
-	52:  {lang: 0x529, region: 0x12e},
-	53:  {lang: 0x254, region: 0xab},
-	54:  {lang: 0x529, region: 0x53},
-	55:  {lang: 0x1cb, region: 0xe7},
-	56:  {lang: 0x529, region: 0x53},
-	57:  {lang: 0x529, region: 0x12e},
-	58:  {lang: 0x2fd, region: 0x9b},
-	59:  {lang: 0x1bc, region: 0x97},
-	60:  {lang: 0x200, region: 0xa2},
-	61:  {lang: 0x1c5, region: 0x12b},
-	62:  {lang: 0x1ca, region: 0xaf},
-	65:  {lang: 0x1d5, region: 0x92},
-	67:  {lang: 0x142, region: 0x9e},
-	68:  {lang: 0x254, region: 0xab},
-	69:  {lang: 0x20e, region: 0x95},
-	70:  {lang: 0x200, region: 0xa2},
-	72:  {lang: 0x135, region: 0xc4},
-	73:  {lang: 0x200, region: 0xa2},
-	74:  {lang: 0x3bb, region: 0xe8},
-	75:  {lang: 0x24a, region: 0xa6},
-	76:  {lang: 0x3fa, region: 0x99},
-	79:  {lang: 0x251, region: 0x99},
-	80:  {lang: 0x254, region: 0xab},
-	82:  {lang: 0x88, region: 0x99},
-	83:  {lang: 0x370, region: 0x123},
-	84:  {lang: 0x2b8, region: 0xaf},
-	89:  {lang: 0x29f, region: 0x99},
-	90:  {lang: 0x2a8, region: 0x99},
-	91:  {lang: 0x28f, region: 0x87},
-	92:  {lang: 0x1a0, region: 0x87},
-	93:  {lang: 0x2ac, region: 0x53},
-	95:  {lang: 0x4f4, region: 0x12b},
-	96:  {lang: 0x4f5, region: 0x12b},
-	97:  {lang: 0x1be, region: 0x99},
-	99:  {lang: 0x337, region: 0x9c},
-	100: {lang: 0x4f7, region: 0x53},
-	101: {lang: 0xa9, region: 0x53},
-	104: {lang: 0x2e8, region: 0x112},
-	105: {lang: 0x4f8, region: 0x10b},
-	106: {lang: 0x4f8, region: 0x10b},
-	107: {lang: 0x304, region: 0x99},
-	108: {lang: 0x31b, region: 0x99},
-	109: {lang: 0x30b, region: 0x53},
-	111: {lang: 0x31e, region: 0x35},
-	112: {lang: 0x30e, region: 0x99},
-	113: {lang: 0x414, region: 0xe8},
-	114: {lang: 0x331, region: 0xc4},
-	115: {lang: 0x4f9, region: 0x108},
-	116: {lang: 0x3b, region: 0xa1},
-	117: {lang: 0x353, region: 0xdb},
-	120: {lang: 0x2d0, region: 0x84},
-	121: {lang: 0x52a, region: 0x53},
-	122: {lang: 0x403, region: 0x96},
-	123: {lang: 0x3ee, region: 0x99},
-	124: {lang: 0x39b, region: 0xc5},
-	125: {lang: 0x395, region: 0x99},
-	126: {lang: 0x399, region: 0x135},
-	127: {lang: 0x429, region: 0x115},
-	128: {lang: 0x3b, region: 0x11c},
-	129: {lang: 0xfd, region: 0xc4},
-	130: {lang: 0x27d, region: 0x106},
-	131: {lang: 0x2c9, region: 0x53},
-	132: {lang: 0x39f, region: 0x9c},
-	133: {lang: 0x39f, region: 0x53},
-	135: {lang: 0x3ad, region: 0xb0},
-	137: {lang: 0x1c6, region: 0x53},
-	138: {lang: 0x4fd, region: 0x9c},
-	189: {lang: 0x3cb, region: 0x95},
-	191: {lang: 0x372, region: 0x10c},
-	192: {lang: 0x420, region: 0x97},
-	194: {lang: 0x4ff, region: 0x15e},
-	195: {lang: 0x3f0, region: 0x99},
-	196: {lang: 0x45, region: 0x135},
-	197: {lang: 0x139, region: 0x7b},
-	198: {lang: 0x3e9, region: 0x99},
-	200: {lang: 0x3e9, region: 0x99},
-	201: {lang: 0x3fa, region: 0x99},
-	202: {lang: 0x40c, region: 0xb3},
-	203: {lang: 0x433, region: 0x99},
-	204: {lang: 0xef, region: 0xc5},
-	205: {lang: 0x43e, region: 0x95},
-	206: {lang: 0x44d, region: 0x35},
-	207: {lang: 0x44e, region: 0x9b},
-	211: {lang: 0x45a, region: 0xe7},
-	212: {lang: 0x11a, region: 0x99},
-	213: {lang: 0x45e, region: 0x53},
-	214: {lang: 0x232, region: 0x53},
-	215: {lang: 0x450, region: 0x99},
-	216: {lang: 0x4a5, region: 0x53},
-	217: {lang: 0x9f, region: 0x13e},
-	218: {lang: 0x461, region: 0x99},
-	220: {lang: 0x528, region: 0xba},
-	221: {lang: 0x153, region: 0xe7},
-	222: {lang: 0x128, region: 0xcd},
-	223: {lang: 0x46b, region: 0x123},
-	224: {lang: 0xa9, region: 0x53},
-	225: {lang: 0x2ce, region: 0x99},
-	226: {lang: 0x4ad, region: 0x11c},
-	227: {lang: 0x4be, region: 0xb4},
-	229: {lang: 0x1ce, region: 0x99},
-	232: {lang: 0x3a9, region: 0x9c},
-	233: {lang: 0x22, region: 0x9b},
-	234: {lang: 0x1ea, region: 0x53},
-	235: {lang: 0xef, region: 0xc5},
-}
-
-type likelyScriptRegion struct {
-	region uint16
-	script uint8
-	flags  uint8
-}
-
-// likelyLang is a lookup table, indexed by langID, for the most likely
-// scripts and regions given incomplete information. If more entries exist for a
-// given language, region and script are the index and size respectively
-// of the list in likelyLangList.
-// Size: 5320 bytes, 1330 elements
-var likelyLang = [1330]likelyScriptRegion{
-	0:    {region: 0x135, script: 0x57, flags: 0x0},
-	1:    {region: 0x6f, script: 0x57, flags: 0x0},
-	2:    {region: 0x165, script: 0x57, flags: 0x0},
-	3:    {region: 0x165, script: 0x57, flags: 0x0},
-	4:    {region: 0x165, script: 0x57, flags: 0x0},
-	5:    {region: 0x7d, script: 0x1f, flags: 0x0},
-	6:    {region: 0x165, script: 0x57, flags: 0x0},
-	7:    {region: 0x165, script: 0x1f, flags: 0x0},
-	8:    {region: 0x80, script: 0x57, flags: 0x0},
-	9:    {region: 0x165, script: 0x57, flags: 0x0},
-	10:   {region: 0x165, script: 0x57, flags: 0x0},
-	11:   {region: 0x165, script: 0x57, flags: 0x0},
-	12:   {region: 0x95, script: 0x57, flags: 0x0},
-	13:   {region: 0x131, script: 0x57, flags: 0x0},
-	14:   {region: 0x80, script: 0x57, flags: 0x0},
-	15:   {region: 0x165, script: 0x57, flags: 0x0},
-	16:   {region: 0x165, script: 0x57, flags: 0x0},
-	17:   {region: 0x106, script: 0x1f, flags: 0x0},
-	18:   {region: 0x165, script: 0x57, flags: 0x0},
-	19:   {region: 0x9c, script: 0x9, flags: 0x0},
-	20:   {region: 0x128, script: 0x5, flags: 0x0},
-	21:   {region: 0x165, script: 0x57, flags: 0x0},
-	22:   {region: 0x161, script: 0x57, flags: 0x0},
-	23:   {region: 0x165, script: 0x57, flags: 0x0},
-	24:   {region: 0x165, script: 0x57, flags: 0x0},
-	25:   {region: 0x165, script: 0x57, flags: 0x0},
-	26:   {region: 0x165, script: 0x57, flags: 0x0},
-	27:   {region: 0x165, script: 0x57, flags: 0x0},
-	28:   {region: 0x52, script: 0x57, flags: 0x0},
-	29:   {region: 0x165, script: 0x57, flags: 0x0},
-	30:   {region: 0x165, script: 0x57, flags: 0x0},
-	31:   {region: 0x99, script: 0x4, flags: 0x0},
-	32:   {region: 0x165, script: 0x57, flags: 0x0},
-	33:   {region: 0x80, script: 0x57, flags: 0x0},
-	34:   {region: 0x9b, script: 0xe9, flags: 0x0},
-	35:   {region: 0x165, script: 0x57, flags: 0x0},
-	36:   {region: 0x165, script: 0x57, flags: 0x0},
-	37:   {region: 0x14d, script: 0x57, flags: 0x0},
-	38:   {region: 0x106, script: 0x1f, flags: 0x0},
-	39:   {region: 0x6f, script: 0x29, flags: 0x0},
-	40:   {region: 0x165, script: 0x57, flags: 0x0},
-	41:   {region: 0x165, script: 0x57, flags: 0x0},
-	42:   {region: 0xd6, script: 0x57, flags: 0x0},
-	43:   {region: 0x165, script: 0x57, flags: 0x0},
-	45:   {region: 0x165, script: 0x57, flags: 0x0},
-	46:   {region: 0x165, script: 0x57, flags: 0x0},
-	47:   {region: 0x165, script: 0x57, flags: 0x0},
-	48:   {region: 0x165, script: 0x57, flags: 0x0},
-	49:   {region: 0x165, script: 0x57, flags: 0x0},
-	50:   {region: 0x165, script: 0x57, flags: 0x0},
-	51:   {region: 0x95, script: 0x57, flags: 0x0},
-	52:   {region: 0x165, script: 0x5, flags: 0x0},
-	53:   {region: 0x122, script: 0x5, flags: 0x0},
-	54:   {region: 0x165, script: 0x57, flags: 0x0},
-	55:   {region: 0x165, script: 0x57, flags: 0x0},
-	56:   {region: 0x165, script: 0x57, flags: 0x0},
-	57:   {region: 0x165, script: 0x57, flags: 0x0},
-	58:   {region: 0x6b, script: 0x5, flags: 0x0},
-	59:   {region: 0x0, script: 0x3, flags: 0x1},
-	60:   {region: 0x165, script: 0x57, flags: 0x0},
-	61:   {region: 0x51, script: 0x57, flags: 0x0},
-	62:   {region: 0x3f, script: 0x57, flags: 0x0},
-	63:   {region: 0x67, script: 0x5, flags: 0x0},
-	65:   {region: 0xba, script: 0x5, flags: 0x0},
-	66:   {region: 0x6b, script: 0x5, flags: 0x0},
-	67:   {region: 0x99, script: 0xe, flags: 0x0},
-	68:   {region: 0x12f, script: 0x57, flags: 0x0},
-	69:   {region: 0x135, script: 0xc4, flags: 0x0},
-	70:   {region: 0x165, script: 0x57, flags: 0x0},
-	71:   {region: 0x165, script: 0x57, flags: 0x0},
-	72:   {region: 0x6e, script: 0x57, flags: 0x0},
-	73:   {region: 0x165, script: 0x57, flags: 0x0},
-	74:   {region: 0x165, script: 0x57, flags: 0x0},
-	75:   {region: 0x49, script: 0x57, flags: 0x0},
-	76:   {region: 0x165, script: 0x57, flags: 0x0},
-	77:   {region: 0x106, script: 0x1f, flags: 0x0},
-	78:   {region: 0x165, script: 0x5, flags: 0x0},
-	79:   {region: 0x165, script: 0x57, flags: 0x0},
-	80:   {region: 0x165, script: 0x57, flags: 0x0},
-	81:   {region: 0x165, script: 0x57, flags: 0x0},
-	82:   {region: 0x99, script: 0x21, flags: 0x0},
-	83:   {region: 0x165, script: 0x57, flags: 0x0},
-	84:   {region: 0x165, script: 0x57, flags: 0x0},
-	85:   {region: 0x165, script: 0x57, flags: 0x0},
-	86:   {region: 0x3f, script: 0x57, flags: 0x0},
-	87:   {region: 0x165, script: 0x57, flags: 0x0},
-	88:   {region: 0x3, script: 0x5, flags: 0x1},
-	89:   {region: 0x106, script: 0x1f, flags: 0x0},
-	90:   {region: 0xe8, script: 0x5, flags: 0x0},
-	91:   {region: 0x95, script: 0x57, flags: 0x0},
-	92:   {region: 0xdb, script: 0x21, flags: 0x0},
-	93:   {region: 0x2e, script: 0x57, flags: 0x0},
-	94:   {region: 0x52, script: 0x57, flags: 0x0},
-	95:   {region: 0x165, script: 0x57, flags: 0x0},
-	96:   {region: 0x52, script: 0xb, flags: 0x0},
-	97:   {region: 0x165, script: 0x57, flags: 0x0},
-	98:   {region: 0x165, script: 0x57, flags: 0x0},
-	99:   {region: 0x95, script: 0x57, flags: 0x0},
-	100:  {region: 0x165, script: 0x57, flags: 0x0},
-	101:  {region: 0x52, script: 0x57, flags: 0x0},
-	102:  {region: 0x165, script: 0x57, flags: 0x0},
-	103:  {region: 0x165, script: 0x57, flags: 0x0},
-	104:  {region: 0x165, script: 0x57, flags: 0x0},
-	105:  {region: 0x165, script: 0x57, flags: 0x0},
-	106:  {region: 0x4f, script: 0x57, flags: 0x0},
-	107:  {region: 0x165, script: 0x57, flags: 0x0},
-	108:  {region: 0x165, script: 0x57, flags: 0x0},
-	109:  {region: 0x165, script: 0x57, flags: 0x0},
-	110:  {region: 0x165, script: 0x29, flags: 0x0},
-	111:  {region: 0x165, script: 0x57, flags: 0x0},
-	112:  {region: 0x165, script: 0x57, flags: 0x0},
-	113:  {region: 0x47, script: 0x1f, flags: 0x0},
-	114:  {region: 0x165, script: 0x57, flags: 0x0},
-	115:  {region: 0x165, script: 0x57, flags: 0x0},
-	116:  {region: 0x10b, script: 0x5, flags: 0x0},
-	117:  {region: 0x162, script: 0x57, flags: 0x0},
-	118:  {region: 0x165, script: 0x57, flags: 0x0},
-	119:  {region: 0x95, script: 0x57, flags: 0x0},
-	120:  {region: 0x165, script: 0x57, flags: 0x0},
-	121:  {region: 0x12f, script: 0x57, flags: 0x0},
-	122:  {region: 0x52, script: 0x57, flags: 0x0},
-	123:  {region: 0x99, script: 0xd7, flags: 0x0},
-	124:  {region: 0xe8, script: 0x5, flags: 0x0},
-	125:  {region: 0x99, script: 0x21, flags: 0x0},
-	126:  {region: 0x38, script: 0x1f, flags: 0x0},
-	127:  {region: 0x99, script: 0x21, flags: 0x0},
-	128:  {region: 0xe8, script: 0x5, flags: 0x0},
-	129:  {region: 0x12b, script: 0x31, flags: 0x0},
-	131:  {region: 0x99, script: 0x21, flags: 0x0},
-	132:  {region: 0x165, script: 0x57, flags: 0x0},
-	133:  {region: 0x99, script: 0x21, flags: 0x0},
-	134:  {region: 0xe7, script: 0x57, flags: 0x0},
-	135:  {region: 0x165, script: 0x57, flags: 0x0},
-	136:  {region: 0x99, script: 0x21, flags: 0x0},
-	137:  {region: 0x165, script: 0x57, flags: 0x0},
-	138:  {region: 0x13f, script: 0x57, flags: 0x0},
-	139:  {region: 0x165, script: 0x57, flags: 0x0},
-	140:  {region: 0x165, script: 0x57, flags: 0x0},
-	141:  {region: 0xe7, script: 0x57, flags: 0x0},
-	142:  {region: 0x165, script: 0x57, flags: 0x0},
-	143:  {region: 0xd6, script: 0x57, flags: 0x0},
-	144:  {region: 0x165, script: 0x57, flags: 0x0},
-	145:  {region: 0x165, script: 0x57, flags: 0x0},
-	146:  {region: 0x165, script: 0x57, flags: 0x0},
-	147:  {region: 0x165, script: 0x29, flags: 0x0},
-	148:  {region: 0x99, script: 0x21, flags: 0x0},
-	149:  {region: 0x95, script: 0x57, flags: 0x0},
-	150:  {region: 0x165, script: 0x57, flags: 0x0},
-	151:  {region: 0x165, script: 0x57, flags: 0x0},
-	152:  {region: 0x114, script: 0x57, flags: 0x0},
-	153:  {region: 0x165, script: 0x57, flags: 0x0},
-	154:  {region: 0x165, script: 0x57, flags: 0x0},
-	155:  {region: 0x52, script: 0x57, flags: 0x0},
-	156:  {region: 0x165, script: 0x57, flags: 0x0},
-	157:  {region: 0xe7, script: 0x57, flags: 0x0},
-	158:  {region: 0x165, script: 0x57, flags: 0x0},
-	159:  {region: 0x13e, script: 0xd9, flags: 0x0},
-	160:  {region: 0xc3, script: 0x57, flags: 0x0},
-	161:  {region: 0x165, script: 0x57, flags: 0x0},
-	162:  {region: 0x165, script: 0x57, flags: 0x0},
-	163:  {region: 0xc3, script: 0x57, flags: 0x0},
-	164:  {region: 0x165, script: 0x57, flags: 0x0},
-	165:  {region: 0x35, script: 0xe, flags: 0x0},
-	166:  {region: 0x165, script: 0x57, flags: 0x0},
-	167:  {region: 0x165, script: 0x57, flags: 0x0},
-	168:  {region: 0x165, script: 0x57, flags: 0x0},
-	169:  {region: 0x53, script: 0xe0, flags: 0x0},
-	170:  {region: 0x165, script: 0x57, flags: 0x0},
-	171:  {region: 0x165, script: 0x57, flags: 0x0},
-	172:  {region: 0x165, script: 0x57, flags: 0x0},
-	173:  {region: 0x99, script: 0xe, flags: 0x0},
-	174:  {region: 0x165, script: 0x57, flags: 0x0},
-	175:  {region: 0x9c, script: 0x5, flags: 0x0},
-	176:  {region: 0x165, script: 0x57, flags: 0x0},
-	177:  {region: 0x4f, script: 0x57, flags: 0x0},
-	178:  {region: 0x78, script: 0x57, flags: 0x0},
-	179:  {region: 0x99, script: 0x21, flags: 0x0},
-	180:  {region: 0xe8, script: 0x5, flags: 0x0},
-	181:  {region: 0x99, script: 0x21, flags: 0x0},
-	182:  {region: 0x165, script: 0x57, flags: 0x0},
-	183:  {region: 0x33, script: 0x57, flags: 0x0},
-	184:  {region: 0x165, script: 0x57, flags: 0x0},
-	185:  {region: 0xb4, script: 0xc, flags: 0x0},
-	186:  {region: 0x52, script: 0x57, flags: 0x0},
-	187:  {region: 0x165, script: 0x29, flags: 0x0},
-	188:  {region: 0xe7, script: 0x57, flags: 0x0},
-	189:  {region: 0x165, script: 0x57, flags: 0x0},
-	190:  {region: 0xe8, script: 0x21, flags: 0x0},
-	191:  {region: 0x106, script: 0x1f, flags: 0x0},
-	192:  {region: 0x15f, script: 0x57, flags: 0x0},
-	193:  {region: 0x165, script: 0x57, flags: 0x0},
-	194:  {region: 0x95, script: 0x57, flags: 0x0},
-	195:  {region: 0x165, script: 0x57, flags: 0x0},
-	196:  {region: 0x52, script: 0x57, flags: 0x0},
-	197:  {region: 0x165, script: 0x57, flags: 0x0},
-	198:  {region: 0x165, script: 0x57, flags: 0x0},
-	199:  {region: 0x165, script: 0x57, flags: 0x0},
-	200:  {region: 0x86, script: 0x57, flags: 0x0},
-	201:  {region: 0x165, script: 0x57, flags: 0x0},
-	202:  {region: 0x165, script: 0x57, flags: 0x0},
-	203:  {region: 0x165, script: 0x57, flags: 0x0},
-	204:  {region: 0x165, script: 0x57, flags: 0x0},
-	205:  {region: 0x6d, script: 0x29, flags: 0x0},
-	206:  {region: 0x165, script: 0x57, flags: 0x0},
-	207:  {region: 0x165, script: 0x57, flags: 0x0},
-	208:  {region: 0x52, script: 0x57, flags: 0x0},
-	209:  {region: 0x165, script: 0x57, flags: 0x0},
-	210:  {region: 0x165, script: 0x57, flags: 0x0},
-	211:  {region: 0xc3, script: 0x57, flags: 0x0},
-	212:  {region: 0x165, script: 0x57, flags: 0x0},
-	213:  {region: 0x165, script: 0x57, flags: 0x0},
-	214:  {region: 0x165, script: 0x57, flags: 0x0},
-	215:  {region: 0x6e, script: 0x57, flags: 0x0},
-	216:  {region: 0x165, script: 0x57, flags: 0x0},
-	217:  {region: 0x165, script: 0x57, flags: 0x0},
-	218:  {region: 0xd6, script: 0x57, flags: 0x0},
-	219:  {region: 0x35, script: 0x16, flags: 0x0},
-	220:  {region: 0x106, script: 0x1f, flags: 0x0},
-	221:  {region: 0xe7, script: 0x57, flags: 0x0},
-	222:  {region: 0x165, script: 0x57, flags: 0x0},
-	223:  {region: 0x131, script: 0x57, flags: 0x0},
-	224:  {region: 0x8a, script: 0x57, flags: 0x0},
-	225:  {region: 0x75, script: 0x57, flags: 0x0},
-	226:  {region: 0x106, script: 0x1f, flags: 0x0},
-	227:  {region: 0x135, script: 0x57, flags: 0x0},
-	228:  {region: 0x49, script: 0x57, flags: 0x0},
-	229:  {region: 0x135, script: 0x1a, flags: 0x0},
-	230:  {region: 0xa6, script: 0x5, flags: 0x0},
-	231:  {region: 0x13e, script: 0x19, flags: 0x0},
-	232:  {region: 0x165, script: 0x57, flags: 0x0},
-	233:  {region: 0x9b, script: 0x5, flags: 0x0},
-	234:  {region: 0x165, script: 0x57, flags: 0x0},
-	235:  {region: 0x165, script: 0x57, flags: 0x0},
-	236:  {region: 0x165, script: 0x57, flags: 0x0},
-	237:  {region: 0x165, script: 0x57, flags: 0x0},
-	238:  {region: 0x165, script: 0x57, flags: 0x0},
-	239:  {region: 0xc5, script: 0xcc, flags: 0x0},
-	240:  {region: 0x78, script: 0x57, flags: 0x0},
-	241:  {region: 0x6b, script: 0x1c, flags: 0x0},
-	242:  {region: 0xe7, script: 0x57, flags: 0x0},
-	243:  {region: 0x49, script: 0x17, flags: 0x0},
-	244:  {region: 0x130, script: 0x1f, flags: 0x0},
-	245:  {region: 0x49, script: 0x17, flags: 0x0},
-	246:  {region: 0x49, script: 0x17, flags: 0x0},
-	247:  {region: 0x49, script: 0x17, flags: 0x0},
-	248:  {region: 0x49, script: 0x17, flags: 0x0},
-	249:  {region: 0x10a, script: 0x57, flags: 0x0},
-	250:  {region: 0x5e, script: 0x57, flags: 0x0},
-	251:  {region: 0xe9, script: 0x57, flags: 0x0},
-	252:  {region: 0x49, script: 0x17, flags: 0x0},
-	253:  {region: 0xc4, script: 0x81, flags: 0x0},
-	254:  {region: 0x8, script: 0x2, flags: 0x1},
-	255:  {region: 0x106, script: 0x1f, flags: 0x0},
-	256:  {region: 0x7b, script: 0x57, flags: 0x0},
-	257:  {region: 0x63, script: 0x57, flags: 0x0},
-	258:  {region: 0x165, script: 0x57, flags: 0x0},
-	259:  {region: 0x165, script: 0x57, flags: 0x0},
-	260:  {region: 0x165, script: 0x57, flags: 0x0},
-	261:  {region: 0x165, script: 0x57, flags: 0x0},
-	262:  {region: 0x135, script: 0x57, flags: 0x0},
-	263:  {region: 0x106, script: 0x1f, flags: 0x0},
-	264:  {region: 0xa4, script: 0x57, flags: 0x0},
-	265:  {region: 0x165, script: 0x57, flags: 0x0},
-	266:  {region: 0x165, script: 0x57, flags: 0x0},
-	267:  {region: 0x99, script: 0x5, flags: 0x0},
-	268:  {region: 0x165, script: 0x57, flags: 0x0},
-	269:  {region: 0x60, script: 0x57, flags: 0x0},
-	270:  {region: 0x165, script: 0x57, flags: 0x0},
-	271:  {region: 0x49, script: 0x57, flags: 0x0},
-	272:  {region: 0x165, script: 0x57, flags: 0x0},
-	273:  {region: 0x165, script: 0x57, flags: 0x0},
-	274:  {region: 0x165, script: 0x57, flags: 0x0},
-	275:  {region: 0x165, script: 0x5, flags: 0x0},
-	276:  {region: 0x49, script: 0x57, flags: 0x0},
-	277:  {region: 0x165, script: 0x57, flags: 0x0},
-	278:  {region: 0x165, script: 0x57, flags: 0x0},
-	279:  {region: 0xd4, script: 0x57, flags: 0x0},
-	280:  {region: 0x4f, script: 0x57, flags: 0x0},
-	281:  {region: 0x165, script: 0x57, flags: 0x0},
-	282:  {region: 0x99, script: 0x5, flags: 0x0},
-	283:  {region: 0x165, script: 0x57, flags: 0x0},
-	284:  {region: 0x165, script: 0x57, flags: 0x0},
-	285:  {region: 0x165, script: 0x57, flags: 0x0},
-	286:  {region: 0x165, script: 0x29, flags: 0x0},
-	287:  {region: 0x60, script: 0x57, flags: 0x0},
-	288:  {region: 0xc3, script: 0x57, flags: 0x0},
-	289:  {region: 0xd0, script: 0x57, flags: 0x0},
-	290:  {region: 0x165, script: 0x57, flags: 0x0},
-	291:  {region: 0xdb, script: 0x21, flags: 0x0},
-	292:  {region: 0x52, script: 0x57, flags: 0x0},
-	293:  {region: 0x165, script: 0x57, flags: 0x0},
-	294:  {region: 0x165, script: 0x57, flags: 0x0},
-	295:  {region: 0x165, script: 0x57, flags: 0x0},
-	296:  {region: 0xcd, script: 0xde, flags: 0x0},
-	297:  {region: 0x165, script: 0x57, flags: 0x0},
-	298:  {region: 0x165, script: 0x57, flags: 0x0},
-	299:  {region: 0x114, script: 0x57, flags: 0x0},
-	300:  {region: 0x37, script: 0x57, flags: 0x0},
-	301:  {region: 0x43, script: 0xe0, flags: 0x0},
-	302:  {region: 0x165, script: 0x57, flags: 0x0},
-	303:  {region: 0xa4, script: 0x57, flags: 0x0},
-	304:  {region: 0x80, script: 0x57, flags: 0x0},
-	305:  {region: 0xd6, script: 0x57, flags: 0x0},
-	306:  {region: 0x9e, script: 0x57, flags: 0x0},
-	307:  {region: 0x6b, script: 0x27, flags: 0x0},
-	308:  {region: 0x165, script: 0x57, flags: 0x0},
-	309:  {region: 0xc4, script: 0x48, flags: 0x0},
-	310:  {region: 0x87, script: 0x31, flags: 0x0},
-	311:  {region: 0x165, script: 0x57, flags: 0x0},
-	312:  {region: 0x165, script: 0x57, flags: 0x0},
-	313:  {region: 0xa, script: 0x2, flags: 0x1},
-	314:  {region: 0x165, script: 0x57, flags: 0x0},
-	315:  {region: 0x165, script: 0x57, flags: 0x0},
-	316:  {region: 0x1, script: 0x57, flags: 0x0},
-	317:  {region: 0x165, script: 0x57, flags: 0x0},
-	318:  {region: 0x6e, script: 0x57, flags: 0x0},
-	319:  {region: 0x135, script: 0x57, flags: 0x0},
-	320:  {region: 0x6a, script: 0x57, flags: 0x0},
-	321:  {region: 0x165, script: 0x57, flags: 0x0},
-	322:  {region: 0x9e, script: 0x43, flags: 0x0},
-	323:  {region: 0x165, script: 0x57, flags: 0x0},
-	324:  {region: 0x165, script: 0x57, flags: 0x0},
-	325:  {region: 0x6e, script: 0x57, flags: 0x0},
-	326:  {region: 0x52, script: 0x57, flags: 0x0},
-	327:  {region: 0x6e, script: 0x57, flags: 0x0},
-	328:  {region: 0x9c, script: 0x5, flags: 0x0},
-	329:  {region: 0x165, script: 0x57, flags: 0x0},
-	330:  {region: 0x165, script: 0x57, flags: 0x0},
-	331:  {region: 0x165, script: 0x57, flags: 0x0},
-	332:  {region: 0x165, script: 0x57, flags: 0x0},
-	333:  {region: 0x86, script: 0x57, flags: 0x0},
-	334:  {region: 0xc, script: 0x2, flags: 0x1},
-	335:  {region: 0x165, script: 0x57, flags: 0x0},
-	336:  {region: 0xc3, script: 0x57, flags: 0x0},
-	337:  {region: 0x72, script: 0x57, flags: 0x0},
-	338:  {region: 0x10b, script: 0x5, flags: 0x0},
-	339:  {region: 0xe7, script: 0x57, flags: 0x0},
-	340:  {region: 0x10c, script: 0x57, flags: 0x0},
-	341:  {region: 0x73, script: 0x57, flags: 0x0},
-	342:  {region: 0x165, script: 0x57, flags: 0x0},
-	343:  {region: 0x165, script: 0x57, flags: 0x0},
-	344:  {region: 0x76, script: 0x57, flags: 0x0},
-	345:  {region: 0x165, script: 0x57, flags: 0x0},
-	346:  {region: 0x3b, script: 0x57, flags: 0x0},
-	347:  {region: 0x165, script: 0x57, flags: 0x0},
-	348:  {region: 0x165, script: 0x57, flags: 0x0},
-	349:  {region: 0x165, script: 0x57, flags: 0x0},
-	350:  {region: 0x78, script: 0x57, flags: 0x0},
-	351:  {region: 0x135, script: 0x57, flags: 0x0},
-	352:  {region: 0x78, script: 0x57, flags: 0x0},
-	353:  {region: 0x60, script: 0x57, flags: 0x0},
-	354:  {region: 0x60, script: 0x57, flags: 0x0},
-	355:  {region: 0x52, script: 0x5, flags: 0x0},
-	356:  {region: 0x140, script: 0x57, flags: 0x0},
-	357:  {region: 0x165, script: 0x57, flags: 0x0},
-	358:  {region: 0x84, script: 0x57, flags: 0x0},
-	359:  {region: 0x165, script: 0x57, flags: 0x0},
-	360:  {region: 0xd4, script: 0x57, flags: 0x0},
-	361:  {region: 0x9e, script: 0x57, flags: 0x0},
-	362:  {region: 0xd6, script: 0x57, flags: 0x0},
-	363:  {region: 0x165, script: 0x57, flags: 0x0},
-	364:  {region: 0x10b, script: 0x57, flags: 0x0},
-	365:  {region: 0xd9, script: 0x57, flags: 0x0},
-	366:  {region: 0x96, script: 0x57, flags: 0x0},
-	367:  {region: 0x80, script: 0x57, flags: 0x0},
-	368:  {region: 0x165, script: 0x57, flags: 0x0},
-	369:  {region: 0xbc, script: 0x57, flags: 0x0},
-	370:  {region: 0x165, script: 0x57, flags: 0x0},
-	371:  {region: 0x165, script: 0x57, flags: 0x0},
-	372:  {region: 0x165, script: 0x57, flags: 0x0},
-	373:  {region: 0x53, script: 0x38, flags: 0x0},
-	374:  {region: 0x165, script: 0x57, flags: 0x0},
-	375:  {region: 0x95, script: 0x57, flags: 0x0},
-	376:  {region: 0x165, script: 0x57, flags: 0x0},
-	377:  {region: 0x165, script: 0x57, flags: 0x0},
-	378:  {region: 0x99, script: 0x21, flags: 0x0},
-	379:  {region: 0x165, script: 0x57, flags: 0x0},
-	380:  {region: 0x9c, script: 0x5, flags: 0x0},
-	381:  {region: 0x7e, script: 0x57, flags: 0x0},
-	382:  {region: 0x7b, script: 0x57, flags: 0x0},
-	383:  {region: 0x165, script: 0x57, flags: 0x0},
-	384:  {region: 0x165, script: 0x57, flags: 0x0},
-	385:  {region: 0x165, script: 0x57, flags: 0x0},
-	386:  {region: 0x165, script: 0x57, flags: 0x0},
-	387:  {region: 0x165, script: 0x57, flags: 0x0},
-	388:  {region: 0x165, script: 0x57, flags: 0x0},
-	389:  {region: 0x6f, script: 0x29, flags: 0x0},
-	390:  {region: 0x165, script: 0x57, flags: 0x0},
-	391:  {region: 0xdb, script: 0x21, flags: 0x0},
-	392:  {region: 0x165, script: 0x57, flags: 0x0},
-	393:  {region: 0xa7, script: 0x57, flags: 0x0},
-	394:  {region: 0x165, script: 0x57, flags: 0x0},
-	395:  {region: 0xe8, script: 0x5, flags: 0x0},
-	396:  {region: 0x165, script: 0x57, flags: 0x0},
-	397:  {region: 0xe8, script: 0x5, flags: 0x0},
-	398:  {region: 0x165, script: 0x57, flags: 0x0},
-	399:  {region: 0x165, script: 0x57, flags: 0x0},
-	400:  {region: 0x6e, script: 0x57, flags: 0x0},
-	401:  {region: 0x9c, script: 0x5, flags: 0x0},
-	402:  {region: 0x165, script: 0x57, flags: 0x0},
-	403:  {region: 0x165, script: 0x29, flags: 0x0},
-	404:  {region: 0xf1, script: 0x57, flags: 0x0},
-	405:  {region: 0x165, script: 0x57, flags: 0x0},
-	406:  {region: 0x165, script: 0x57, flags: 0x0},
-	407:  {region: 0x165, script: 0x57, flags: 0x0},
-	408:  {region: 0x165, script: 0x29, flags: 0x0},
-	409:  {region: 0x165, script: 0x57, flags: 0x0},
-	410:  {region: 0x99, script: 0x21, flags: 0x0},
-	411:  {region: 0x99, script: 0xda, flags: 0x0},
-	412:  {region: 0x95, script: 0x57, flags: 0x0},
-	413:  {region: 0xd9, script: 0x57, flags: 0x0},
-	414:  {region: 0x130, script: 0x2f, flags: 0x0},
-	415:  {region: 0x165, script: 0x57, flags: 0x0},
-	416:  {region: 0xe, script: 0x2, flags: 0x1},
-	417:  {region: 0x99, script: 0xe, flags: 0x0},
-	418:  {region: 0x165, script: 0x57, flags: 0x0},
-	419:  {region: 0x4e, script: 0x57, flags: 0x0},
-	420:  {region: 0x99, script: 0x32, flags: 0x0},
-	421:  {region: 0x41, script: 0x57, flags: 0x0},
-	422:  {region: 0x54, script: 0x57, flags: 0x0},
-	423:  {region: 0x165, script: 0x57, flags: 0x0},
-	424:  {region: 0x80, script: 0x57, flags: 0x0},
-	425:  {region: 0x165, script: 0x57, flags: 0x0},
-	426:  {region: 0x165, script: 0x57, flags: 0x0},
-	427:  {region: 0xa4, script: 0x57, flags: 0x0},
-	428:  {region: 0x98, script: 0x57, flags: 0x0},
-	429:  {region: 0x165, script: 0x57, flags: 0x0},
-	430:  {region: 0xdb, script: 0x21, flags: 0x0},
-	431:  {region: 0x165, script: 0x57, flags: 0x0},
-	432:  {region: 0x165, script: 0x5, flags: 0x0},
-	433:  {region: 0x49, script: 0x57, flags: 0x0},
-	434:  {region: 0x165, script: 0x5, flags: 0x0},
-	435:  {region: 0x165, script: 0x57, flags: 0x0},
-	436:  {region: 0x10, script: 0x3, flags: 0x1},
-	437:  {region: 0x165, script: 0x57, flags: 0x0},
-	438:  {region: 0x53, script: 0x38, flags: 0x0},
-	439:  {region: 0x165, script: 0x57, flags: 0x0},
-	440:  {region: 0x135, script: 0x57, flags: 0x0},
-	441:  {region: 0x24, script: 0x5, flags: 0x0},
-	442:  {region: 0x165, script: 0x57, flags: 0x0},
-	443:  {region: 0x165, script: 0x29, flags: 0x0},
-	444:  {region: 0x97, script: 0x3b, flags: 0x0},
-	445:  {region: 0x165, script: 0x57, flags: 0x0},
-	446:  {region: 0x99, script: 0x21, flags: 0x0},
-	447:  {region: 0x165, script: 0x57, flags: 0x0},
-	448:  {region: 0x73, script: 0x57, flags: 0x0},
-	449:  {region: 0x165, script: 0x57, flags: 0x0},
-	450:  {region: 0x165, script: 0x57, flags: 0x0},
-	451:  {region: 0xe7, script: 0x57, flags: 0x0},
-	452:  {region: 0x165, script: 0x57, flags: 0x0},
-	453:  {region: 0x12b, script: 0x3d, flags: 0x0},
-	454:  {region: 0x53, script: 0x89, flags: 0x0},
-	455:  {region: 0x165, script: 0x57, flags: 0x0},
-	456:  {region: 0xe8, script: 0x5, flags: 0x0},
-	457:  {region: 0x99, script: 0x21, flags: 0x0},
-	458:  {region: 0xaf, script: 0x3e, flags: 0x0},
-	459:  {region: 0xe7, script: 0x57, flags: 0x0},
-	460:  {region: 0xe8, script: 0x5, flags: 0x0},
-	461:  {region: 0xe6, script: 0x57, flags: 0x0},
-	462:  {region: 0x99, script: 0x21, flags: 0x0},
-	463:  {region: 0x99, script: 0x21, flags: 0x0},
-	464:  {region: 0x165, script: 0x57, flags: 0x0},
-	465:  {region: 0x90, script: 0x57, flags: 0x0},
-	466:  {region: 0x60, script: 0x57, flags: 0x0},
-	467:  {region: 0x53, script: 0x38, flags: 0x0},
-	468:  {region: 0x91, script: 0x57, flags: 0x0},
-	469:  {region: 0x92, script: 0x57, flags: 0x0},
-	470:  {region: 0x165, script: 0x57, flags: 0x0},
-	471:  {region: 0x28, script: 0x8, flags: 0x0},
-	472:  {region: 0xd2, script: 0x57, flags: 0x0},
-	473:  {region: 0x78, script: 0x57, flags: 0x0},
-	474:  {region: 0x165, script: 0x57, flags: 0x0},
-	475:  {region: 0x165, script: 0x57, flags: 0x0},
-	476:  {region: 0xd0, script: 0x57, flags: 0x0},
-	477:  {region: 0xd6, script: 0x57, flags: 0x0},
-	478:  {region: 0x165, script: 0x57, flags: 0x0},
-	479:  {region: 0x165, script: 0x57, flags: 0x0},
-	480:  {region: 0x165, script: 0x57, flags: 0x0},
-	481:  {region: 0x95, script: 0x57, flags: 0x0},
-	482:  {region: 0x165, script: 0x57, flags: 0x0},
-	483:  {region: 0x165, script: 0x57, flags: 0x0},
-	484:  {region: 0x165, script: 0x57, flags: 0x0},
-	486:  {region: 0x122, script: 0x57, flags: 0x0},
-	487:  {region: 0xd6, script: 0x57, flags: 0x0},
-	488:  {region: 0x165, script: 0x57, flags: 0x0},
-	489:  {region: 0x165, script: 0x57, flags: 0x0},
-	490:  {region: 0x53, script: 0xea, flags: 0x0},
-	491:  {region: 0x165, script: 0x57, flags: 0x0},
-	492:  {region: 0x135, script: 0x57, flags: 0x0},
-	493:  {region: 0x165, script: 0x57, flags: 0x0},
-	494:  {region: 0x49, script: 0x57, flags: 0x0},
-	495:  {region: 0x165, script: 0x57, flags: 0x0},
-	496:  {region: 0x165, script: 0x57, flags: 0x0},
-	497:  {region: 0xe7, script: 0x57, flags: 0x0},
-	498:  {region: 0x165, script: 0x57, flags: 0x0},
-	499:  {region: 0x95, script: 0x57, flags: 0x0},
-	500:  {region: 0x106, script: 0x1f, flags: 0x0},
-	501:  {region: 0x1, script: 0x57, flags: 0x0},
-	502:  {region: 0x165, script: 0x57, flags: 0x0},
-	503:  {region: 0x165, script: 0x57, flags: 0x0},
-	504:  {region: 0x9d, script: 0x57, flags: 0x0},
-	505:  {region: 0x9e, script: 0x57, flags: 0x0},
-	506:  {region: 0x49, script: 0x17, flags: 0x0},
-	507:  {region: 0x97, script: 0x3b, flags: 0x0},
-	508:  {region: 0x165, script: 0x57, flags: 0x0},
-	509:  {region: 0x165, script: 0x57, flags: 0x0},
-	510:  {region: 0x106, script: 0x57, flags: 0x0},
-	511:  {region: 0x165, script: 0x57, flags: 0x0},
-	512:  {region: 0xa2, script: 0x46, flags: 0x0},
-	513:  {region: 0x165, script: 0x57, flags: 0x0},
-	514:  {region: 0xa0, script: 0x57, flags: 0x0},
-	515:  {region: 0x1, script: 0x57, flags: 0x0},
-	516:  {region: 0x165, script: 0x57, flags: 0x0},
-	517:  {region: 0x165, script: 0x57, flags: 0x0},
-	518:  {region: 0x165, script: 0x57, flags: 0x0},
-	519:  {region: 0x52, script: 0x57, flags: 0x0},
-	520:  {region: 0x130, script: 0x3b, flags: 0x0},
-	521:  {region: 0x165, script: 0x57, flags: 0x0},
-	522:  {region: 0x12f, script: 0x57, flags: 0x0},
-	523:  {region: 0xdb, script: 0x21, flags: 0x0},
-	524:  {region: 0x165, script: 0x57, flags: 0x0},
-	525:  {region: 0x63, script: 0x57, flags: 0x0},
-	526:  {region: 0x95, script: 0x57, flags: 0x0},
-	527:  {region: 0x95, script: 0x57, flags: 0x0},
-	528:  {region: 0x7d, script: 0x2b, flags: 0x0},
-	529:  {region: 0x137, script: 0x1f, flags: 0x0},
-	530:  {region: 0x67, script: 0x57, flags: 0x0},
-	531:  {region: 0xc4, script: 0x57, flags: 0x0},
-	532:  {region: 0x165, script: 0x57, flags: 0x0},
-	533:  {region: 0x165, script: 0x57, flags: 0x0},
-	534:  {region: 0xd6, script: 0x57, flags: 0x0},
-	535:  {region: 0xa4, script: 0x57, flags: 0x0},
-	536:  {region: 0xc3, script: 0x57, flags: 0x0},
-	537:  {region: 0x106, script: 0x1f, flags: 0x0},
-	538:  {region: 0x165, script: 0x57, flags: 0x0},
-	539:  {region: 0x165, script: 0x57, flags: 0x0},
-	540:  {region: 0x165, script: 0x57, flags: 0x0},
-	541:  {region: 0x165, script: 0x57, flags: 0x0},
-	542:  {region: 0xd4, script: 0x5, flags: 0x0},
-	543:  {region: 0xd6, script: 0x57, flags: 0x0},
-	544:  {region: 0x164, script: 0x57, flags: 0x0},
-	545:  {region: 0x165, script: 0x57, flags: 0x0},
-	546:  {region: 0x165, script: 0x57, flags: 0x0},
-	547:  {region: 0x12f, script: 0x57, flags: 0x0},
-	548:  {region: 0x122, script: 0x5, flags: 0x0},
-	549:  {region: 0x165, script: 0x57, flags: 0x0},
-	550:  {region: 0x123, script: 0xdf, flags: 0x0},
-	551:  {region: 0x5a, script: 0x57, flags: 0x0},
-	552:  {region: 0x52, script: 0x57, flags: 0x0},
-	553:  {region: 0x165, script: 0x57, flags: 0x0},
-	554:  {region: 0x4f, script: 0x57, flags: 0x0},
-	555:  {region: 0x99, script: 0x21, flags: 0x0},
-	556:  {region: 0x99, script: 0x21, flags: 0x0},
-	557:  {region: 0x4b, script: 0x57, flags: 0x0},
-	558:  {region: 0x95, script: 0x57, flags: 0x0},
-	559:  {region: 0x165, script: 0x57, flags: 0x0},
-	560:  {region: 0x41, script: 0x57, flags: 0x0},
-	561:  {region: 0x99, script: 0x57, flags: 0x0},
-	562:  {region: 0x53, script: 0xd6, flags: 0x0},
-	563:  {region: 0x99, script: 0x21, flags: 0x0},
-	564:  {region: 0xc3, script: 0x57, flags: 0x0},
-	565:  {region: 0x165, script: 0x57, flags: 0x0},
-	566:  {region: 0x99, script: 0x72, flags: 0x0},
-	567:  {region: 0xe8, script: 0x5, flags: 0x0},
-	568:  {region: 0x165, script: 0x57, flags: 0x0},
-	569:  {region: 0xa4, script: 0x57, flags: 0x0},
-	570:  {region: 0x165, script: 0x57, flags: 0x0},
-	571:  {region: 0x12b, script: 0x57, flags: 0x0},
-	572:  {region: 0x165, script: 0x57, flags: 0x0},
-	573:  {region: 0xd2, script: 0x57, flags: 0x0},
-	574:  {region: 0x165, script: 0x57, flags: 0x0},
-	575:  {region: 0xaf, script: 0x54, flags: 0x0},
-	576:  {region: 0x165, script: 0x57, flags: 0x0},
-	577:  {region: 0x165, script: 0x57, flags: 0x0},
-	578:  {region: 0x13, script: 0x6, flags: 0x1},
-	579:  {region: 0x165, script: 0x57, flags: 0x0},
-	580:  {region: 0x52, script: 0x57, flags: 0x0},
-	581:  {region: 0x82, script: 0x57, flags: 0x0},
-	582:  {region: 0xa4, script: 0x57, flags: 0x0},
-	583:  {region: 0x165, script: 0x57, flags: 0x0},
-	584:  {region: 0x165, script: 0x57, flags: 0x0},
-	585:  {region: 0x165, script: 0x57, flags: 0x0},
-	586:  {region: 0xa6, script: 0x4b, flags: 0x0},
-	587:  {region: 0x2a, script: 0x57, flags: 0x0},
-	588:  {region: 0x165, script: 0x57, flags: 0x0},
-	589:  {region: 0x165, script: 0x57, flags: 0x0},
-	590:  {region: 0x165, script: 0x57, flags: 0x0},
-	591:  {region: 0x165, script: 0x57, flags: 0x0},
-	592:  {region: 0x165, script: 0x57, flags: 0x0},
-	593:  {region: 0x99, script: 0x4f, flags: 0x0},
-	594:  {region: 0x8b, script: 0x57, flags: 0x0},
-	595:  {region: 0x165, script: 0x57, flags: 0x0},
-	596:  {region: 0xab, script: 0x50, flags: 0x0},
-	597:  {region: 0x106, script: 0x1f, flags: 0x0},
-	598:  {region: 0x99, script: 0x21, flags: 0x0},
-	599:  {region: 0x165, script: 0x57, flags: 0x0},
-	600:  {region: 0x75, script: 0x57, flags: 0x0},
-	601:  {region: 0x165, script: 0x57, flags: 0x0},
-	602:  {region: 0xb4, script: 0x57, flags: 0x0},
-	603:  {region: 0x165, script: 0x57, flags: 0x0},
-	604:  {region: 0x165, script: 0x57, flags: 0x0},
-	605:  {region: 0x165, script: 0x57, flags: 0x0},
-	606:  {region: 0x165, script: 0x57, flags: 0x0},
-	607:  {region: 0x165, script: 0x57, flags: 0x0},
-	608:  {region: 0x165, script: 0x57, flags: 0x0},
-	609:  {region: 0x165, script: 0x57, flags: 0x0},
-	610:  {region: 0x165, script: 0x29, flags: 0x0},
-	611:  {region: 0x165, script: 0x57, flags: 0x0},
-	612:  {region: 0x106, script: 0x1f, flags: 0x0},
-	613:  {region: 0x112, script: 0x57, flags: 0x0},
-	614:  {region: 0xe7, script: 0x57, flags: 0x0},
-	615:  {region: 0x106, script: 0x57, flags: 0x0},
-	616:  {region: 0x165, script: 0x57, flags: 0x0},
-	617:  {region: 0x99, script: 0x21, flags: 0x0},
-	618:  {region: 0x99, script: 0x5, flags: 0x0},
-	619:  {region: 0x12f, script: 0x57, flags: 0x0},
-	620:  {region: 0x165, script: 0x57, flags: 0x0},
-	621:  {region: 0x52, script: 0x57, flags: 0x0},
-	622:  {region: 0x60, script: 0x57, flags: 0x0},
-	623:  {region: 0x165, script: 0x57, flags: 0x0},
-	624:  {region: 0x165, script: 0x57, flags: 0x0},
-	625:  {region: 0x165, script: 0x29, flags: 0x0},
-	626:  {region: 0x165, script: 0x57, flags: 0x0},
-	627:  {region: 0x165, script: 0x57, flags: 0x0},
-	628:  {region: 0x19, script: 0x3, flags: 0x1},
-	629:  {region: 0x165, script: 0x57, flags: 0x0},
-	630:  {region: 0x165, script: 0x57, flags: 0x0},
-	631:  {region: 0x165, script: 0x57, flags: 0x0},
-	632:  {region: 0x165, script: 0x57, flags: 0x0},
-	633:  {region: 0x106, script: 0x1f, flags: 0x0},
-	634:  {region: 0x165, script: 0x57, flags: 0x0},
-	635:  {region: 0x165, script: 0x57, flags: 0x0},
-	636:  {region: 0x165, script: 0x57, flags: 0x0},
-	637:  {region: 0x106, script: 0x1f, flags: 0x0},
-	638:  {region: 0x165, script: 0x57, flags: 0x0},
-	639:  {region: 0x95, script: 0x57, flags: 0x0},
-	640:  {region: 0xe8, script: 0x5, flags: 0x0},
-	641:  {region: 0x7b, script: 0x57, flags: 0x0},
-	642:  {region: 0x165, script: 0x57, flags: 0x0},
-	643:  {region: 0x165, script: 0x57, flags: 0x0},
-	644:  {region: 0x165, script: 0x57, flags: 0x0},
-	645:  {region: 0x165, script: 0x29, flags: 0x0},
-	646:  {region: 0x123, script: 0xdf, flags: 0x0},
-	647:  {region: 0xe8, script: 0x5, flags: 0x0},
-	648:  {region: 0x165, script: 0x57, flags: 0x0},
-	649:  {region: 0x165, script: 0x57, flags: 0x0},
-	650:  {region: 0x1c, script: 0x5, flags: 0x1},
-	651:  {region: 0x165, script: 0x57, flags: 0x0},
-	652:  {region: 0x165, script: 0x57, flags: 0x0},
-	653:  {region: 0x165, script: 0x57, flags: 0x0},
-	654:  {region: 0x138, script: 0x57, flags: 0x0},
-	655:  {region: 0x87, script: 0x5b, flags: 0x0},
-	656:  {region: 0x97, script: 0x3b, flags: 0x0},
-	657:  {region: 0x12f, script: 0x57, flags: 0x0},
-	658:  {region: 0xe8, script: 0x5, flags: 0x0},
-	659:  {region: 0x131, script: 0x57, flags: 0x0},
-	660:  {region: 0x165, script: 0x57, flags: 0x0},
-	661:  {region: 0xb7, script: 0x57, flags: 0x0},
-	662:  {region: 0x106, script: 0x1f, flags: 0x0},
-	663:  {region: 0x165, script: 0x57, flags: 0x0},
-	664:  {region: 0x95, script: 0x57, flags: 0x0},
-	665:  {region: 0x165, script: 0x57, flags: 0x0},
-	666:  {region: 0x53, script: 0xdf, flags: 0x0},
-	667:  {region: 0x165, script: 0x57, flags: 0x0},
-	668:  {region: 0x165, script: 0x57, flags: 0x0},
-	669:  {region: 0x165, script: 0x57, flags: 0x0},
-	670:  {region: 0x165, script: 0x57, flags: 0x0},
-	671:  {region: 0x99, script: 0x59, flags: 0x0},
-	672:  {region: 0x165, script: 0x57, flags: 0x0},
-	673:  {region: 0x165, script: 0x57, flags: 0x0},
-	674:  {region: 0x106, script: 0x1f, flags: 0x0},
-	675:  {region: 0x131, script: 0x57, flags: 0x0},
-	676:  {region: 0x165, script: 0x57, flags: 0x0},
-	677:  {region: 0xd9, script: 0x57, flags: 0x0},
-	678:  {region: 0x165, script: 0x57, flags: 0x0},
-	679:  {region: 0x165, script: 0x57, flags: 0x0},
-	680:  {region: 0x21, script: 0x2, flags: 0x1},
-	681:  {region: 0x165, script: 0x57, flags: 0x0},
-	682:  {region: 0x165, script: 0x57, flags: 0x0},
-	683:  {region: 0x9e, script: 0x57, flags: 0x0},
-	684:  {region: 0x53, script: 0x5d, flags: 0x0},
-	685:  {region: 0x95, script: 0x57, flags: 0x0},
-	686:  {region: 0x9c, script: 0x5, flags: 0x0},
-	687:  {region: 0x135, script: 0x57, flags: 0x0},
-	688:  {region: 0x165, script: 0x57, flags: 0x0},
-	689:  {region: 0x165, script: 0x57, flags: 0x0},
-	690:  {region: 0x99, script: 0xda, flags: 0x0},
-	691:  {region: 0x9e, script: 0x57, flags: 0x0},
-	692:  {region: 0x165, script: 0x57, flags: 0x0},
-	693:  {region: 0x4b, script: 0x57, flags: 0x0},
-	694:  {region: 0x165, script: 0x57, flags: 0x0},
-	695:  {region: 0x165, script: 0x57, flags: 0x0},
-	696:  {region: 0xaf, script: 0x54, flags: 0x0},
-	697:  {region: 0x165, script: 0x57, flags: 0x0},
-	698:  {region: 0x165, script: 0x57, flags: 0x0},
-	699:  {region: 0x4b, script: 0x57, flags: 0x0},
-	700:  {region: 0x165, script: 0x57, flags: 0x0},
-	701:  {region: 0x165, script: 0x57, flags: 0x0},
-	702:  {region: 0x162, script: 0x57, flags: 0x0},
-	703:  {region: 0x9c, script: 0x5, flags: 0x0},
-	704:  {region: 0xb6, script: 0x57, flags: 0x0},
-	705:  {region: 0xb8, script: 0x57, flags: 0x0},
-	706:  {region: 0x4b, script: 0x57, flags: 0x0},
-	707:  {region: 0x4b, script: 0x57, flags: 0x0},
-	708:  {region: 0xa4, script: 0x57, flags: 0x0},
-	709:  {region: 0xa4, script: 0x57, flags: 0x0},
-	710:  {region: 0x9c, script: 0x5, flags: 0x0},
-	711:  {region: 0xb8, script: 0x57, flags: 0x0},
-	712:  {region: 0x123, script: 0xdf, flags: 0x0},
-	713:  {region: 0x53, script: 0x38, flags: 0x0},
-	714:  {region: 0x12b, script: 0x57, flags: 0x0},
-	715:  {region: 0x95, script: 0x57, flags: 0x0},
-	716:  {region: 0x52, script: 0x57, flags: 0x0},
-	717:  {region: 0x99, script: 0x21, flags: 0x0},
-	718:  {region: 0x99, script: 0x21, flags: 0x0},
-	719:  {region: 0x95, script: 0x57, flags: 0x0},
-	720:  {region: 0x23, script: 0x3, flags: 0x1},
-	721:  {region: 0xa4, script: 0x57, flags: 0x0},
-	722:  {region: 0x165, script: 0x57, flags: 0x0},
-	723:  {region: 0xcf, script: 0x57, flags: 0x0},
-	724:  {region: 0x165, script: 0x57, flags: 0x0},
-	725:  {region: 0x165, script: 0x57, flags: 0x0},
-	726:  {region: 0x165, script: 0x57, flags: 0x0},
-	727:  {region: 0x165, script: 0x57, flags: 0x0},
-	728:  {region: 0x165, script: 0x57, flags: 0x0},
-	729:  {region: 0x165, script: 0x57, flags: 0x0},
-	730:  {region: 0x165, script: 0x57, flags: 0x0},
-	731:  {region: 0x165, script: 0x57, flags: 0x0},
-	732:  {region: 0x165, script: 0x57, flags: 0x0},
-	733:  {region: 0x165, script: 0x57, flags: 0x0},
-	734:  {region: 0x165, script: 0x57, flags: 0x0},
-	735:  {region: 0x165, script: 0x5, flags: 0x0},
-	736:  {region: 0x106, script: 0x1f, flags: 0x0},
-	737:  {region: 0xe7, script: 0x57, flags: 0x0},
-	738:  {region: 0x165, script: 0x57, flags: 0x0},
-	739:  {region: 0x95, script: 0x57, flags: 0x0},
-	740:  {region: 0x165, script: 0x29, flags: 0x0},
-	741:  {region: 0x165, script: 0x57, flags: 0x0},
-	742:  {region: 0x165, script: 0x57, flags: 0x0},
-	743:  {region: 0x165, script: 0x57, flags: 0x0},
-	744:  {region: 0x112, script: 0x57, flags: 0x0},
-	745:  {region: 0xa4, script: 0x57, flags: 0x0},
-	746:  {region: 0x165, script: 0x57, flags: 0x0},
-	747:  {region: 0x165, script: 0x57, flags: 0x0},
-	748:  {region: 0x123, script: 0x5, flags: 0x0},
-	749:  {region: 0xcc, script: 0x57, flags: 0x0},
-	750:  {region: 0x165, script: 0x57, flags: 0x0},
-	751:  {region: 0x165, script: 0x57, flags: 0x0},
-	752:  {region: 0x165, script: 0x57, flags: 0x0},
-	753:  {region: 0xbf, script: 0x57, flags: 0x0},
-	754:  {region: 0xd1, script: 0x57, flags: 0x0},
-	755:  {region: 0x165, script: 0x57, flags: 0x0},
-	756:  {region: 0x52, script: 0x57, flags: 0x0},
-	757:  {region: 0xdb, script: 0x21, flags: 0x0},
-	758:  {region: 0x12f, script: 0x57, flags: 0x0},
-	759:  {region: 0xc0, script: 0x57, flags: 0x0},
-	760:  {region: 0x165, script: 0x57, flags: 0x0},
-	761:  {region: 0x165, script: 0x57, flags: 0x0},
-	762:  {region: 0xe0, script: 0x57, flags: 0x0},
-	763:  {region: 0x165, script: 0x57, flags: 0x0},
-	764:  {region: 0x95, script: 0x57, flags: 0x0},
-	765:  {region: 0x9b, script: 0x3a, flags: 0x0},
-	766:  {region: 0x165, script: 0x57, flags: 0x0},
-	767:  {region: 0xc2, script: 0x1f, flags: 0x0},
-	768:  {region: 0x165, script: 0x5, flags: 0x0},
-	769:  {region: 0x165, script: 0x57, flags: 0x0},
-	770:  {region: 0x165, script: 0x57, flags: 0x0},
-	771:  {region: 0x165, script: 0x57, flags: 0x0},
-	772:  {region: 0x99, script: 0x6b, flags: 0x0},
-	773:  {region: 0x165, script: 0x57, flags: 0x0},
-	774:  {region: 0x165, script: 0x57, flags: 0x0},
-	775:  {region: 0x10b, script: 0x57, flags: 0x0},
-	776:  {region: 0x165, script: 0x57, flags: 0x0},
-	777:  {region: 0x165, script: 0x57, flags: 0x0},
-	778:  {region: 0x165, script: 0x57, flags: 0x0},
-	779:  {region: 0x26, script: 0x3, flags: 0x1},
-	780:  {region: 0x165, script: 0x57, flags: 0x0},
-	781:  {region: 0x165, script: 0x57, flags: 0x0},
-	782:  {region: 0x99, script: 0xe, flags: 0x0},
-	783:  {region: 0xc4, script: 0x72, flags: 0x0},
-	785:  {region: 0x165, script: 0x57, flags: 0x0},
-	786:  {region: 0x49, script: 0x57, flags: 0x0},
-	787:  {region: 0x49, script: 0x57, flags: 0x0},
-	788:  {region: 0x37, script: 0x57, flags: 0x0},
-	789:  {region: 0x165, script: 0x57, flags: 0x0},
-	790:  {region: 0x165, script: 0x57, flags: 0x0},
-	791:  {region: 0x165, script: 0x57, flags: 0x0},
-	792:  {region: 0x165, script: 0x57, flags: 0x0},
-	793:  {region: 0x165, script: 0x57, flags: 0x0},
-	794:  {region: 0x165, script: 0x57, flags: 0x0},
-	795:  {region: 0x99, script: 0x21, flags: 0x0},
-	796:  {region: 0xdb, script: 0x21, flags: 0x0},
-	797:  {region: 0x106, script: 0x1f, flags: 0x0},
-	798:  {region: 0x35, script: 0x6f, flags: 0x0},
-	799:  {region: 0x29, script: 0x3, flags: 0x1},
-	800:  {region: 0xcb, script: 0x57, flags: 0x0},
-	801:  {region: 0x165, script: 0x57, flags: 0x0},
-	802:  {region: 0x165, script: 0x57, flags: 0x0},
-	803:  {region: 0x165, script: 0x57, flags: 0x0},
-	804:  {region: 0x99, script: 0x21, flags: 0x0},
-	805:  {region: 0x52, script: 0x57, flags: 0x0},
-	807:  {region: 0x165, script: 0x57, flags: 0x0},
-	808:  {region: 0x135, script: 0x57, flags: 0x0},
-	809:  {region: 0x165, script: 0x57, flags: 0x0},
-	810:  {region: 0x165, script: 0x57, flags: 0x0},
-	811:  {region: 0xe8, script: 0x5, flags: 0x0},
-	812:  {region: 0xc3, script: 0x57, flags: 0x0},
-	813:  {region: 0x99, script: 0x21, flags: 0x0},
-	814:  {region: 0x95, script: 0x57, flags: 0x0},
-	815:  {region: 0x164, script: 0x57, flags: 0x0},
-	816:  {region: 0x165, script: 0x57, flags: 0x0},
-	817:  {region: 0xc4, script: 0x72, flags: 0x0},
-	818:  {region: 0x165, script: 0x57, flags: 0x0},
-	819:  {region: 0x165, script: 0x29, flags: 0x0},
-	820:  {region: 0x106, script: 0x1f, flags: 0x0},
-	821:  {region: 0x165, script: 0x57, flags: 0x0},
-	822:  {region: 0x131, script: 0x57, flags: 0x0},
-	823:  {region: 0x9c, script: 0x63, flags: 0x0},
-	824:  {region: 0x165, script: 0x57, flags: 0x0},
-	825:  {region: 0x165, script: 0x57, flags: 0x0},
-	826:  {region: 0x9c, script: 0x5, flags: 0x0},
-	827:  {region: 0x165, script: 0x57, flags: 0x0},
-	828:  {region: 0x165, script: 0x57, flags: 0x0},
-	829:  {region: 0x165, script: 0x57, flags: 0x0},
-	830:  {region: 0xdd, script: 0x57, flags: 0x0},
-	831:  {region: 0x165, script: 0x57, flags: 0x0},
-	832:  {region: 0x165, script: 0x57, flags: 0x0},
-	834:  {region: 0x165, script: 0x57, flags: 0x0},
-	835:  {region: 0x53, script: 0x38, flags: 0x0},
-	836:  {region: 0x9e, script: 0x57, flags: 0x0},
-	837:  {region: 0xd2, script: 0x57, flags: 0x0},
-	838:  {region: 0x165, script: 0x57, flags: 0x0},
-	839:  {region: 0xda, script: 0x57, flags: 0x0},
-	840:  {region: 0x165, script: 0x57, flags: 0x0},
-	841:  {region: 0x165, script: 0x57, flags: 0x0},
-	842:  {region: 0x165, script: 0x57, flags: 0x0},
-	843:  {region: 0xcf, script: 0x57, flags: 0x0},
-	844:  {region: 0x165, script: 0x57, flags: 0x0},
-	845:  {region: 0x165, script: 0x57, flags: 0x0},
-	846:  {region: 0x164, script: 0x57, flags: 0x0},
-	847:  {region: 0xd1, script: 0x57, flags: 0x0},
-	848:  {region: 0x60, script: 0x57, flags: 0x0},
-	849:  {region: 0xdb, script: 0x21, flags: 0x0},
-	850:  {region: 0x165, script: 0x57, flags: 0x0},
-	851:  {region: 0xdb, script: 0x21, flags: 0x0},
-	852:  {region: 0x165, script: 0x57, flags: 0x0},
-	853:  {region: 0x165, script: 0x57, flags: 0x0},
-	854:  {region: 0xd2, script: 0x57, flags: 0x0},
-	855:  {region: 0x165, script: 0x57, flags: 0x0},
-	856:  {region: 0x165, script: 0x57, flags: 0x0},
-	857:  {region: 0xd1, script: 0x57, flags: 0x0},
-	858:  {region: 0x165, script: 0x57, flags: 0x0},
-	859:  {region: 0xcf, script: 0x57, flags: 0x0},
-	860:  {region: 0xcf, script: 0x57, flags: 0x0},
-	861:  {region: 0x165, script: 0x57, flags: 0x0},
-	862:  {region: 0x165, script: 0x57, flags: 0x0},
-	863:  {region: 0x95, script: 0x57, flags: 0x0},
-	864:  {region: 0x165, script: 0x57, flags: 0x0},
-	865:  {region: 0xdf, script: 0x57, flags: 0x0},
-	866:  {region: 0x165, script: 0x57, flags: 0x0},
-	867:  {region: 0x165, script: 0x57, flags: 0x0},
-	868:  {region: 0x99, script: 0x57, flags: 0x0},
-	869:  {region: 0x165, script: 0x57, flags: 0x0},
-	870:  {region: 0x165, script: 0x57, flags: 0x0},
-	871:  {region: 0xd9, script: 0x57, flags: 0x0},
-	872:  {region: 0x52, script: 0x57, flags: 0x0},
-	873:  {region: 0x165, script: 0x57, flags: 0x0},
-	874:  {region: 0xda, script: 0x57, flags: 0x0},
-	875:  {region: 0x165, script: 0x57, flags: 0x0},
-	876:  {region: 0x52, script: 0x57, flags: 0x0},
-	877:  {region: 0x165, script: 0x57, flags: 0x0},
-	878:  {region: 0x165, script: 0x57, flags: 0x0},
-	879:  {region: 0xda, script: 0x57, flags: 0x0},
-	880:  {region: 0x123, script: 0x53, flags: 0x0},
-	881:  {region: 0x99, script: 0x21, flags: 0x0},
-	882:  {region: 0x10c, script: 0xbf, flags: 0x0},
-	883:  {region: 0x165, script: 0x57, flags: 0x0},
-	884:  {region: 0x165, script: 0x57, flags: 0x0},
-	885:  {region: 0x84, script: 0x78, flags: 0x0},
-	886:  {region: 0x161, script: 0x57, flags: 0x0},
-	887:  {region: 0x165, script: 0x57, flags: 0x0},
-	888:  {region: 0x49, script: 0x17, flags: 0x0},
-	889:  {region: 0x165, script: 0x57, flags: 0x0},
-	890:  {region: 0x161, script: 0x57, flags: 0x0},
-	891:  {region: 0x165, script: 0x57, flags: 0x0},
-	892:  {region: 0x165, script: 0x57, flags: 0x0},
-	893:  {region: 0x165, script: 0x57, flags: 0x0},
-	894:  {region: 0x165, script: 0x57, flags: 0x0},
-	895:  {region: 0x165, script: 0x57, flags: 0x0},
-	896:  {region: 0x117, script: 0x57, flags: 0x0},
-	897:  {region: 0x165, script: 0x57, flags: 0x0},
-	898:  {region: 0x165, script: 0x57, flags: 0x0},
-	899:  {region: 0x135, script: 0x57, flags: 0x0},
-	900:  {region: 0x165, script: 0x57, flags: 0x0},
-	901:  {region: 0x53, script: 0x57, flags: 0x0},
-	902:  {region: 0x165, script: 0x57, flags: 0x0},
-	903:  {region: 0xce, script: 0x57, flags: 0x0},
-	904:  {region: 0x12f, script: 0x57, flags: 0x0},
-	905:  {region: 0x131, script: 0x57, flags: 0x0},
-	906:  {region: 0x80, script: 0x57, flags: 0x0},
-	907:  {region: 0x78, script: 0x57, flags: 0x0},
-	908:  {region: 0x165, script: 0x57, flags: 0x0},
-	910:  {region: 0x165, script: 0x57, flags: 0x0},
-	911:  {region: 0x165, script: 0x57, flags: 0x0},
-	912:  {region: 0x6f, script: 0x57, flags: 0x0},
-	913:  {region: 0x165, script: 0x57, flags: 0x0},
-	914:  {region: 0x165, script: 0x57, flags: 0x0},
-	915:  {region: 0x165, script: 0x57, flags: 0x0},
-	916:  {region: 0x165, script: 0x57, flags: 0x0},
-	917:  {region: 0x99, script: 0x7d, flags: 0x0},
-	918:  {region: 0x165, script: 0x57, flags: 0x0},
-	919:  {region: 0x165, script: 0x5, flags: 0x0},
-	920:  {region: 0x7d, script: 0x1f, flags: 0x0},
-	921:  {region: 0x135, script: 0x7e, flags: 0x0},
-	922:  {region: 0x165, script: 0x5, flags: 0x0},
-	923:  {region: 0xc5, script: 0x7c, flags: 0x0},
-	924:  {region: 0x165, script: 0x57, flags: 0x0},
-	925:  {region: 0x2c, script: 0x3, flags: 0x1},
-	926:  {region: 0xe7, script: 0x57, flags: 0x0},
-	927:  {region: 0x2f, script: 0x2, flags: 0x1},
-	928:  {region: 0xe7, script: 0x57, flags: 0x0},
-	929:  {region: 0x30, script: 0x57, flags: 0x0},
-	930:  {region: 0xf0, script: 0x57, flags: 0x0},
-	931:  {region: 0x165, script: 0x57, flags: 0x0},
-	932:  {region: 0x78, script: 0x57, flags: 0x0},
-	933:  {region: 0xd6, script: 0x57, flags: 0x0},
-	934:  {region: 0x135, script: 0x57, flags: 0x0},
-	935:  {region: 0x49, script: 0x57, flags: 0x0},
-	936:  {region: 0x165, script: 0x57, flags: 0x0},
-	937:  {region: 0x9c, script: 0xe8, flags: 0x0},
-	938:  {region: 0x165, script: 0x57, flags: 0x0},
-	939:  {region: 0x60, script: 0x57, flags: 0x0},
-	940:  {region: 0x165, script: 0x5, flags: 0x0},
-	941:  {region: 0xb0, script: 0x87, flags: 0x0},
-	943:  {region: 0x165, script: 0x57, flags: 0x0},
-	944:  {region: 0x165, script: 0x57, flags: 0x0},
-	945:  {region: 0x99, script: 0x12, flags: 0x0},
-	946:  {region: 0xa4, script: 0x57, flags: 0x0},
-	947:  {region: 0xe9, script: 0x57, flags: 0x0},
-	948:  {region: 0x165, script: 0x57, flags: 0x0},
-	949:  {region: 0x9e, script: 0x57, flags: 0x0},
-	950:  {region: 0x165, script: 0x57, flags: 0x0},
-	951:  {region: 0x165, script: 0x57, flags: 0x0},
-	952:  {region: 0x87, script: 0x31, flags: 0x0},
-	953:  {region: 0x75, script: 0x57, flags: 0x0},
-	954:  {region: 0x165, script: 0x57, flags: 0x0},
-	955:  {region: 0xe8, script: 0x4a, flags: 0x0},
-	956:  {region: 0x9c, script: 0x5, flags: 0x0},
-	957:  {region: 0x1, script: 0x57, flags: 0x0},
-	958:  {region: 0x24, script: 0x5, flags: 0x0},
-	959:  {region: 0x165, script: 0x57, flags: 0x0},
-	960:  {region: 0x41, script: 0x57, flags: 0x0},
-	961:  {region: 0x165, script: 0x57, flags: 0x0},
-	962:  {region: 0x7a, script: 0x57, flags: 0x0},
-	963:  {region: 0x165, script: 0x57, flags: 0x0},
-	964:  {region: 0xe4, script: 0x57, flags: 0x0},
-	965:  {region: 0x89, script: 0x57, flags: 0x0},
-	966:  {region: 0x69, script: 0x57, flags: 0x0},
-	967:  {region: 0x165, script: 0x57, flags: 0x0},
-	968:  {region: 0x99, script: 0x21, flags: 0x0},
-	969:  {region: 0x165, script: 0x57, flags: 0x0},
-	970:  {region: 0x102, script: 0x57, flags: 0x0},
-	971:  {region: 0x95, script: 0x57, flags: 0x0},
-	972:  {region: 0x165, script: 0x57, flags: 0x0},
-	973:  {region: 0x165, script: 0x57, flags: 0x0},
-	974:  {region: 0x9e, script: 0x57, flags: 0x0},
-	975:  {region: 0x165, script: 0x5, flags: 0x0},
-	976:  {region: 0x99, script: 0x57, flags: 0x0},
-	977:  {region: 0x31, script: 0x2, flags: 0x1},
-	978:  {region: 0xdb, script: 0x21, flags: 0x0},
-	979:  {region: 0x35, script: 0xe, flags: 0x0},
-	980:  {region: 0x4e, script: 0x57, flags: 0x0},
-	981:  {region: 0x72, script: 0x57, flags: 0x0},
-	982:  {region: 0x4e, script: 0x57, flags: 0x0},
-	983:  {region: 0x9c, script: 0x5, flags: 0x0},
-	984:  {region: 0x10c, script: 0x57, flags: 0x0},
-	985:  {region: 0x3a, script: 0x57, flags: 0x0},
-	986:  {region: 0x165, script: 0x57, flags: 0x0},
-	987:  {region: 0xd1, script: 0x57, flags: 0x0},
-	988:  {region: 0x104, script: 0x57, flags: 0x0},
-	989:  {region: 0x95, script: 0x57, flags: 0x0},
-	990:  {region: 0x12f, script: 0x57, flags: 0x0},
-	991:  {region: 0x165, script: 0x57, flags: 0x0},
-	992:  {region: 0x165, script: 0x57, flags: 0x0},
-	993:  {region: 0x73, script: 0x57, flags: 0x0},
-	994:  {region: 0x106, script: 0x1f, flags: 0x0},
-	995:  {region: 0x130, script: 0x1f, flags: 0x0},
-	996:  {region: 0x109, script: 0x57, flags: 0x0},
-	997:  {region: 0x107, script: 0x57, flags: 0x0},
-	998:  {region: 0x12f, script: 0x57, flags: 0x0},
-	999:  {region: 0x165, script: 0x57, flags: 0x0},
-	1000: {region: 0xa2, script: 0x49, flags: 0x0},
-	1001: {region: 0x99, script: 0x21, flags: 0x0},
-	1002: {region: 0x80, script: 0x57, flags: 0x0},
-	1003: {region: 0x106, script: 0x1f, flags: 0x0},
-	1004: {region: 0xa4, script: 0x57, flags: 0x0},
-	1005: {region: 0x95, script: 0x57, flags: 0x0},
-	1006: {region: 0x99, script: 0x57, flags: 0x0},
-	1007: {region: 0x114, script: 0x57, flags: 0x0},
-	1008: {region: 0x99, script: 0xc3, flags: 0x0},
-	1009: {region: 0x165, script: 0x57, flags: 0x0},
-	1010: {region: 0x165, script: 0x57, flags: 0x0},
-	1011: {region: 0x12f, script: 0x57, flags: 0x0},
-	1012: {region: 0x9e, script: 0x57, flags: 0x0},
-	1013: {region: 0x99, script: 0x21, flags: 0x0},
-	1014: {region: 0x165, script: 0x5, flags: 0x0},
-	1015: {region: 0x9e, script: 0x57, flags: 0x0},
-	1016: {region: 0x7b, script: 0x57, flags: 0x0},
-	1017: {region: 0x49, script: 0x57, flags: 0x0},
-	1018: {region: 0x33, script: 0x4, flags: 0x1},
-	1019: {region: 0x9e, script: 0x57, flags: 0x0},
-	1020: {region: 0x9c, script: 0x5, flags: 0x0},
-	1021: {region: 0xda, script: 0x57, flags: 0x0},
-	1022: {region: 0x4f, script: 0x57, flags: 0x0},
-	1023: {region: 0xd1, script: 0x57, flags: 0x0},
-	1024: {region: 0xcf, script: 0x57, flags: 0x0},
-	1025: {region: 0xc3, script: 0x57, flags: 0x0},
-	1026: {region: 0x4c, script: 0x57, flags: 0x0},
-	1027: {region: 0x96, script: 0x7a, flags: 0x0},
-	1028: {region: 0xb6, script: 0x57, flags: 0x0},
-	1029: {region: 0x165, script: 0x29, flags: 0x0},
-	1030: {region: 0x165, script: 0x57, flags: 0x0},
-	1032: {region: 0xba, script: 0xdc, flags: 0x0},
-	1033: {region: 0x165, script: 0x57, flags: 0x0},
-	1034: {region: 0xc4, script: 0x72, flags: 0x0},
-	1035: {region: 0x165, script: 0x5, flags: 0x0},
-	1036: {region: 0xb3, script: 0xca, flags: 0x0},
-	1037: {region: 0x6f, script: 0x57, flags: 0x0},
-	1038: {region: 0x165, script: 0x57, flags: 0x0},
-	1039: {region: 0x165, script: 0x57, flags: 0x0},
-	1040: {region: 0x165, script: 0x57, flags: 0x0},
-	1041: {region: 0x165, script: 0x57, flags: 0x0},
-	1042: {region: 0x111, script: 0x57, flags: 0x0},
-	1043: {region: 0x165, script: 0x57, flags: 0x0},
-	1044: {region: 0xe8, script: 0x5, flags: 0x0},
-	1045: {region: 0x165, script: 0x57, flags: 0x0},
-	1046: {region: 0x10f, script: 0x57, flags: 0x0},
-	1047: {region: 0x165, script: 0x57, flags: 0x0},
-	1048: {region: 0xe9, script: 0x57, flags: 0x0},
-	1049: {region: 0x165, script: 0x57, flags: 0x0},
-	1050: {region: 0x95, script: 0x57, flags: 0x0},
-	1051: {region: 0x142, script: 0x57, flags: 0x0},
-	1052: {region: 0x10c, script: 0x57, flags: 0x0},
-	1054: {region: 0x10c, script: 0x57, flags: 0x0},
-	1055: {region: 0x72, script: 0x57, flags: 0x0},
-	1056: {region: 0x97, script: 0xc0, flags: 0x0},
-	1057: {region: 0x165, script: 0x57, flags: 0x0},
-	1058: {region: 0x72, script: 0x57, flags: 0x0},
-	1059: {region: 0x164, script: 0x57, flags: 0x0},
-	1060: {region: 0x165, script: 0x57, flags: 0x0},
-	1061: {region: 0xc3, script: 0x57, flags: 0x0},
-	1062: {region: 0x165, script: 0x57, flags: 0x0},
-	1063: {region: 0x165, script: 0x57, flags: 0x0},
-	1064: {region: 0x165, script: 0x57, flags: 0x0},
-	1065: {region: 0x115, script: 0x57, flags: 0x0},
-	1066: {region: 0x165, script: 0x57, flags: 0x0},
-	1067: {region: 0x165, script: 0x57, flags: 0x0},
-	1068: {region: 0x123, script: 0xdf, flags: 0x0},
-	1069: {region: 0x165, script: 0x57, flags: 0x0},
-	1070: {region: 0x165, script: 0x57, flags: 0x0},
-	1071: {region: 0x165, script: 0x57, flags: 0x0},
-	1072: {region: 0x165, script: 0x57, flags: 0x0},
-	1073: {region: 0x27, script: 0x57, flags: 0x0},
-	1074: {region: 0x37, script: 0x5, flags: 0x1},
-	1075: {region: 0x99, script: 0xcb, flags: 0x0},
-	1076: {region: 0x116, script: 0x57, flags: 0x0},
-	1077: {region: 0x114, script: 0x57, flags: 0x0},
-	1078: {region: 0x99, script: 0x21, flags: 0x0},
-	1079: {region: 0x161, script: 0x57, flags: 0x0},
-	1080: {region: 0x165, script: 0x57, flags: 0x0},
-	1081: {region: 0x165, script: 0x57, flags: 0x0},
-	1082: {region: 0x6d, script: 0x57, flags: 0x0},
-	1083: {region: 0x161, script: 0x57, flags: 0x0},
-	1084: {region: 0x165, script: 0x57, flags: 0x0},
-	1085: {region: 0x60, script: 0x57, flags: 0x0},
-	1086: {region: 0x95, script: 0x57, flags: 0x0},
-	1087: {region: 0x165, script: 0x57, flags: 0x0},
-	1088: {region: 0x165, script: 0x57, flags: 0x0},
-	1089: {region: 0x12f, script: 0x57, flags: 0x0},
-	1090: {region: 0x165, script: 0x57, flags: 0x0},
-	1091: {region: 0x84, script: 0x57, flags: 0x0},
-	1092: {region: 0x10c, script: 0x57, flags: 0x0},
-	1093: {region: 0x12f, script: 0x57, flags: 0x0},
-	1094: {region: 0x15f, script: 0x5, flags: 0x0},
-	1095: {region: 0x4b, script: 0x57, flags: 0x0},
-	1096: {region: 0x60, script: 0x57, flags: 0x0},
-	1097: {region: 0x165, script: 0x57, flags: 0x0},
-	1098: {region: 0x99, script: 0x21, flags: 0x0},
-	1099: {region: 0x95, script: 0x57, flags: 0x0},
-	1100: {region: 0x165, script: 0x57, flags: 0x0},
-	1101: {region: 0x35, script: 0xe, flags: 0x0},
-	1102: {region: 0x9b, script: 0xcf, flags: 0x0},
-	1103: {region: 0xe9, script: 0x57, flags: 0x0},
-	1104: {region: 0x99, script: 0xd7, flags: 0x0},
-	1105: {region: 0xdb, script: 0x21, flags: 0x0},
-	1106: {region: 0x165, script: 0x57, flags: 0x0},
-	1107: {region: 0x165, script: 0x57, flags: 0x0},
-	1108: {region: 0x165, script: 0x57, flags: 0x0},
-	1109: {region: 0x165, script: 0x57, flags: 0x0},
-	1110: {region: 0x165, script: 0x57, flags: 0x0},
-	1111: {region: 0x165, script: 0x57, flags: 0x0},
-	1112: {region: 0x165, script: 0x57, flags: 0x0},
-	1113: {region: 0x165, script: 0x57, flags: 0x0},
-	1114: {region: 0xe7, script: 0x57, flags: 0x0},
-	1115: {region: 0x165, script: 0x57, flags: 0x0},
-	1116: {region: 0x165, script: 0x57, flags: 0x0},
-	1117: {region: 0x99, script: 0x4f, flags: 0x0},
-	1118: {region: 0x53, script: 0xd5, flags: 0x0},
-	1119: {region: 0xdb, script: 0x21, flags: 0x0},
-	1120: {region: 0xdb, script: 0x21, flags: 0x0},
-	1121: {region: 0x99, script: 0xda, flags: 0x0},
-	1122: {region: 0x165, script: 0x57, flags: 0x0},
-	1123: {region: 0x112, script: 0x57, flags: 0x0},
-	1124: {region: 0x131, script: 0x57, flags: 0x0},
-	1125: {region: 0x126, script: 0x57, flags: 0x0},
-	1126: {region: 0x165, script: 0x57, flags: 0x0},
-	1127: {region: 0x3c, script: 0x3, flags: 0x1},
-	1128: {region: 0x165, script: 0x57, flags: 0x0},
-	1129: {region: 0x165, script: 0x57, flags: 0x0},
-	1130: {region: 0x165, script: 0x57, flags: 0x0},
-	1131: {region: 0x123, script: 0xdf, flags: 0x0},
-	1132: {region: 0xdb, script: 0x21, flags: 0x0},
-	1133: {region: 0xdb, script: 0x21, flags: 0x0},
-	1134: {region: 0xdb, script: 0x21, flags: 0x0},
-	1135: {region: 0x6f, script: 0x29, flags: 0x0},
-	1136: {region: 0x165, script: 0x57, flags: 0x0},
-	1137: {region: 0x6d, script: 0x29, flags: 0x0},
-	1138: {region: 0x165, script: 0x57, flags: 0x0},
-	1139: {region: 0x165, script: 0x57, flags: 0x0},
-	1140: {region: 0x165, script: 0x57, flags: 0x0},
-	1141: {region: 0xd6, script: 0x57, flags: 0x0},
-	1142: {region: 0x127, script: 0x57, flags: 0x0},
-	1143: {region: 0x125, script: 0x57, flags: 0x0},
-	1144: {region: 0x32, script: 0x57, flags: 0x0},
-	1145: {region: 0xdb, script: 0x21, flags: 0x0},
-	1146: {region: 0xe7, script: 0x57, flags: 0x0},
-	1147: {region: 0x165, script: 0x57, flags: 0x0},
-	1148: {region: 0x165, script: 0x57, flags: 0x0},
-	1149: {region: 0x32, script: 0x57, flags: 0x0},
-	1150: {region: 0xd4, script: 0x57, flags: 0x0},
-	1151: {region: 0x165, script: 0x57, flags: 0x0},
-	1152: {region: 0x161, script: 0x57, flags: 0x0},
-	1153: {region: 0x165, script: 0x57, flags: 0x0},
-	1154: {region: 0x129, script: 0x57, flags: 0x0},
-	1155: {region: 0x165, script: 0x57, flags: 0x0},
-	1156: {region: 0xce, script: 0x57, flags: 0x0},
-	1157: {region: 0x165, script: 0x57, flags: 0x0},
-	1158: {region: 0xe6, script: 0x57, flags: 0x0},
-	1159: {region: 0x165, script: 0x57, flags: 0x0},
-	1160: {region: 0x165, script: 0x57, flags: 0x0},
-	1161: {region: 0x165, script: 0x57, flags: 0x0},
-	1162: {region: 0x12b, script: 0x57, flags: 0x0},
-	1163: {region: 0x12b, script: 0x57, flags: 0x0},
-	1164: {region: 0x12e, script: 0x57, flags: 0x0},
-	1165: {region: 0x165, script: 0x5, flags: 0x0},
-	1166: {region: 0x161, script: 0x57, flags: 0x0},
-	1167: {region: 0x87, script: 0x31, flags: 0x0},
-	1168: {region: 0xdb, script: 0x21, flags: 0x0},
-	1169: {region: 0xe7, script: 0x57, flags: 0x0},
-	1170: {region: 0x43, script: 0xe0, flags: 0x0},
-	1171: {region: 0x165, script: 0x57, flags: 0x0},
-	1172: {region: 0x106, script: 0x1f, flags: 0x0},
-	1173: {region: 0x165, script: 0x57, flags: 0x0},
-	1174: {region: 0x165, script: 0x57, flags: 0x0},
-	1175: {region: 0x131, script: 0x57, flags: 0x0},
-	1176: {region: 0x165, script: 0x57, flags: 0x0},
-	1177: {region: 0x123, script: 0xdf, flags: 0x0},
-	1178: {region: 0x32, script: 0x57, flags: 0x0},
-	1179: {region: 0x165, script: 0x57, flags: 0x0},
-	1180: {region: 0x165, script: 0x57, flags: 0x0},
-	1181: {region: 0xce, script: 0x57, flags: 0x0},
-	1182: {region: 0x165, script: 0x57, flags: 0x0},
-	1183: {region: 0x165, script: 0x57, flags: 0x0},
-	1184: {region: 0x12d, script: 0x57, flags: 0x0},
-	1185: {region: 0x165, script: 0x57, flags: 0x0},
-	1187: {region: 0x165, script: 0x57, flags: 0x0},
-	1188: {region: 0xd4, script: 0x57, flags: 0x0},
-	1189: {region: 0x53, script: 0xd8, flags: 0x0},
-	1190: {region: 0xe5, script: 0x57, flags: 0x0},
-	1191: {region: 0x165, script: 0x57, flags: 0x0},
-	1192: {region: 0x106, script: 0x1f, flags: 0x0},
-	1193: {region: 0xba, script: 0x57, flags: 0x0},
-	1194: {region: 0x165, script: 0x57, flags: 0x0},
-	1195: {region: 0x106, script: 0x1f, flags: 0x0},
-	1196: {region: 0x3f, script: 0x4, flags: 0x1},
-	1197: {region: 0x11c, script: 0xe2, flags: 0x0},
-	1198: {region: 0x130, script: 0x1f, flags: 0x0},
-	1199: {region: 0x75, script: 0x57, flags: 0x0},
-	1200: {region: 0x2a, script: 0x57, flags: 0x0},
-	1202: {region: 0x43, script: 0x3, flags: 0x1},
-	1203: {region: 0x99, script: 0xe, flags: 0x0},
-	1204: {region: 0xe8, script: 0x5, flags: 0x0},
-	1205: {region: 0x165, script: 0x57, flags: 0x0},
-	1206: {region: 0x165, script: 0x57, flags: 0x0},
-	1207: {region: 0x165, script: 0x57, flags: 0x0},
-	1208: {region: 0x165, script: 0x57, flags: 0x0},
-	1209: {region: 0x165, script: 0x57, flags: 0x0},
-	1210: {region: 0x165, script: 0x57, flags: 0x0},
-	1211: {region: 0x165, script: 0x57, flags: 0x0},
-	1212: {region: 0x46, script: 0x4, flags: 0x1},
-	1213: {region: 0x165, script: 0x57, flags: 0x0},
-	1214: {region: 0xb4, script: 0xe3, flags: 0x0},
-	1215: {region: 0x165, script: 0x57, flags: 0x0},
-	1216: {region: 0x161, script: 0x57, flags: 0x0},
-	1217: {region: 0x9e, script: 0x57, flags: 0x0},
-	1218: {region: 0x106, script: 0x57, flags: 0x0},
-	1219: {region: 0x13e, script: 0x57, flags: 0x0},
-	1220: {region: 0x11b, script: 0x57, flags: 0x0},
-	1221: {region: 0x165, script: 0x57, flags: 0x0},
-	1222: {region: 0x36, script: 0x57, flags: 0x0},
-	1223: {region: 0x60, script: 0x57, flags: 0x0},
-	1224: {region: 0xd1, script: 0x57, flags: 0x0},
-	1225: {region: 0x1, script: 0x57, flags: 0x0},
-	1226: {region: 0x106, script: 0x57, flags: 0x0},
-	1227: {region: 0x6a, script: 0x57, flags: 0x0},
-	1228: {region: 0x12f, script: 0x57, flags: 0x0},
-	1229: {region: 0x165, script: 0x57, flags: 0x0},
-	1230: {region: 0x36, script: 0x57, flags: 0x0},
-	1231: {region: 0x4e, script: 0x57, flags: 0x0},
-	1232: {region: 0x165, script: 0x57, flags: 0x0},
-	1233: {region: 0x6f, script: 0x29, flags: 0x0},
-	1234: {region: 0x165, script: 0x57, flags: 0x0},
-	1235: {region: 0xe7, script: 0x57, flags: 0x0},
-	1236: {region: 0x2f, script: 0x57, flags: 0x0},
-	1237: {region: 0x99, script: 0xda, flags: 0x0},
-	1238: {region: 0x99, script: 0x21, flags: 0x0},
-	1239: {region: 0x165, script: 0x57, flags: 0x0},
-	1240: {region: 0x165, script: 0x57, flags: 0x0},
-	1241: {region: 0x165, script: 0x57, flags: 0x0},
-	1242: {region: 0x165, script: 0x57, flags: 0x0},
-	1243: {region: 0x165, script: 0x57, flags: 0x0},
-	1244: {region: 0x165, script: 0x57, flags: 0x0},
-	1245: {region: 0x165, script: 0x57, flags: 0x0},
-	1246: {region: 0x165, script: 0x57, flags: 0x0},
-	1247: {region: 0x165, script: 0x57, flags: 0x0},
-	1248: {region: 0x140, script: 0x57, flags: 0x0},
-	1249: {region: 0x165, script: 0x57, flags: 0x0},
-	1250: {region: 0x165, script: 0x57, flags: 0x0},
-	1251: {region: 0xa8, script: 0x5, flags: 0x0},
-	1252: {region: 0x165, script: 0x57, flags: 0x0},
-	1253: {region: 0x114, script: 0x57, flags: 0x0},
-	1254: {region: 0x165, script: 0x57, flags: 0x0},
-	1255: {region: 0x165, script: 0x57, flags: 0x0},
-	1256: {region: 0x165, script: 0x57, flags: 0x0},
-	1257: {region: 0x165, script: 0x57, flags: 0x0},
-	1258: {region: 0x99, script: 0x21, flags: 0x0},
-	1259: {region: 0x53, script: 0x38, flags: 0x0},
-	1260: {region: 0x165, script: 0x57, flags: 0x0},
-	1261: {region: 0x165, script: 0x57, flags: 0x0},
-	1262: {region: 0x41, script: 0x57, flags: 0x0},
-	1263: {region: 0x165, script: 0x57, flags: 0x0},
-	1264: {region: 0x12b, script: 0x18, flags: 0x0},
-	1265: {region: 0x165, script: 0x57, flags: 0x0},
-	1266: {region: 0x161, script: 0x57, flags: 0x0},
-	1267: {region: 0x165, script: 0x57, flags: 0x0},
-	1268: {region: 0x12b, script: 0x5f, flags: 0x0},
-	1269: {region: 0x12b, script: 0x60, flags: 0x0},
-	1270: {region: 0x7d, script: 0x2b, flags: 0x0},
-	1271: {region: 0x53, script: 0x64, flags: 0x0},
-	1272: {region: 0x10b, script: 0x69, flags: 0x0},
-	1273: {region: 0x108, script: 0x73, flags: 0x0},
-	1274: {region: 0x99, script: 0x21, flags: 0x0},
-	1275: {region: 0x131, script: 0x57, flags: 0x0},
-	1276: {region: 0x165, script: 0x57, flags: 0x0},
-	1277: {region: 0x9c, script: 0x8a, flags: 0x0},
-	1278: {region: 0x165, script: 0x57, flags: 0x0},
-	1279: {region: 0x15e, script: 0xc2, flags: 0x0},
-	1280: {region: 0x165, script: 0x57, flags: 0x0},
-	1281: {region: 0x165, script: 0x57, flags: 0x0},
-	1282: {region: 0xdb, script: 0x21, flags: 0x0},
-	1283: {region: 0x165, script: 0x57, flags: 0x0},
-	1284: {region: 0x165, script: 0x57, flags: 0x0},
-	1285: {region: 0xd1, script: 0x57, flags: 0x0},
-	1286: {region: 0x75, script: 0x57, flags: 0x0},
-	1287: {region: 0x165, script: 0x57, flags: 0x0},
-	1288: {region: 0x165, script: 0x57, flags: 0x0},
-	1289: {region: 0x52, script: 0x57, flags: 0x0},
-	1290: {region: 0x165, script: 0x57, flags: 0x0},
-	1291: {region: 0x165, script: 0x57, flags: 0x0},
-	1292: {region: 0x165, script: 0x57, flags: 0x0},
-	1293: {region: 0x52, script: 0x57, flags: 0x0},
-	1294: {region: 0x165, script: 0x57, flags: 0x0},
-	1295: {region: 0x165, script: 0x57, flags: 0x0},
-	1296: {region: 0x165, script: 0x57, flags: 0x0},
-	1297: {region: 0x165, script: 0x57, flags: 0x0},
-	1298: {region: 0x1, script: 0x3b, flags: 0x0},
-	1299: {region: 0x165, script: 0x57, flags: 0x0},
-	1300: {region: 0x165, script: 0x57, flags: 0x0},
-	1301: {region: 0x165, script: 0x57, flags: 0x0},
-	1302: {region: 0x165, script: 0x57, flags: 0x0},
-	1303: {region: 0x165, script: 0x57, flags: 0x0},
-	1304: {region: 0xd6, script: 0x57, flags: 0x0},
-	1305: {region: 0x165, script: 0x57, flags: 0x0},
-	1306: {region: 0x165, script: 0x57, flags: 0x0},
-	1307: {region: 0x165, script: 0x57, flags: 0x0},
-	1308: {region: 0x41, script: 0x57, flags: 0x0},
-	1309: {region: 0x165, script: 0x57, flags: 0x0},
-	1310: {region: 0xcf, script: 0x57, flags: 0x0},
-	1311: {region: 0x4a, script: 0x3, flags: 0x1},
-	1312: {region: 0x165, script: 0x57, flags: 0x0},
-	1313: {region: 0x165, script: 0x57, flags: 0x0},
-	1314: {region: 0x165, script: 0x57, flags: 0x0},
-	1315: {region: 0x53, script: 0x57, flags: 0x0},
-	1316: {region: 0x10b, script: 0x57, flags: 0x0},
-	1318: {region: 0xa8, script: 0x5, flags: 0x0},
-	1319: {region: 0xd9, script: 0x57, flags: 0x0},
-	1320: {region: 0xba, script: 0xdc, flags: 0x0},
-	1321: {region: 0x4d, script: 0x14, flags: 0x1},
-	1322: {region: 0x53, script: 0x79, flags: 0x0},
-	1323: {region: 0x165, script: 0x57, flags: 0x0},
-	1324: {region: 0x122, script: 0x57, flags: 0x0},
-	1325: {region: 0xd0, script: 0x57, flags: 0x0},
-	1326: {region: 0x165, script: 0x57, flags: 0x0},
-	1327: {region: 0x161, script: 0x57, flags: 0x0},
-	1329: {region: 0x12b, script: 0x57, flags: 0x0},
-}
-
-// likelyLangList holds lists info associated with likelyLang.
-// Size: 388 bytes, 97 elements
-var likelyLangList = [97]likelyScriptRegion{
-	0:  {region: 0x9c, script: 0x7, flags: 0x0},
-	1:  {region: 0xa1, script: 0x74, flags: 0x2},
-	2:  {region: 0x11c, script: 0x80, flags: 0x2},
-	3:  {region: 0x32, script: 0x57, flags: 0x0},
-	4:  {region: 0x9b, script: 0x5, flags: 0x4},
-	5:  {region: 0x9c, script: 0x5, flags: 0x4},
-	6:  {region: 0x106, script: 0x1f, flags: 0x4},
-	7:  {region: 0x9c, script: 0x5, flags: 0x2},
-	8:  {region: 0x106, script: 0x1f, flags: 0x0},
-	9:  {region: 0x38, script: 0x2c, flags: 0x2},
-	10: {region: 0x135, script: 0x57, flags: 0x0},
-	11: {region: 0x7b, script: 0xc5, flags: 0x2},
-	12: {region: 0x114, script: 0x57, flags: 0x0},
-	13: {region: 0x84, script: 0x1, flags: 0x2},
-	14: {region: 0x5d, script: 0x1e, flags: 0x0},
-	15: {region: 0x87, script: 0x5c, flags: 0x2},
-	16: {region: 0xd6, script: 0x57, flags: 0x0},
-	17: {region: 0x52, script: 0x5, flags: 0x4},
-	18: {region: 0x10b, script: 0x5, flags: 0x4},
-	19: {region: 0xae, script: 0x1f, flags: 0x0},
-	20: {region: 0x24, script: 0x5, flags: 0x4},
-	21: {region: 0x53, script: 0x5, flags: 0x4},
-	22: {region: 0x9c, script: 0x5, flags: 0x4},
-	23: {region: 0xc5, script: 0x5, flags: 0x4},
-	24: {region: 0x53, script: 0x5, flags: 0x2},
-	25: {region: 0x12b, script: 0x57, flags: 0x0},
-	26: {region: 0xb0, script: 0x5, flags: 0x4},
-	27: {region: 0x9b, script: 0x5, flags: 0x2},
-	28: {region: 0xa5, script: 0x1f, flags: 0x0},
-	29: {region: 0x53, script: 0x5, flags: 0x4},
-	30: {region: 0x12b, script: 0x57, flags: 0x4},
-	31: {region: 0x53, script: 0x5, flags: 0x2},
-	32: {region: 0x12b, script: 0x57, flags: 0x2},
-	33: {region: 0xdb, script: 0x21, flags: 0x0},
-	34: {region: 0x99, script: 0x5a, flags: 0x2},
-	35: {region: 0x83, script: 0x57, flags: 0x0},
-	36: {region: 0x84, script: 0x78, flags: 0x4},
-	37: {region: 0x84, script: 0x78, flags: 0x2},
-	38: {region: 0xc5, script: 0x1f, flags: 0x0},
-	39: {region: 0x53, script: 0x6d, flags: 0x4},
-	40: {region: 0x53, script: 0x6d, flags: 0x2},
-	41: {region: 0xd0, script: 0x57, flags: 0x0},
-	42: {region: 0x4a, script: 0x5, flags: 0x4},
-	43: {region: 0x95, script: 0x5, flags: 0x4},
-	44: {region: 0x99, script: 0x33, flags: 0x0},
-	45: {region: 0xe8, script: 0x5, flags: 0x4},
-	46: {region: 0xe8, script: 0x5, flags: 0x2},
-	47: {region: 0x9c, script: 0x84, flags: 0x0},
-	48: {region: 0x53, script: 0x85, flags: 0x2},
-	49: {region: 0xba, script: 0xdc, flags: 0x0},
-	50: {region: 0xd9, script: 0x57, flags: 0x4},
-	51: {region: 0xe8, script: 0x5, flags: 0x0},
-	52: {region: 0x99, script: 0x21, flags: 0x2},
-	53: {region: 0x99, script: 0x4c, flags: 0x2},
-	54: {region: 0x99, script: 0xc9, flags: 0x2},
-	55: {region: 0x105, script: 0x1f, flags: 0x0},
-	56: {region: 0xbd, script: 0x57, flags: 0x4},
-	57: {region: 0x104, script: 0x57, flags: 0x4},
-	58: {region: 0x106, script: 0x57, flags: 0x4},
-	59: {region: 0x12b, script: 0x57, flags: 0x4},
-	60: {region: 0x124, script: 0x1f, flags: 0x0},
-	61: {region: 0xe8, script: 0x5, flags: 0x4},
-	62: {region: 0xe8, script: 0x5, flags: 0x2},
-	63: {region: 0x53, script: 0x5, flags: 0x0},
-	64: {region: 0xae, script: 0x1f, flags: 0x4},
-	65: {region: 0xc5, script: 0x1f, flags: 0x4},
-	66: {region: 0xae, script: 0x1f, flags: 0x2},
-	67: {region: 0x99, script: 0xe, flags: 0x0},
-	68: {region: 0xdb, script: 0x21, flags: 0x4},
-	69: {region: 0xdb, script: 0x21, flags: 0x2},
-	70: {region: 0x137, script: 0x57, flags: 0x0},
-	71: {region: 0x24, script: 0x5, flags: 0x4},
-	72: {region: 0x53, script: 0x1f, flags: 0x4},
-	73: {region: 0x24, script: 0x5, flags: 0x2},
-	74: {region: 0x8d, script: 0x39, flags: 0x0},
-	75: {region: 0x53, script: 0x38, flags: 0x4},
-	76: {region: 0x53, script: 0x38, flags: 0x2},
-	77: {region: 0x53, script: 0x38, flags: 0x0},
-	78: {region: 0x2f, script: 0x39, flags: 0x4},
-	79: {region: 0x3e, script: 0x39, flags: 0x4},
-	80: {region: 0x7b, script: 0x39, flags: 0x4},
-	81: {region: 0x7e, script: 0x39, flags: 0x4},
-	82: {region: 0x8d, script: 0x39, flags: 0x4},
-	83: {region: 0x95, script: 0x39, flags: 0x4},
-	84: {region: 0xc6, script: 0x39, flags: 0x4},
-	85: {region: 0xd0, script: 0x39, flags: 0x4},
-	86: {region: 0xe2, script: 0x39, flags: 0x4},
-	87: {region: 0xe5, script: 0x39, flags: 0x4},
-	88: {region: 0xe7, script: 0x39, flags: 0x4},
-	89: {region: 0x116, script: 0x39, flags: 0x4},
-	90: {region: 0x123, script: 0x39, flags: 0x4},
-	91: {region: 0x12e, script: 0x39, flags: 0x4},
-	92: {region: 0x135, script: 0x39, flags: 0x4},
-	93: {region: 0x13e, script: 0x39, flags: 0x4},
-	94: {region: 0x12e, script: 0x11, flags: 0x2},
-	95: {region: 0x12e, script: 0x34, flags: 0x2},
-	96: {region: 0x12e, script: 0x39, flags: 0x2},
-}
-
-type likelyLangScript struct {
-	lang   uint16
-	script uint8
-	flags  uint8
-}
-
-// likelyRegion is a lookup table, indexed by regionID, for the most likely
-// languages and scripts given incomplete information. If more entries exist
-// for a given regionID, lang and script are the index and size respectively
-// of the list in likelyRegionList.
-// TODO: exclude containers and user-definable regions from the list.
-// Size: 1432 bytes, 358 elements
-var likelyRegion = [358]likelyLangScript{
-	34:  {lang: 0xd7, script: 0x57, flags: 0x0},
-	35:  {lang: 0x3a, script: 0x5, flags: 0x0},
-	36:  {lang: 0x0, script: 0x2, flags: 0x1},
-	39:  {lang: 0x2, script: 0x2, flags: 0x1},
-	40:  {lang: 0x4, script: 0x2, flags: 0x1},
-	42:  {lang: 0x3c0, script: 0x57, flags: 0x0},
-	43:  {lang: 0x0, script: 0x57, flags: 0x0},
-	44:  {lang: 0x13e, script: 0x57, flags: 0x0},
-	45:  {lang: 0x41b, script: 0x57, flags: 0x0},
-	46:  {lang: 0x10d, script: 0x57, flags: 0x0},
-	48:  {lang: 0x367, script: 0x57, flags: 0x0},
-	49:  {lang: 0x444, script: 0x57, flags: 0x0},
-	50:  {lang: 0x58, script: 0x57, flags: 0x0},
-	51:  {lang: 0x6, script: 0x2, flags: 0x1},
-	53:  {lang: 0xa5, script: 0xe, flags: 0x0},
-	54:  {lang: 0x367, script: 0x57, flags: 0x0},
-	55:  {lang: 0x15e, script: 0x57, flags: 0x0},
-	56:  {lang: 0x7e, script: 0x1f, flags: 0x0},
-	57:  {lang: 0x3a, script: 0x5, flags: 0x0},
-	58:  {lang: 0x3d9, script: 0x57, flags: 0x0},
-	59:  {lang: 0x15e, script: 0x57, flags: 0x0},
-	60:  {lang: 0x15e, script: 0x57, flags: 0x0},
-	62:  {lang: 0x31f, script: 0x57, flags: 0x0},
-	63:  {lang: 0x13e, script: 0x57, flags: 0x0},
-	64:  {lang: 0x3a1, script: 0x57, flags: 0x0},
-	65:  {lang: 0x3c0, script: 0x57, flags: 0x0},
-	67:  {lang: 0x8, script: 0x2, flags: 0x1},
-	69:  {lang: 0x0, script: 0x57, flags: 0x0},
-	71:  {lang: 0x71, script: 0x1f, flags: 0x0},
-	73:  {lang: 0x512, script: 0x3b, flags: 0x2},
-	74:  {lang: 0x31f, script: 0x5, flags: 0x2},
-	75:  {lang: 0x445, script: 0x57, flags: 0x0},
-	76:  {lang: 0x15e, script: 0x57, flags: 0x0},
-	77:  {lang: 0x15e, script: 0x57, flags: 0x0},
-	78:  {lang: 0x10d, script: 0x57, flags: 0x0},
-	79:  {lang: 0x15e, script: 0x57, flags: 0x0},
-	81:  {lang: 0x13e, script: 0x57, flags: 0x0},
-	82:  {lang: 0x15e, script: 0x57, flags: 0x0},
-	83:  {lang: 0xa, script: 0x4, flags: 0x1},
-	84:  {lang: 0x13e, script: 0x57, flags: 0x0},
-	85:  {lang: 0x0, script: 0x57, flags: 0x0},
-	86:  {lang: 0x13e, script: 0x57, flags: 0x0},
-	89:  {lang: 0x13e, script: 0x57, flags: 0x0},
-	90:  {lang: 0x3c0, script: 0x57, flags: 0x0},
-	91:  {lang: 0x3a1, script: 0x57, flags: 0x0},
-	93:  {lang: 0xe, script: 0x2, flags: 0x1},
-	94:  {lang: 0xfa, script: 0x57, flags: 0x0},
-	96:  {lang: 0x10d, script: 0x57, flags: 0x0},
-	98:  {lang: 0x1, script: 0x57, flags: 0x0},
-	99:  {lang: 0x101, script: 0x57, flags: 0x0},
-	101: {lang: 0x13e, script: 0x57, flags: 0x0},
-	103: {lang: 0x10, script: 0x2, flags: 0x1},
-	104: {lang: 0x13e, script: 0x57, flags: 0x0},
-	105: {lang: 0x13e, script: 0x57, flags: 0x0},
-	106: {lang: 0x140, script: 0x57, flags: 0x0},
-	107: {lang: 0x3a, script: 0x5, flags: 0x0},
-	108: {lang: 0x3a, script: 0x5, flags: 0x0},
-	109: {lang: 0x46f, script: 0x29, flags: 0x0},
-	110: {lang: 0x13e, script: 0x57, flags: 0x0},
-	111: {lang: 0x12, script: 0x2, flags: 0x1},
-	113: {lang: 0x10d, script: 0x57, flags: 0x0},
-	114: {lang: 0x151, script: 0x57, flags: 0x0},
-	115: {lang: 0x1c0, script: 0x21, flags: 0x2},
-	118: {lang: 0x158, script: 0x57, flags: 0x0},
-	120: {lang: 0x15e, script: 0x57, flags: 0x0},
-	122: {lang: 0x15e, script: 0x57, flags: 0x0},
-	123: {lang: 0x14, script: 0x2, flags: 0x1},
-	125: {lang: 0x16, script: 0x3, flags: 0x1},
-	126: {lang: 0x15e, script: 0x57, flags: 0x0},
-	128: {lang: 0x21, script: 0x57, flags: 0x0},
-	130: {lang: 0x245, script: 0x57, flags: 0x0},
-	132: {lang: 0x15e, script: 0x57, flags: 0x0},
-	133: {lang: 0x15e, script: 0x57, flags: 0x0},
-	134: {lang: 0x13e, script: 0x57, flags: 0x0},
-	135: {lang: 0x19, script: 0x2, flags: 0x1},
-	136: {lang: 0x0, script: 0x57, flags: 0x0},
-	137: {lang: 0x13e, script: 0x57, flags: 0x0},
-	139: {lang: 0x3c0, script: 0x57, flags: 0x0},
-	141: {lang: 0x529, script: 0x39, flags: 0x0},
-	142: {lang: 0x0, script: 0x57, flags: 0x0},
-	143: {lang: 0x13e, script: 0x57, flags: 0x0},
-	144: {lang: 0x1d1, script: 0x57, flags: 0x0},
-	145: {lang: 0x1d4, script: 0x57, flags: 0x0},
-	146: {lang: 0x1d5, script: 0x57, flags: 0x0},
-	148: {lang: 0x13e, script: 0x57, flags: 0x0},
-	149: {lang: 0x1b, script: 0x2, flags: 0x1},
-	151: {lang: 0x1bc, script: 0x3b, flags: 0x0},
-	153: {lang: 0x1d, script: 0x3, flags: 0x1},
-	155: {lang: 0x3a, script: 0x5, flags: 0x0},
-	156: {lang: 0x20, script: 0x2, flags: 0x1},
-	157: {lang: 0x1f8, script: 0x57, flags: 0x0},
-	158: {lang: 0x1f9, script: 0x57, flags: 0x0},
-	161: {lang: 0x3a, script: 0x5, flags: 0x0},
-	162: {lang: 0x200, script: 0x46, flags: 0x0},
-	164: {lang: 0x445, script: 0x57, flags: 0x0},
-	165: {lang: 0x28a, script: 0x1f, flags: 0x0},
-	166: {lang: 0x22, script: 0x3, flags: 0x1},
-	168: {lang: 0x25, script: 0x2, flags: 0x1},
-	170: {lang: 0x254, script: 0x50, flags: 0x0},
-	171: {lang: 0x254, script: 0x50, flags: 0x0},
-	172: {lang: 0x3a, script: 0x5, flags: 0x0},
-	174: {lang: 0x3e2, script: 0x1f, flags: 0x0},
-	175: {lang: 0x27, script: 0x2, flags: 0x1},
-	176: {lang: 0x3a, script: 0x5, flags: 0x0},
-	178: {lang: 0x10d, script: 0x57, flags: 0x0},
-	179: {lang: 0x40c, script: 0xca, flags: 0x0},
-	181: {lang: 0x43b, script: 0x57, flags: 0x0},
-	182: {lang: 0x2c0, script: 0x57, flags: 0x0},
-	183: {lang: 0x15e, script: 0x57, flags: 0x0},
-	184: {lang: 0x2c7, script: 0x57, flags: 0x0},
-	185: {lang: 0x3a, script: 0x5, flags: 0x0},
-	186: {lang: 0x29, script: 0x2, flags: 0x1},
-	187: {lang: 0x15e, script: 0x57, flags: 0x0},
-	188: {lang: 0x2b, script: 0x2, flags: 0x1},
-	189: {lang: 0x432, script: 0x57, flags: 0x0},
-	190: {lang: 0x15e, script: 0x57, flags: 0x0},
-	191: {lang: 0x2f1, script: 0x57, flags: 0x0},
-	194: {lang: 0x2d, script: 0x2, flags: 0x1},
-	195: {lang: 0xa0, script: 0x57, flags: 0x0},
-	196: {lang: 0x2f, script: 0x2, flags: 0x1},
-	197: {lang: 0x31, script: 0x2, flags: 0x1},
-	198: {lang: 0x33, script: 0x2, flags: 0x1},
-	200: {lang: 0x15e, script: 0x57, flags: 0x0},
-	201: {lang: 0x35, script: 0x2, flags: 0x1},
-	203: {lang: 0x320, script: 0x57, flags: 0x0},
-	204: {lang: 0x37, script: 0x3, flags: 0x1},
-	205: {lang: 0x128, script: 0xde, flags: 0x0},
-	207: {lang: 0x13e, script: 0x57, flags: 0x0},
-	208: {lang: 0x31f, script: 0x57, flags: 0x0},
-	209: {lang: 0x3c0, script: 0x57, flags: 0x0},
-	210: {lang: 0x16, script: 0x57, flags: 0x0},
-	211: {lang: 0x15e, script: 0x57, flags: 0x0},
-	212: {lang: 0x1b4, script: 0x57, flags: 0x0},
-	214: {lang: 0x1b4, script: 0x5, flags: 0x2},
-	216: {lang: 0x13e, script: 0x57, flags: 0x0},
-	217: {lang: 0x367, script: 0x57, flags: 0x0},
-	218: {lang: 0x347, script: 0x57, flags: 0x0},
-	219: {lang: 0x351, script: 0x21, flags: 0x0},
-	225: {lang: 0x3a, script: 0x5, flags: 0x0},
-	226: {lang: 0x13e, script: 0x57, flags: 0x0},
-	228: {lang: 0x13e, script: 0x57, flags: 0x0},
-	229: {lang: 0x15e, script: 0x57, flags: 0x0},
-	230: {lang: 0x486, script: 0x57, flags: 0x0},
-	231: {lang: 0x153, script: 0x57, flags: 0x0},
-	232: {lang: 0x3a, script: 0x3, flags: 0x1},
-	233: {lang: 0x3b3, script: 0x57, flags: 0x0},
-	234: {lang: 0x15e, script: 0x57, flags: 0x0},
-	236: {lang: 0x13e, script: 0x57, flags: 0x0},
-	237: {lang: 0x3a, script: 0x5, flags: 0x0},
-	238: {lang: 0x3c0, script: 0x57, flags: 0x0},
-	240: {lang: 0x3a2, script: 0x57, flags: 0x0},
-	241: {lang: 0x194, script: 0x57, flags: 0x0},
-	243: {lang: 0x3a, script: 0x5, flags: 0x0},
-	258: {lang: 0x15e, script: 0x57, flags: 0x0},
-	260: {lang: 0x3d, script: 0x2, flags: 0x1},
-	261: {lang: 0x432, script: 0x1f, flags: 0x0},
-	262: {lang: 0x3f, script: 0x2, flags: 0x1},
-	263: {lang: 0x3e5, script: 0x57, flags: 0x0},
-	264: {lang: 0x3a, script: 0x5, flags: 0x0},
-	266: {lang: 0x15e, script: 0x57, flags: 0x0},
-	267: {lang: 0x3a, script: 0x5, flags: 0x0},
-	268: {lang: 0x41, script: 0x2, flags: 0x1},
-	271: {lang: 0x416, script: 0x57, flags: 0x0},
-	272: {lang: 0x347, script: 0x57, flags: 0x0},
-	273: {lang: 0x43, script: 0x2, flags: 0x1},
-	275: {lang: 0x1f9, script: 0x57, flags: 0x0},
-	276: {lang: 0x15e, script: 0x57, flags: 0x0},
-	277: {lang: 0x429, script: 0x57, flags: 0x0},
-	278: {lang: 0x367, script: 0x57, flags: 0x0},
-	280: {lang: 0x3c0, script: 0x57, flags: 0x0},
-	282: {lang: 0x13e, script: 0x57, flags: 0x0},
-	284: {lang: 0x45, script: 0x2, flags: 0x1},
-	288: {lang: 0x15e, script: 0x57, flags: 0x0},
-	289: {lang: 0x15e, script: 0x57, flags: 0x0},
-	290: {lang: 0x47, script: 0x2, flags: 0x1},
-	291: {lang: 0x49, script: 0x3, flags: 0x1},
-	292: {lang: 0x4c, script: 0x2, flags: 0x1},
-	293: {lang: 0x477, script: 0x57, flags: 0x0},
-	294: {lang: 0x3c0, script: 0x57, flags: 0x0},
-	295: {lang: 0x476, script: 0x57, flags: 0x0},
-	296: {lang: 0x4e, script: 0x2, flags: 0x1},
-	297: {lang: 0x482, script: 0x57, flags: 0x0},
-	299: {lang: 0x50, script: 0x4, flags: 0x1},
-	301: {lang: 0x4a0, script: 0x57, flags: 0x0},
-	302: {lang: 0x54, script: 0x2, flags: 0x1},
-	303: {lang: 0x445, script: 0x57, flags: 0x0},
-	304: {lang: 0x56, script: 0x3, flags: 0x1},
-	305: {lang: 0x445, script: 0x57, flags: 0x0},
-	309: {lang: 0x512, script: 0x3b, flags: 0x2},
-	310: {lang: 0x13e, script: 0x57, flags: 0x0},
-	311: {lang: 0x4bc, script: 0x57, flags: 0x0},
-	312: {lang: 0x1f9, script: 0x57, flags: 0x0},
-	315: {lang: 0x13e, script: 0x57, flags: 0x0},
-	318: {lang: 0x4c3, script: 0x57, flags: 0x0},
-	319: {lang: 0x8a, script: 0x57, flags: 0x0},
-	320: {lang: 0x15e, script: 0x57, flags: 0x0},
-	322: {lang: 0x41b, script: 0x57, flags: 0x0},
-	333: {lang: 0x59, script: 0x2, flags: 0x1},
-	350: {lang: 0x3a, script: 0x5, flags: 0x0},
-	351: {lang: 0x5b, script: 0x2, flags: 0x1},
-	356: {lang: 0x423, script: 0x57, flags: 0x0},
-}
-
-// likelyRegionList holds lists info associated with likelyRegion.
-// Size: 372 bytes, 93 elements
-var likelyRegionList = [93]likelyLangScript{
-	0:  {lang: 0x148, script: 0x5, flags: 0x0},
-	1:  {lang: 0x476, script: 0x57, flags: 0x0},
-	2:  {lang: 0x431, script: 0x57, flags: 0x0},
-	3:  {lang: 0x2ff, script: 0x1f, flags: 0x0},
-	4:  {lang: 0x1d7, script: 0x8, flags: 0x0},
-	5:  {lang: 0x274, script: 0x57, flags: 0x0},
-	6:  {lang: 0xb7, script: 0x57, flags: 0x0},
-	7:  {lang: 0x432, script: 0x1f, flags: 0x0},
-	8:  {lang: 0x12d, script: 0xe0, flags: 0x0},
-	9:  {lang: 0x351, script: 0x21, flags: 0x0},
-	10: {lang: 0x529, script: 0x38, flags: 0x0},
-	11: {lang: 0x4ac, script: 0x5, flags: 0x0},
-	12: {lang: 0x523, script: 0x57, flags: 0x0},
-	13: {lang: 0x29a, script: 0xdf, flags: 0x0},
-	14: {lang: 0x136, script: 0x31, flags: 0x0},
-	15: {lang: 0x48a, script: 0x57, flags: 0x0},
-	16: {lang: 0x3a, script: 0x5, flags: 0x0},
-	17: {lang: 0x15e, script: 0x57, flags: 0x0},
-	18: {lang: 0x27, script: 0x29, flags: 0x0},
-	19: {lang: 0x139, script: 0x57, flags: 0x0},
-	20: {lang: 0x26a, script: 0x5, flags: 0x2},
-	21: {lang: 0x512, script: 0x3b, flags: 0x2},
-	22: {lang: 0x210, script: 0x2b, flags: 0x0},
-	23: {lang: 0x5, script: 0x1f, flags: 0x0},
-	24: {lang: 0x274, script: 0x57, flags: 0x0},
-	25: {lang: 0x136, script: 0x31, flags: 0x0},
-	26: {lang: 0x2ff, script: 0x1f, flags: 0x0},
-	27: {lang: 0x1e1, script: 0x57, flags: 0x0},
-	28: {lang: 0x31f, script: 0x5, flags: 0x0},
-	29: {lang: 0x1be, script: 0x21, flags: 0x0},
-	30: {lang: 0x4b4, script: 0x5, flags: 0x0},
-	31: {lang: 0x236, script: 0x72, flags: 0x0},
-	32: {lang: 0x148, script: 0x5, flags: 0x0},
-	33: {lang: 0x476, script: 0x57, flags: 0x0},
-	34: {lang: 0x24a, script: 0x4b, flags: 0x0},
-	35: {lang: 0xe6, script: 0x5, flags: 0x0},
-	36: {lang: 0x226, script: 0xdf, flags: 0x0},
-	37: {lang: 0x3a, script: 0x5, flags: 0x0},
-	38: {lang: 0x15e, script: 0x57, flags: 0x0},
-	39: {lang: 0x2b8, script: 0x54, flags: 0x0},
-	40: {lang: 0x226, script: 0xdf, flags: 0x0},
-	41: {lang: 0x3a, script: 0x5, flags: 0x0},
-	42: {lang: 0x15e, script: 0x57, flags: 0x0},
-	43: {lang: 0x3dc, script: 0x57, flags: 0x0},
-	44: {lang: 0x4ae, script: 0x1f, flags: 0x0},
-	45: {lang: 0x2ff, script: 0x1f, flags: 0x0},
-	46: {lang: 0x431, script: 0x57, flags: 0x0},
-	47: {lang: 0x331, script: 0x72, flags: 0x0},
-	48: {lang: 0x213, script: 0x57, flags: 0x0},
-	49: {lang: 0x30b, script: 0x1f, flags: 0x0},
-	50: {lang: 0x242, script: 0x5, flags: 0x0},
-	51: {lang: 0x529, script: 0x39, flags: 0x0},
-	52: {lang: 0x3c0, script: 0x57, flags: 0x0},
-	53: {lang: 0x3a, script: 0x5, flags: 0x0},
-	54: {lang: 0x15e, script: 0x57, flags: 0x0},
-	55: {lang: 0x2ed, script: 0x57, flags: 0x0},
-	56: {lang: 0x4b4, script: 0x5, flags: 0x0},
-	57: {lang: 0x88, script: 0x21, flags: 0x0},
-	58: {lang: 0x4b4, script: 0x5, flags: 0x0},
-	59: {lang: 0x4b4, script: 0x5, flags: 0x0},
-	60: {lang: 0xbe, script: 0x21, flags: 0x0},
-	61: {lang: 0x3dc, script: 0x57, flags: 0x0},
-	62: {lang: 0x7e, script: 0x1f, flags: 0x0},
-	63: {lang: 0x3e2, script: 0x1f, flags: 0x0},
-	64: {lang: 0x267, script: 0x57, flags: 0x0},
-	65: {lang: 0x444, script: 0x57, flags: 0x0},
-	66: {lang: 0x512, script: 0x3b, flags: 0x0},
-	67: {lang: 0x412, script: 0x57, flags: 0x0},
-	68: {lang: 0x4ae, script: 0x1f, flags: 0x0},
-	69: {lang: 0x3a, script: 0x5, flags: 0x0},
-	70: {lang: 0x15e, script: 0x57, flags: 0x0},
-	71: {lang: 0x15e, script: 0x57, flags: 0x0},
-	72: {lang: 0x35, script: 0x5, flags: 0x0},
-	73: {lang: 0x46b, script: 0xdf, flags: 0x0},
-	74: {lang: 0x2ec, script: 0x5, flags: 0x0},
-	75: {lang: 0x30f, script: 0x72, flags: 0x0},
-	76: {lang: 0x467, script: 0x1f, flags: 0x0},
-	77: {lang: 0x148, script: 0x5, flags: 0x0},
-	78: {lang: 0x3a, script: 0x5, flags: 0x0},
-	79: {lang: 0x15e, script: 0x57, flags: 0x0},
-	80: {lang: 0x48a, script: 0x57, flags: 0x0},
-	81: {lang: 0x58, script: 0x5, flags: 0x0},
-	82: {lang: 0x219, script: 0x1f, flags: 0x0},
-	83: {lang: 0x81, script: 0x31, flags: 0x0},
-	84: {lang: 0x529, script: 0x39, flags: 0x0},
-	85: {lang: 0x48c, script: 0x57, flags: 0x0},
-	86: {lang: 0x4ae, script: 0x1f, flags: 0x0},
-	87: {lang: 0x512, script: 0x3b, flags: 0x0},
-	88: {lang: 0x3b3, script: 0x57, flags: 0x0},
-	89: {lang: 0x431, script: 0x57, flags: 0x0},
-	90: {lang: 0x432, script: 0x1f, flags: 0x0},
-	91: {lang: 0x15e, script: 0x57, flags: 0x0},
-	92: {lang: 0x446, script: 0x5, flags: 0x0},
-}
-
-type likelyTag struct {
-	lang   uint16
-	region uint16
-	script uint8
-}
-
-// Size: 198 bytes, 33 elements
-var likelyRegionGroup = [33]likelyTag{
-	1:  {lang: 0x139, region: 0xd6, script: 0x57},
-	2:  {lang: 0x139, region: 0x135, script: 0x57},
-	3:  {lang: 0x3c0, region: 0x41, script: 0x57},
-	4:  {lang: 0x139, region: 0x2f, script: 0x57},
-	5:  {lang: 0x139, region: 0xd6, script: 0x57},
-	6:  {lang: 0x13e, region: 0xcf, script: 0x57},
-	7:  {lang: 0x445, region: 0x12f, script: 0x57},
-	8:  {lang: 0x3a, region: 0x6b, script: 0x5},
-	9:  {lang: 0x445, region: 0x4b, script: 0x57},
-	10: {lang: 0x139, region: 0x161, script: 0x57},
-	11: {lang: 0x139, region: 0x135, script: 0x57},
-	12: {lang: 0x139, region: 0x135, script: 0x57},
-	13: {lang: 0x13e, region: 0x59, script: 0x57},
-	14: {lang: 0x529, region: 0x53, script: 0x38},
-	15: {lang: 0x1be, region: 0x99, script: 0x21},
-	16: {lang: 0x1e1, region: 0x95, script: 0x57},
-	17: {lang: 0x1f9, region: 0x9e, script: 0x57},
-	18: {lang: 0x139, region: 0x2f, script: 0x57},
-	19: {lang: 0x139, region: 0xe6, script: 0x57},
-	20: {lang: 0x139, region: 0x8a, script: 0x57},
-	21: {lang: 0x41b, region: 0x142, script: 0x57},
-	22: {lang: 0x529, region: 0x53, script: 0x38},
-	23: {lang: 0x4bc, region: 0x137, script: 0x57},
-	24: {lang: 0x3a, region: 0x108, script: 0x5},
-	25: {lang: 0x3e2, region: 0x106, script: 0x1f},
-	26: {lang: 0x3e2, region: 0x106, script: 0x1f},
-	27: {lang: 0x139, region: 0x7b, script: 0x57},
-	28: {lang: 0x10d, region: 0x60, script: 0x57},
-	29: {lang: 0x139, region: 0xd6, script: 0x57},
-	30: {lang: 0x13e, region: 0x1f, script: 0x57},
-	31: {lang: 0x139, region: 0x9a, script: 0x57},
-	32: {lang: 0x139, region: 0x7b, script: 0x57},
-}
-
-// Size: 358 bytes, 358 elements
-var regionToGroups = [358]uint8{
-	// Entry 0 - 3F
-	0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x04,
-	0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x04, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00,
-	0x00, 0x04, 0x00, 0x00, 0x04, 0x01, 0x00, 0x00,
-	0x04, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x04,
-	// Entry 40 - 7F
-	0x04, 0x04, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x04, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x04, 0x00, 0x00, 0x04, 0x00, 0x04, 0x00,
-	0x00, 0x04, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x08,
-	0x00, 0x04, 0x00, 0x00, 0x08, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x04, 0x00,
-	// Entry 80 - BF
-	0x00, 0x00, 0x04, 0x00, 0x00, 0x04, 0x00, 0x00,
-	0x00, 0x04, 0x01, 0x00, 0x04, 0x02, 0x00, 0x04,
-	0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x04, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00,
-	0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x08, 0x08, 0x00, 0x00, 0x00, 0x04, 0x00,
-	// Entry C0 - FF
-	0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x02, 0x01,
-	0x04, 0x08, 0x04, 0x00, 0x00, 0x00, 0x00, 0x04,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x04, 0x00, 0x05, 0x00, 0x00, 0x00,
-	0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	// Entry 100 - 13F
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00,
-	0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x00, 0x04,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x08, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x01, 0x00, 0x05, 0x04, 0x00,
-	0x00, 0x04, 0x00, 0x04, 0x04, 0x05, 0x00, 0x00,
-	// Entry 140 - 17F
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-	0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-}
-
-// Size: 18 bytes, 3 elements
-var paradigmLocales = [3][3]uint16{
-	0: [3]uint16{0x139, 0x0, 0x7b},
-	1: [3]uint16{0x13e, 0x0, 0x1f},
-	2: [3]uint16{0x3c0, 0x41, 0xee},
-}
-
-type mutualIntelligibility struct {
-	want     uint16
-	have     uint16
-	distance uint8
-	oneway   bool
-}
-
-type scriptIntelligibility struct {
-	wantLang   uint16
-	haveLang   uint16
-	wantScript uint8
-	haveScript uint8
-	distance   uint8
-}
-
-type regionIntelligibility struct {
-	lang     uint16
-	script   uint8
-	group    uint8
-	distance uint8
-}
-
-// matchLang holds pairs of langIDs of base languages that are typically
-// mutually intelligible. Each pair is associated with a confidence and
-// whether the intelligibility goes one or both ways.
-// Size: 678 bytes, 113 elements
-var matchLang = [113]mutualIntelligibility{
-	0:   {want: 0x1d1, have: 0xb7, distance: 0x4, oneway: false},
-	1:   {want: 0x407, have: 0xb7, distance: 0x4, oneway: false},
-	2:   {want: 0x407, have: 0x1d1, distance: 0x4, oneway: false},
-	3:   {want: 0x407, have: 0x432, distance: 0x4, oneway: false},
-	4:   {want: 0x43a, have: 0x1, distance: 0x4, oneway: false},
-	5:   {want: 0x1a3, have: 0x10d, distance: 0x4, oneway: true},
-	6:   {want: 0x295, have: 0x10d, distance: 0x4, oneway: true},
-	7:   {want: 0x101, have: 0x36f, distance: 0x8, oneway: false},
-	8:   {want: 0x101, have: 0x347, distance: 0x8, oneway: false},
-	9:   {want: 0x5, have: 0x3e2, distance: 0xa, oneway: true},
-	10:  {want: 0xd, have: 0x139, distance: 0xa, oneway: true},
-	11:  {want: 0x16, have: 0x367, distance: 0xa, oneway: true},
-	12:  {want: 0x21, have: 0x139, distance: 0xa, oneway: true},
-	13:  {want: 0x56, have: 0x13e, distance: 0xa, oneway: true},
-	14:  {want: 0x58, have: 0x3e2, distance: 0xa, oneway: true},
-	15:  {want: 0x71, have: 0x3e2, distance: 0xa, oneway: true},
-	16:  {want: 0x75, have: 0x139, distance: 0xa, oneway: true},
-	17:  {want: 0x82, have: 0x1be, distance: 0xa, oneway: true},
-	18:  {want: 0xa5, have: 0x139, distance: 0xa, oneway: true},
-	19:  {want: 0xb2, have: 0x15e, distance: 0xa, oneway: true},
-	20:  {want: 0xdd, have: 0x153, distance: 0xa, oneway: true},
-	21:  {want: 0xe5, have: 0x139, distance: 0xa, oneway: true},
-	22:  {want: 0xe9, have: 0x3a, distance: 0xa, oneway: true},
-	23:  {want: 0xf0, have: 0x15e, distance: 0xa, oneway: true},
-	24:  {want: 0xf9, have: 0x15e, distance: 0xa, oneway: true},
-	25:  {want: 0x100, have: 0x139, distance: 0xa, oneway: true},
-	26:  {want: 0x130, have: 0x139, distance: 0xa, oneway: true},
-	27:  {want: 0x13c, have: 0x139, distance: 0xa, oneway: true},
-	28:  {want: 0x140, have: 0x151, distance: 0xa, oneway: true},
-	29:  {want: 0x145, have: 0x13e, distance: 0xa, oneway: true},
-	30:  {want: 0x158, have: 0x101, distance: 0xa, oneway: true},
-	31:  {want: 0x16d, have: 0x367, distance: 0xa, oneway: true},
-	32:  {want: 0x16e, have: 0x139, distance: 0xa, oneway: true},
-	33:  {want: 0x16f, have: 0x139, distance: 0xa, oneway: true},
-	34:  {want: 0x17e, have: 0x139, distance: 0xa, oneway: true},
-	35:  {want: 0x190, have: 0x13e, distance: 0xa, oneway: true},
-	36:  {want: 0x194, have: 0x13e, distance: 0xa, oneway: true},
-	37:  {want: 0x1a4, have: 0x1be, distance: 0xa, oneway: true},
-	38:  {want: 0x1b4, have: 0x139, distance: 0xa, oneway: true},
-	39:  {want: 0x1b8, have: 0x139, distance: 0xa, oneway: true},
-	40:  {want: 0x1d4, have: 0x15e, distance: 0xa, oneway: true},
-	41:  {want: 0x1d7, have: 0x3e2, distance: 0xa, oneway: true},
-	42:  {want: 0x1d9, have: 0x139, distance: 0xa, oneway: true},
-	43:  {want: 0x1e7, have: 0x139, distance: 0xa, oneway: true},
-	44:  {want: 0x1f8, have: 0x139, distance: 0xa, oneway: true},
-	45:  {want: 0x20e, have: 0x1e1, distance: 0xa, oneway: true},
-	46:  {want: 0x210, have: 0x139, distance: 0xa, oneway: true},
-	47:  {want: 0x22d, have: 0x15e, distance: 0xa, oneway: true},
-	48:  {want: 0x242, have: 0x3e2, distance: 0xa, oneway: true},
-	49:  {want: 0x24a, have: 0x139, distance: 0xa, oneway: true},
-	50:  {want: 0x251, have: 0x139, distance: 0xa, oneway: true},
-	51:  {want: 0x265, have: 0x139, distance: 0xa, oneway: true},
-	52:  {want: 0x274, have: 0x48a, distance: 0xa, oneway: true},
-	53:  {want: 0x28a, have: 0x3e2, distance: 0xa, oneway: true},
-	54:  {want: 0x28e, have: 0x1f9, distance: 0xa, oneway: true},
-	55:  {want: 0x2a3, have: 0x139, distance: 0xa, oneway: true},
-	56:  {want: 0x2b5, have: 0x15e, distance: 0xa, oneway: true},
-	57:  {want: 0x2b8, have: 0x139, distance: 0xa, oneway: true},
-	58:  {want: 0x2be, have: 0x139, distance: 0xa, oneway: true},
-	59:  {want: 0x2c3, have: 0x15e, distance: 0xa, oneway: true},
-	60:  {want: 0x2ed, have: 0x139, distance: 0xa, oneway: true},
-	61:  {want: 0x2f1, have: 0x15e, distance: 0xa, oneway: true},
-	62:  {want: 0x2fa, have: 0x139, distance: 0xa, oneway: true},
-	63:  {want: 0x2ff, have: 0x7e, distance: 0xa, oneway: true},
-	64:  {want: 0x304, have: 0x139, distance: 0xa, oneway: true},
-	65:  {want: 0x30b, have: 0x3e2, distance: 0xa, oneway: true},
-	66:  {want: 0x31b, have: 0x1be, distance: 0xa, oneway: true},
-	67:  {want: 0x31f, have: 0x1e1, distance: 0xa, oneway: true},
-	68:  {want: 0x320, have: 0x139, distance: 0xa, oneway: true},
-	69:  {want: 0x331, have: 0x139, distance: 0xa, oneway: true},
-	70:  {want: 0x351, have: 0x139, distance: 0xa, oneway: true},
-	71:  {want: 0x36a, have: 0x347, distance: 0xa, oneway: false},
-	72:  {want: 0x36a, have: 0x36f, distance: 0xa, oneway: true},
-	73:  {want: 0x37a, have: 0x139, distance: 0xa, oneway: true},
-	74:  {want: 0x387, have: 0x139, distance: 0xa, oneway: true},
-	75:  {want: 0x389, have: 0x139, distance: 0xa, oneway: true},
-	76:  {want: 0x38b, have: 0x15e, distance: 0xa, oneway: true},
-	77:  {want: 0x390, have: 0x139, distance: 0xa, oneway: true},
-	78:  {want: 0x395, have: 0x139, distance: 0xa, oneway: true},
-	79:  {want: 0x39d, have: 0x139, distance: 0xa, oneway: true},
-	80:  {want: 0x3a5, have: 0x139, distance: 0xa, oneway: true},
-	81:  {want: 0x3be, have: 0x139, distance: 0xa, oneway: true},
-	82:  {want: 0x3c4, have: 0x13e, distance: 0xa, oneway: true},
-	83:  {want: 0x3d4, have: 0x10d, distance: 0xa, oneway: true},
-	84:  {want: 0x3d9, have: 0x139, distance: 0xa, oneway: true},
-	85:  {want: 0x3e5, have: 0x15e, distance: 0xa, oneway: true},
-	86:  {want: 0x3e9, have: 0x1be, distance: 0xa, oneway: true},
-	87:  {want: 0x3fa, have: 0x139, distance: 0xa, oneway: true},
-	88:  {want: 0x40c, have: 0x139, distance: 0xa, oneway: true},
-	89:  {want: 0x423, have: 0x139, distance: 0xa, oneway: true},
-	90:  {want: 0x429, have: 0x139, distance: 0xa, oneway: true},
-	91:  {want: 0x431, have: 0x139, distance: 0xa, oneway: true},
-	92:  {want: 0x43b, have: 0x139, distance: 0xa, oneway: true},
-	93:  {want: 0x43e, have: 0x1e1, distance: 0xa, oneway: true},
-	94:  {want: 0x445, have: 0x139, distance: 0xa, oneway: true},
-	95:  {want: 0x450, have: 0x139, distance: 0xa, oneway: true},
-	96:  {want: 0x461, have: 0x139, distance: 0xa, oneway: true},
-	97:  {want: 0x467, have: 0x3e2, distance: 0xa, oneway: true},
-	98:  {want: 0x46f, have: 0x139, distance: 0xa, oneway: true},
-	99:  {want: 0x476, have: 0x3e2, distance: 0xa, oneway: true},
-	100: {want: 0x3883, have: 0x139, distance: 0xa, oneway: true},
-	101: {want: 0x480, have: 0x139, distance: 0xa, oneway: true},
-	102: {want: 0x482, have: 0x139, distance: 0xa, oneway: true},
-	103: {want: 0x494, have: 0x3e2, distance: 0xa, oneway: true},
-	104: {want: 0x49d, have: 0x139, distance: 0xa, oneway: true},
-	105: {want: 0x4ac, have: 0x529, distance: 0xa, oneway: true},
-	106: {want: 0x4b4, have: 0x139, distance: 0xa, oneway: true},
-	107: {want: 0x4bc, have: 0x3e2, distance: 0xa, oneway: true},
-	108: {want: 0x4e5, have: 0x15e, distance: 0xa, oneway: true},
-	109: {want: 0x4f2, have: 0x139, distance: 0xa, oneway: true},
-	110: {want: 0x512, have: 0x139, distance: 0xa, oneway: true},
-	111: {want: 0x518, have: 0x139, distance: 0xa, oneway: true},
-	112: {want: 0x52f, have: 0x139, distance: 0xa, oneway: true},
-}
-
-// matchScript holds pairs of scriptIDs where readers of one script
-// can typically also read the other. Each is associated with a confidence.
-// Size: 208 bytes, 26 elements
-var matchScript = [26]scriptIntelligibility{
-	0:  {wantLang: 0x432, haveLang: 0x432, wantScript: 0x57, haveScript: 0x1f, distance: 0x5},
-	1:  {wantLang: 0x432, haveLang: 0x432, wantScript: 0x1f, haveScript: 0x57, distance: 0x5},
-	2:  {wantLang: 0x58, haveLang: 0x3e2, wantScript: 0x57, haveScript: 0x1f, distance: 0xa},
-	3:  {wantLang: 0xa5, haveLang: 0x139, wantScript: 0xe, haveScript: 0x57, distance: 0xa},
-	4:  {wantLang: 0x1d7, haveLang: 0x3e2, wantScript: 0x8, haveScript: 0x1f, distance: 0xa},
-	5:  {wantLang: 0x210, haveLang: 0x139, wantScript: 0x2b, haveScript: 0x57, distance: 0xa},
-	6:  {wantLang: 0x24a, haveLang: 0x139, wantScript: 0x4b, haveScript: 0x57, distance: 0xa},
-	7:  {wantLang: 0x251, haveLang: 0x139, wantScript: 0x4f, haveScript: 0x57, distance: 0xa},
-	8:  {wantLang: 0x2b8, haveLang: 0x139, wantScript: 0x54, haveScript: 0x57, distance: 0xa},
-	9:  {wantLang: 0x304, haveLang: 0x139, wantScript: 0x6b, haveScript: 0x57, distance: 0xa},
-	10: {wantLang: 0x331, haveLang: 0x139, wantScript: 0x72, haveScript: 0x57, distance: 0xa},
-	11: {wantLang: 0x351, haveLang: 0x139, wantScript: 0x21, haveScript: 0x57, distance: 0xa},
-	12: {wantLang: 0x395, haveLang: 0x139, wantScript: 0x7d, haveScript: 0x57, distance: 0xa},
-	13: {wantLang: 0x39d, haveLang: 0x139, wantScript: 0x33, haveScript: 0x57, distance: 0xa},
-	14: {wantLang: 0x3be, haveLang: 0x139, wantScript: 0x5, haveScript: 0x57, distance: 0xa},
-	15: {wantLang: 0x3fa, haveLang: 0x139, wantScript: 0x5, haveScript: 0x57, distance: 0xa},
-	16: {wantLang: 0x40c, haveLang: 0x139, wantScript: 0xca, haveScript: 0x57, distance: 0xa},
-	17: {wantLang: 0x450, haveLang: 0x139, wantScript: 0xd7, haveScript: 0x57, distance: 0xa},
-	18: {wantLang: 0x461, haveLang: 0x139, wantScript: 0xda, haveScript: 0x57, distance: 0xa},
-	19: {wantLang: 0x46f, haveLang: 0x139, wantScript: 0x29, haveScript: 0x57, distance: 0xa},
-	20: {wantLang: 0x476, haveLang: 0x3e2, wantScript: 0x57, haveScript: 0x1f, distance: 0xa},
-	21: {wantLang: 0x4b4, haveLang: 0x139, wantScript: 0x5, haveScript: 0x57, distance: 0xa},
-	22: {wantLang: 0x4bc, haveLang: 0x3e2, wantScript: 0x57, haveScript: 0x1f, distance: 0xa},
-	23: {wantLang: 0x512, haveLang: 0x139, wantScript: 0x3b, haveScript: 0x57, distance: 0xa},
-	24: {wantLang: 0x529, haveLang: 0x529, wantScript: 0x38, haveScript: 0x39, distance: 0xf},
-	25: {wantLang: 0x529, haveLang: 0x529, wantScript: 0x39, haveScript: 0x38, distance: 0x13},
-}
-
-// Size: 90 bytes, 15 elements
-var matchRegion = [15]regionIntelligibility{
-	0:  {lang: 0x3a, script: 0x0, group: 0x4, distance: 0x4},
-	1:  {lang: 0x3a, script: 0x0, group: 0x84, distance: 0x4},
-	2:  {lang: 0x139, script: 0x0, group: 0x1, distance: 0x4},
-	3:  {lang: 0x139, script: 0x0, group: 0x81, distance: 0x4},
-	4:  {lang: 0x13e, script: 0x0, group: 0x3, distance: 0x4},
-	5:  {lang: 0x13e, script: 0x0, group: 0x83, distance: 0x4},
-	6:  {lang: 0x3c0, script: 0x0, group: 0x3, distance: 0x4},
-	7:  {lang: 0x3c0, script: 0x0, group: 0x83, distance: 0x4},
-	8:  {lang: 0x529, script: 0x39, group: 0x2, distance: 0x4},
-	9:  {lang: 0x529, script: 0x39, group: 0x82, distance: 0x4},
-	10: {lang: 0x3a, script: 0x0, group: 0x80, distance: 0x5},
-	11: {lang: 0x139, script: 0x0, group: 0x80, distance: 0x5},
-	12: {lang: 0x13e, script: 0x0, group: 0x80, distance: 0x5},
-	13: {lang: 0x3c0, script: 0x0, group: 0x80, distance: 0x5},
-	14: {lang: 0x529, script: 0x39, group: 0x80, distance: 0x5},
-}
-
-// Size: 264 bytes, 33 elements
-var regionContainment = [33]uint64{
-	// Entry 0 - 1F
-	0x00000001ffffffff, 0x00000000200007a2, 0x0000000000003044, 0x0000000000000008,
-	0x00000000803c0010, 0x0000000000000020, 0x0000000000000040, 0x0000000000000080,
-	0x0000000000000100, 0x0000000000000200, 0x0000000000000400, 0x000000004000384c,
-	0x0000000000001000, 0x0000000000002000, 0x0000000000004000, 0x0000000000008000,
-	0x0000000000010000, 0x0000000000020000, 0x0000000000040000, 0x0000000000080000,
-	0x0000000000100000, 0x0000000000200000, 0x0000000001c1c000, 0x0000000000800000,
-	0x0000000001000000, 0x000000001e020000, 0x0000000004000000, 0x0000000008000000,
-	0x0000000010000000, 0x00000000200006a0, 0x0000000040002048, 0x0000000080000000,
-	// Entry 20 - 3F
-	0x0000000100000000,
-}
-
-// regionInclusion maps region identifiers to sets of regions in regionInclusionBits,
-// where each set holds all groupings that are directly connected in a region
-// containment graph.
-// Size: 358 bytes, 358 elements
-var regionInclusion = [358]uint8{
-	// Entry 0 - 3F
-	0x00, 0x00, 0x01, 0x02, 0x03, 0x04, 0x05, 0x06,
-	0x07, 0x08, 0x09, 0x0a, 0x0b, 0x0c, 0x0d, 0x0e,
-	0x0f, 0x10, 0x11, 0x12, 0x13, 0x14, 0x15, 0x16,
-	0x17, 0x18, 0x19, 0x1a, 0x1b, 0x1c, 0x1d, 0x1e,
-	0x21, 0x22, 0x23, 0x24, 0x25, 0x26, 0x26, 0x23,
-	0x24, 0x26, 0x27, 0x22, 0x28, 0x29, 0x2a, 0x2b,
-	0x26, 0x2c, 0x24, 0x23, 0x26, 0x25, 0x2a, 0x2d,
-	0x2e, 0x24, 0x2f, 0x2d, 0x26, 0x30, 0x31, 0x28,
-	// Entry 40 - 7F
-	0x26, 0x28, 0x26, 0x25, 0x31, 0x22, 0x32, 0x33,
-	0x34, 0x30, 0x22, 0x27, 0x27, 0x27, 0x35, 0x2d,
-	0x29, 0x28, 0x27, 0x36, 0x28, 0x22, 0x34, 0x23,
-	0x21, 0x26, 0x2d, 0x26, 0x22, 0x37, 0x2e, 0x35,
-	0x2a, 0x22, 0x2f, 0x38, 0x26, 0x26, 0x21, 0x39,
-	0x39, 0x28, 0x38, 0x39, 0x39, 0x2f, 0x3a, 0x2f,
-	0x20, 0x21, 0x38, 0x3b, 0x28, 0x3c, 0x2c, 0x21,
-	0x2a, 0x35, 0x27, 0x38, 0x26, 0x24, 0x28, 0x2c,
-	// Entry 80 - BF
-	0x2d, 0x23, 0x30, 0x2d, 0x2d, 0x26, 0x27, 0x3a,
-	0x22, 0x34, 0x3c, 0x2d, 0x28, 0x36, 0x22, 0x34,
-	0x3a, 0x26, 0x2e, 0x21, 0x39, 0x31, 0x38, 0x24,
-	0x2c, 0x25, 0x22, 0x24, 0x25, 0x2c, 0x3a, 0x2c,
-	0x26, 0x24, 0x36, 0x21, 0x2f, 0x3d, 0x31, 0x3c,
-	0x2f, 0x26, 0x36, 0x36, 0x24, 0x26, 0x3d, 0x31,
-	0x24, 0x26, 0x35, 0x25, 0x2d, 0x32, 0x38, 0x2a,
-	0x38, 0x39, 0x39, 0x35, 0x33, 0x23, 0x26, 0x2f,
-	// Entry C0 - FF
-	0x3c, 0x21, 0x23, 0x2d, 0x31, 0x36, 0x36, 0x3c,
-	0x26, 0x2d, 0x26, 0x3a, 0x2f, 0x25, 0x2f, 0x34,
-	0x31, 0x2f, 0x32, 0x3b, 0x2d, 0x2b, 0x2d, 0x21,
-	0x34, 0x2a, 0x2c, 0x25, 0x21, 0x3c, 0x24, 0x29,
-	0x2b, 0x24, 0x34, 0x21, 0x28, 0x29, 0x3b, 0x31,
-	0x25, 0x2e, 0x30, 0x29, 0x26, 0x24, 0x3a, 0x21,
-	0x3c, 0x28, 0x21, 0x24, 0x21, 0x21, 0x1f, 0x21,
-	0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21,
-	// Entry 100 - 13F
-	0x21, 0x21, 0x2f, 0x21, 0x2e, 0x23, 0x33, 0x2f,
-	0x24, 0x3b, 0x2f, 0x39, 0x38, 0x31, 0x2d, 0x3a,
-	0x2c, 0x2e, 0x2d, 0x23, 0x2d, 0x2f, 0x28, 0x2f,
-	0x27, 0x33, 0x34, 0x26, 0x24, 0x32, 0x22, 0x26,
-	0x27, 0x22, 0x2d, 0x31, 0x3d, 0x29, 0x31, 0x3d,
-	0x39, 0x29, 0x31, 0x24, 0x26, 0x29, 0x36, 0x2f,
-	0x33, 0x2f, 0x21, 0x22, 0x21, 0x30, 0x28, 0x3d,
-	0x23, 0x26, 0x21, 0x28, 0x26, 0x26, 0x31, 0x3b,
-	// Entry 140 - 17F
-	0x29, 0x21, 0x29, 0x21, 0x21, 0x21, 0x21, 0x21,
-	0x21, 0x21, 0x21, 0x21, 0x21, 0x23, 0x21, 0x21,
-	0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21,
-	0x21, 0x21, 0x21, 0x21, 0x21, 0x24, 0x24, 0x2f,
-	0x23, 0x32, 0x2f, 0x27, 0x2f, 0x21,
-}
-
-// regionInclusionBits is an array of bit vectors where every vector represents
-// a set of region groupings.  These sets are used to compute the distance
-// between two regions for the purpose of language matching.
-// Size: 584 bytes, 73 elements
-var regionInclusionBits = [73]uint64{
-	// Entry 0 - 1F
-	0x0000000102400813, 0x00000000200007a3, 0x0000000000003844, 0x0000000040000808,
-	0x00000000803c0011, 0x0000000020000022, 0x0000000040000844, 0x0000000020000082,
-	0x0000000000000102, 0x0000000020000202, 0x0000000020000402, 0x000000004000384d,
-	0x0000000000001804, 0x0000000040002804, 0x0000000000404000, 0x0000000000408000,
-	0x0000000000410000, 0x0000000002020000, 0x0000000000040010, 0x0000000000080010,
-	0x0000000000100010, 0x0000000000200010, 0x0000000001c1c001, 0x0000000000c00000,
-	0x0000000001400000, 0x000000001e020001, 0x0000000006000000, 0x000000000a000000,
-	0x0000000012000000, 0x00000000200006a2, 0x0000000040002848, 0x0000000080000010,
-	// Entry 20 - 3F
-	0x0000000100000001, 0x0000000000000001, 0x0000000080000000, 0x0000000000020000,
-	0x0000000001000000, 0x0000000000008000, 0x0000000000002000, 0x0000000000000200,
-	0x0000000000000008, 0x0000000000200000, 0x0000000110000000, 0x0000000000040000,
-	0x0000000008000000, 0x0000000000000020, 0x0000000104000000, 0x0000000000000080,
-	0x0000000000001000, 0x0000000000010000, 0x0000000000000400, 0x0000000004000000,
-	0x0000000000000040, 0x0000000010000000, 0x0000000000004000, 0x0000000101000000,
-	0x0000000108000000, 0x0000000000000100, 0x0000000100020000, 0x0000000000080000,
-	0x0000000000100000, 0x0000000000800000, 0x00000001ffffffff, 0x0000000122400fb3,
-	// Entry 40 - 5F
-	0x00000001827c0813, 0x000000014240385f, 0x0000000103c1c813, 0x000000011e420813,
-	0x0000000112000001, 0x0000000106000001, 0x0000000101400001, 0x000000010a000001,
-	0x0000000102020001,
-}
-
-// regionInclusionNext marks, for each entry in regionInclusionBits, the set of
-// all groups that are reachable from the groups set in the respective entry.
-// Size: 73 bytes, 73 elements
-var regionInclusionNext = [73]uint8{
-	// Entry 0 - 3F
-	0x3e, 0x3f, 0x0b, 0x0b, 0x40, 0x01, 0x0b, 0x01,
-	0x01, 0x01, 0x01, 0x41, 0x0b, 0x0b, 0x16, 0x16,
-	0x16, 0x19, 0x04, 0x04, 0x04, 0x04, 0x42, 0x16,
-	0x16, 0x43, 0x19, 0x19, 0x19, 0x01, 0x0b, 0x04,
-	0x00, 0x00, 0x1f, 0x11, 0x18, 0x0f, 0x0d, 0x09,
-	0x03, 0x15, 0x44, 0x12, 0x1b, 0x05, 0x45, 0x07,
-	0x0c, 0x10, 0x0a, 0x1a, 0x06, 0x1c, 0x0e, 0x46,
-	0x47, 0x08, 0x48, 0x13, 0x14, 0x17, 0x3e, 0x3e,
-	// Entry 40 - 7F
-	0x3e, 0x3e, 0x3e, 0x3e, 0x43, 0x43, 0x42, 0x43,
-	0x43,
-}
-
-type parentRel struct {
-	lang       uint16
-	script     uint8
-	maxScript  uint8
-	toRegion   uint16
-	fromRegion []uint16
-}
-
-// Size: 414 bytes, 5 elements
-var parents = [5]parentRel{
-	0: {lang: 0x139, script: 0x0, maxScript: 0x57, toRegion: 0x1, fromRegion: []uint16{0x1a, 0x25, 0x26, 0x2f, 0x34, 0x36, 0x3d, 0x42, 0x46, 0x48, 0x49, 0x4a, 0x50, 0x52, 0x5c, 0x5d, 0x61, 0x64, 0x6d, 0x73, 0x74, 0x75, 0x7b, 0x7c, 0x7f, 0x80, 0x81, 0x83, 0x8c, 0x8d, 0x96, 0x97, 0x98, 0x99, 0x9a, 0x9f, 0xa0, 0xa4, 0xa7, 0xa9, 0xad, 0xb1, 0xb4, 0xb5, 0xbf, 0xc6, 0xca, 0xcb, 0xcc, 0xce, 0xd0, 0xd2, 0xd5, 0xd6, 0xdd, 0xdf, 0xe0, 0xe6, 0xe7, 0xe8, 0xeb, 0xf0, 0x107, 0x109, 0x10a, 0x10b, 0x10d, 0x10e, 0x112, 0x117, 0x11b, 0x11d, 0x11f, 0x125, 0x129, 0x12c, 0x12d, 0x12f, 0x131, 0x139, 0x13c, 0x13f, 0x142, 0x161, 0x162, 0x164}},
-	1: {lang: 0x139, script: 0x0, maxScript: 0x57, toRegion: 0x1a, fromRegion: []uint16{0x2e, 0x4e, 0x60, 0x63, 0x72, 0xd9, 0x10c, 0x10f}},
-	2: {lang: 0x13e, script: 0x0, maxScript: 0x57, toRegion: 0x1f, fromRegion: []uint16{0x2c, 0x3f, 0x41, 0x48, 0x51, 0x54, 0x56, 0x59, 0x65, 0x69, 0x89, 0x8f, 0xcf, 0xd8, 0xe2, 0xe4, 0xec, 0xf1, 0x11a, 0x135, 0x136, 0x13b}},
-	3: {lang: 0x3c0, script: 0x0, maxScript: 0x57, toRegion: 0xee, fromRegion: []uint16{0x2a, 0x4e, 0x5a, 0x86, 0x8b, 0xb7, 0xc6, 0xd1, 0x118, 0x126}},
-	4: {lang: 0x529, script: 0x39, maxScript: 0x39, toRegion: 0x8d, fromRegion: []uint16{0xc6}},
-}
-
-// Total table size 27238 bytes (26KiB); checksum: C9BBE4D5
diff --git a/vendor/golang.org/x/text/language/tags.go b/vendor/golang.org/x/text/language/tags.go
deleted file mode 100644
index de30155..0000000
--- a/vendor/golang.org/x/text/language/tags.go
+++ /dev/null
@@ -1,143 +0,0 @@
-// Copyright 2013 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-package language
-
-// TODO: Various sets of commonly use tags and regions.
-
-// MustParse is like Parse, but panics if the given BCP 47 tag cannot be parsed.
-// It simplifies safe initialization of Tag values.
-func MustParse(s string) Tag {
-	t, err := Parse(s)
-	if err != nil {
-		panic(err)
-	}
-	return t
-}
-
-// MustParse is like Parse, but panics if the given BCP 47 tag cannot be parsed.
-// It simplifies safe initialization of Tag values.
-func (c CanonType) MustParse(s string) Tag {
-	t, err := c.Parse(s)
-	if err != nil {
-		panic(err)
-	}
-	return t
-}
-
-// MustParseBase is like ParseBase, but panics if the given base cannot be parsed.
-// It simplifies safe initialization of Base values.
-func MustParseBase(s string) Base {
-	b, err := ParseBase(s)
-	if err != nil {
-		panic(err)
-	}
-	return b
-}
-
-// MustParseScript is like ParseScript, but panics if the given script cannot be
-// parsed. It simplifies safe initialization of Script values.
-func MustParseScript(s string) Script {
-	scr, err := ParseScript(s)
-	if err != nil {
-		panic(err)
-	}
-	return scr
-}
-
-// MustParseRegion is like ParseRegion, but panics if the given region cannot be
-// parsed. It simplifies safe initialization of Region values.
-func MustParseRegion(s string) Region {
-	r, err := ParseRegion(s)
-	if err != nil {
-		panic(err)
-	}
-	return r
-}
-
-var (
-	und = Tag{}
-
-	Und Tag = Tag{}
-
-	Afrikaans            Tag = Tag{lang: _af}                //  af
-	Amharic              Tag = Tag{lang: _am}                //  am
-	Arabic               Tag = Tag{lang: _ar}                //  ar
-	ModernStandardArabic Tag = Tag{lang: _ar, region: _001}  //  ar-001
-	Azerbaijani          Tag = Tag{lang: _az}                //  az
-	Bulgarian            Tag = Tag{lang: _bg}                //  bg
-	Bengali              Tag = Tag{lang: _bn}                //  bn
-	Catalan              Tag = Tag{lang: _ca}                //  ca
-	Czech                Tag = Tag{lang: _cs}                //  cs
-	Danish               Tag = Tag{lang: _da}                //  da
-	German               Tag = Tag{lang: _de}                //  de
-	Greek                Tag = Tag{lang: _el}                //  el
-	English              Tag = Tag{lang: _en}                //  en
-	AmericanEnglish      Tag = Tag{lang: _en, region: _US}   //  en-US
-	BritishEnglish       Tag = Tag{lang: _en, region: _GB}   //  en-GB
-	Spanish              Tag = Tag{lang: _es}                //  es
-	EuropeanSpanish      Tag = Tag{lang: _es, region: _ES}   //  es-ES
-	LatinAmericanSpanish Tag = Tag{lang: _es, region: _419}  //  es-419
-	Estonian             Tag = Tag{lang: _et}                //  et
-	Persian              Tag = Tag{lang: _fa}                //  fa
-	Finnish              Tag = Tag{lang: _fi}                //  fi
-	Filipino             Tag = Tag{lang: _fil}               //  fil
-	French               Tag = Tag{lang: _fr}                //  fr
-	CanadianFrench       Tag = Tag{lang: _fr, region: _CA}   //  fr-CA
-	Gujarati             Tag = Tag{lang: _gu}                //  gu
-	Hebrew               Tag = Tag{lang: _he}                //  he
-	Hindi                Tag = Tag{lang: _hi}                //  hi
-	Croatian             Tag = Tag{lang: _hr}                //  hr
-	Hungarian            Tag = Tag{lang: _hu}                //  hu
-	Armenian             Tag = Tag{lang: _hy}                //  hy
-	Indonesian           Tag = Tag{lang: _id}                //  id
-	Icelandic            Tag = Tag{lang: _is}                //  is
-	Italian              Tag = Tag{lang: _it}                //  it
-	Japanese             Tag = Tag{lang: _ja}                //  ja
-	Georgian             Tag = Tag{lang: _ka}                //  ka
-	Kazakh               Tag = Tag{lang: _kk}                //  kk
-	Khmer                Tag = Tag{lang: _km}                //  km
-	Kannada              Tag = Tag{lang: _kn}                //  kn
-	Korean               Tag = Tag{lang: _ko}                //  ko
-	Kirghiz              Tag = Tag{lang: _ky}                //  ky
-	Lao                  Tag = Tag{lang: _lo}                //  lo
-	Lithuanian           Tag = Tag{lang: _lt}                //  lt
-	Latvian              Tag = Tag{lang: _lv}                //  lv
-	Macedonian           Tag = Tag{lang: _mk}                //  mk
-	Malayalam            Tag = Tag{lang: _ml}                //  ml
-	Mongolian            Tag = Tag{lang: _mn}                //  mn
-	Marathi              Tag = Tag{lang: _mr}                //  mr
-	Malay                Tag = Tag{lang: _ms}                //  ms
-	Burmese              Tag = Tag{lang: _my}                //  my
-	Nepali               Tag = Tag{lang: _ne}                //  ne
-	Dutch                Tag = Tag{lang: _nl}                //  nl
-	Norwegian            Tag = Tag{lang: _no}                //  no
-	Punjabi              Tag = Tag{lang: _pa}                //  pa
-	Polish               Tag = Tag{lang: _pl}                //  pl
-	Portuguese           Tag = Tag{lang: _pt}                //  pt
-	BrazilianPortuguese  Tag = Tag{lang: _pt, region: _BR}   //  pt-BR
-	EuropeanPortuguese   Tag = Tag{lang: _pt, region: _PT}   //  pt-PT
-	Romanian             Tag = Tag{lang: _ro}                //  ro
-	Russian              Tag = Tag{lang: _ru}                //  ru
-	Sinhala              Tag = Tag{lang: _si}                //  si
-	Slovak               Tag = Tag{lang: _sk}                //  sk
-	Slovenian            Tag = Tag{lang: _sl}                //  sl
-	Albanian             Tag = Tag{lang: _sq}                //  sq
-	Serbian              Tag = Tag{lang: _sr}                //  sr
-	SerbianLatin         Tag = Tag{lang: _sr, script: _Latn} //  sr-Latn
-	Swedish              Tag = Tag{lang: _sv}                //  sv
-	Swahili              Tag = Tag{lang: _sw}                //  sw
-	Tamil                Tag = Tag{lang: _ta}                //  ta
-	Telugu               Tag = Tag{lang: _te}                //  te
-	Thai                 Tag = Tag{lang: _th}                //  th
-	Turkish              Tag = Tag{lang: _tr}                //  tr
-	Ukrainian            Tag = Tag{lang: _uk}                //  uk
-	Urdu                 Tag = Tag{lang: _ur}                //  ur
-	Uzbek                Tag = Tag{lang: _uz}                //  uz
-	Vietnamese           Tag = Tag{lang: _vi}                //  vi
-	Chinese              Tag = Tag{lang: _zh}                //  zh
-	SimplifiedChinese    Tag = Tag{lang: _zh, script: _Hans} //  zh-Hans
-	TraditionalChinese   Tag = Tag{lang: _zh, script: _Hant} //  zh-Hant
-	Zulu                 Tag = Tag{lang: _zu}                //  zu
-)
author	Reinhard Tartler <siretart@tauware.de>	2020-12-02 09:24:47 -0500
committer	Reinhard Tartler <siretart@tauware.de>	2020-12-02 09:24:58 -0500
commit	29cc1453eab24cbbfcdd21b9b86a36ff3183a840 (patch)
tree	6a8ea32fea737936384e95e2ba2109dfc373697c /vendor/golang.org/x/text/language
parent	8086b728c2d5c06e05010693cdbe64e972a31128 (diff)